close

SimulationCraft 720-01

for World of Warcraft 7.2.0 Live (wow build level 23826, git build 7aba89f)

Current simulator hotfixes

Death Knight

Tag Spell / Effect Field Hotfixed Value DBC Value
2017-01-10 Portal to the Underworld damage increased by 33%.
Dragged to Helheim (effect#1) ap_coefficient 1.60 1.20

Druid

Tag Spell / Effect Field Hotfixed Value DBC Value
2016-12-18 Incorrect spell level for starfall damage component.
Starfall spell_level 40.00 76.00

Hunter

Tag Spell / Effect Field Hotfixed Value DBC Value
2017-3-31 Echo of Ohnaras proc chance increased to 20% (was 10%).
Echoes of Ohn'ara proc_chance 20.00 10.00
2017-1-8 Spelldata claims that Marking Target's rppm was buffed from 5 to 6.5, but testing shows higher.
Hunter's Mark rppm 7.20 6.50

Mage

Tag Spell / Effect Field Hotfixed Value DBC Value
2017-03-20 Manually set Frozen Orb's travel speed.
Frozen Orb prj_speed 20.00 0.00
2017-02-04 Manually set Flurry's travel speed.
Flurry prj_speed 45.00 0.00
2017-01-11 Incorrect spell level for Frozen Orb Bolt.
Frozen Orb spell_level 57.00 81.00

Mark of the Distant Army

Tag Spell / Effect Field Hotfixed Value DBC Value
2017-01-10 Set Velocity to a reasonable value.
Mark of the Distant Army prj_speed 40.00 1.00

Monk

Tag Spell / Effect Field Hotfixed Value DBC Value
2017-03-30 Split Personality cooldown reduction increased to 5 seconds per rank (was 3 seconds per rank). [Serentiy]
Split Personality (effect#2) base_value -5000.00 -3000.00
2017-03-29 Split Personality cooldown reduction increased to 5 seconds per rank (was 3 seconds per rank). [SEF]
Split Personality (effect#1) base_value -5000.00 -3000.00
2017-03-24 Windwalker Monks now deal 8% more damage with Tiger Palm, Blackout Kick, and Rising Sun Kick.
Windwalker Monk (effect#6) base_value 8.00 8.00

Paladin

Tag Spell / Effect Field Hotfixed Value DBC Value
2017-03-29 Righteous Verdict bonus increased to 8% per point (was 5% per point)
Righteous Verdict (effect#1) base_value 8.00 5.00

Table of Contents

Raid Summary

 

Actions per Minute / DPS Variance Summary

Alythess' : 1331660 dps, 797525 dps to main target

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR
1331660.4 1331660.4 1134.9 / 0.085% 228727.6 / 17.2% 42.2
RPS Out RPS In Primary Resource Waiting APM Active Skill
25192.2 25192.2 Mana 0.00% 50.1 100.0% 100%
Talents
  • 15: Roaring Blaze (Destruction Warlock)
  • 30: Eradication (Destruction Warlock)
  • 60: Soul Harvest
  • 90: Grimoire of Service
  • 100: Wreak Havoc (Destruction Warlock)
  • Talent Calculator
Artifact

Charts

Abilities

Damage Stats DPS DPS% Execute Interval DPE DPET Type Count Hit Crit Avg Crit% Up%
Alythess' 1331660
Chaos Bolt 396945 29.9% 61.5 4.75sec 1941751 1304160 Direct 117.5 0 1015897 1015897 100.0%  

Stats details: chaos_bolt

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 61.47 117.50 0.00 0.00 1.4889 0.0000 119368486.42 119368486.42 0.00 1304160.28 1304160.28
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
crit 117.50 100.00% 1015896.72 659654 1550681 1016177.20 951636 1088537 119368486 119368486 0.00
 
 

Action details: chaos_bolt

Static Values
  • id:116858
  • school:chromatic
  • resource:soul_shard
  • range:40.0
  • travel_speed:16.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:2.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:3.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:116858
  • name:Chaos Bolt
  • school:chromatic
  • tooltip:
  • description:Unleashes a devastating blast of chaos, causing {$s1=1} Chaos damage. Chaos Bolt always critically strikes and your critical strike chance increases its damage.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:4.000000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
Conflagrate 164917 12.4% 48.4 6.21sec 1023985 985388 Direct 96.2 292980 680439 514885 57.3%  

Stats details: conflagrate

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 48.36 96.18 0.00 0.00 1.0392 0.0000 49521669.61 49521669.61 0.00 985388.20 985388.20
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 41.09 42.73% 292980.27 192297 452039 293122.75 260002 337013 12039733 12039733 0.00
crit 55.09 57.27% 680439.26 384606 1078458 680535.07 603153 751779 37481937 37481937 0.00
 
 

Action details: conflagrate

Static Values
  • id:17962
  • school:fire
  • resource:chi
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:9.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:talent.roaring_blaze.enabled&(charges=2+set_bonus.tier19_4pc|(charges>=1+set_bonus.tier19_4pc&recharge_time<gcd)|target.time_to_die<24)
Spelldata
  • id:17962
  • name:Conflagrate
  • school:fire
  • tooltip:
  • description:Triggers an explosion on the target, dealing {$s1=1} Fire damage.{$?s196406=false}[ Reduces the cast time of Incinerate and Chaos Bolt by {$117828s1=30}% for {$117828d=10 seconds}.][] |cFFFFFFFFGenerates 1 Soul Shard.|r
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:2.265510
  • base_dd_min:1.00
  • base_dd_max:1.00
 
Cry Havoc 40860 3.1% 53.1 5.45sec 231297 0 Direct 106.3 96951 193877 115649 19.3%  

Stats details: cry_havoc

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 53.13 106.25 0.00 0.00 0.0000 0.0000 12287862.23 12287862.23 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 85.76 80.71% 96951.36 69248 145348 96999.66 90365 104543 8314039 8314039 0.00
crit 20.50 19.29% 193876.68 138497 290697 194002.00 162492 226258 3973823 3973823 0.00
 
 

Action details: cry_havoc

Static Values
  • id:243011
  • school:chromatic
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:243011
  • name:Cry Havoc
  • school:chromatic
  • tooltip:
  • description:Deals {$s2=0} Chaos damage to enemies within $A2 yards.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:1.000000
  • base_dd_min:0.00
  • base_dd_max:0.00
 
Deadly Grace 6201 0.5% 14.4 2.06sec 127256 0 Direct 14.4 106653 213305 127257 19.3%  

Stats details: deadly_grace

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 14.39 14.39 0.00 0.00 0.0000 0.0000 1830973.42 1830973.42 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 11.61 80.68% 106652.74 94564 113476 106662.36 97716 113476 1238080 1238080 0.00
crit 2.78 19.32% 213304.71 189127 226953 202480.67 0 226953 592893 592893 0.00
 
 

Action details: deadly_grace

Static Values
  • id:188091
  • school:arcane
  • resource:none
  • range:40.0
  • travel_speed:25.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:188091
  • name:Deadly Grace
  • school:arcane
  • tooltip:
  • description:Deal {$s1=63339 to 95008} Arcane damage.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:63338.72
  • base_dd_max:95008.08
 
Immolate 300095 22.5% 20.0 15.20sec 4507611 4283248 Direct 38.7 153142 306531 256320 67.3%  
Periodic 293.3 163611 326982 273502 67.3% 196.0%

Stats details: immolate

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 20.00 38.67 293.31 293.31 1.0524 2.0112 90132391.42 90132391.42 0.00 147526.81 4283248.18
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 12.66 32.73% 153142.42 101079 237594 153122.72 125572 182448 1938449 1938449 0.00
crit 26.01 67.27% 306531.25 202144 474974 306506.68 269970 344259 7972936 7972936 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 96.0 32.73% 163610.96 96 472050 163875.99 132900 201711 15708883 15708883 0.00
crit 197.3 67.27% 326981.70 62 944101 327482.98 289388 375887 64512124 64512124 0.00
 
 

Action details: immolate

Static Values
  • id:348
  • school:fire
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:66000.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:1.50
  • base_crit:0.48
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:remains<=tick_time
Spelldata
  • id:348
  • name:Immolate
  • school:fire
  • tooltip:
  • description:Burns the enemy, causing {$s1=1} Fire damage immediately and an additional $157736o1 Fire damage over {$157736d=18 seconds}. |cFFFFFFFFPeriodic damage has a {$193541s1=15}% chance to generate 1 Soul Shard. Chance doubled on critical strikes.|r
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:1.332000
  • base_dd_min:1.00
  • base_dd_max:1.00
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.721500
  • base_td:0.00
  • dot_duration:18.00
  • base_tick_time:3.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
 
Incinerate 144384 10.9% 75.1 3.84sec 578775 451966 Direct 143.5 253757 507641 302807 19.3%  

Stats details: incinerate

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 75.05 143.46 0.00 0.00 1.2806 0.0000 43439385.41 43439385.41 0.00 451966.30 451966.30
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 115.74 80.68% 253757.31 163381 384071 253830.76 238231 272326 29370247 29370247 0.00
crit 27.71 19.32% 507640.60 326774 768132 507810.50 449490 581652 14069138 14069138 0.00
 
 

Action details: incinerate

Static Values
  • id:29722
  • school:fire
  • resource:mana
  • range:40.0
  • travel_speed:20.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:66000.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:1.88
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:29722
  • name:Incinerate
  • school:fire
  • tooltip:
  • description:Draws fire toward the enemy, dealing {$s2=0} Fire damage.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:2.331000
  • base_dd_min:0.00
  • base_dd_max:0.00
 
Mark of the Hidden Satyr 10298 0.8% 20.0 15.05sec 154817 0 Direct 20.0 129793 259581 154822 19.3%  

Stats details: mark_of_the_hidden_satyr

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 19.99 19.99 0.00 0.00 0.0000 0.0000 3094725.21 3094725.21 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 16.14 80.72% 129792.88 123658 156215 129813.78 123658 142206 2094271 2094271 0.00
crit 3.85 19.28% 259580.52 247315 312430 254096.63 0 312430 1000454 1000454 0.00
 
 

Action details: mark_of_the_hidden_satyr

Static Values
  • id:191259
  • school:fire
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:191259
  • name:Mark of the Hidden Satyr
  • school:fire
  • tooltip:
  • description:Deals fire damage.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:2.500000
  • spell_power_mod.direct:2.000000
  • base_dd_min:0.00
  • base_dd_max:0.00
 
pet - imp 48924 / 48924
Firebolt 48924 3.7% 108.7 2.77sec 135198 111013 Direct 107.9 114217 228261 136246 19.3%  

Stats details: firebolt

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 108.74 107.90 0.00 0.00 1.2179 0.0000 14701357.17 14701357.17 0.00 111013.13 111013.13
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 87.06 80.68% 114217.09 72960 138253 114249.14 111272 116950 9943827 9943827 0.00
crit 20.84 19.32% 228261.37 145919 276506 228301.96 210152 247115 4757530 4757530 0.00
 
 

Action details: firebolt

Static Values
  • id:3110
  • school:fire
  • resource:energy
  • range:40.0
  • travel_speed:16.0000
  • trigger_gcd:0.5000
  • min_gcd:0.7500
  • base_cost:40.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:1.75
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:3110
  • name:Firebolt
  • school:fire
  • tooltip:
  • description:Deals {$s1=1} Fire damage to a target.$?a231795[ Damage increased by {$231795s1=50}% if you have Immolated the target.][] |cFF777777(Right-Click to toggle)|r
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:1.000000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
pet - service_imp 142021 / 45453
Firebolt 142021 3.4% 49.3 5.52sec 276348 242081 Direct 49.0 232927 465828 277936 19.3%  

Stats details: firebolt

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 49.29 49.00 0.00 0.00 1.1416 0.0000 13620199.18 13620199.18 0.00 242080.93 242080.93
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 39.53 80.67% 232927.28 145919 276506 233158.60 222177 242506 9208464 9208464 0.00
crit 9.47 19.33% 465828.00 291838 553011 466220.44 389118 553011 4411735 4411735 0.00
 
 

Action details: firebolt

Static Values
  • id:3110
  • school:fire
  • resource:energy
  • range:40.0
  • travel_speed:16.0000
  • trigger_gcd:0.5000
  • min_gcd:0.7500
  • base_cost:40.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:1.75
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:3110
  • name:Firebolt
  • school:fire
  • tooltip:
  • description:Deals {$s1=1} Fire damage to a target.$?a231795[ Damage increased by {$231795s1=50}% if you have Immolated the target.][] |cFF777777(Right-Click to toggle)|r
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:1.000000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
pet - infernal 134026 / 11350
Immolation 104391 0.7% 1.0 0.00sec 2609881 0 Periodic 46.5 47111 94223 56147 19.2% 8.1%

Stats details: immolation

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 23.24 46.48 0.0000 1.0476 2609881.40 2609881.40 0.00 107190.79 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 37.6 80.82% 47111.08 40681 48817 47115.91 45653 48420 1769939 1769939 0.00
crit 8.9 19.18% 94223.27 81362 97634 94236.35 81362 97634 839943 839943 0.00
 
 

Action details: immolation

Static Values
  • id:19483
  • school:fire
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:!ticking
Spelldata
  • id:19483
  • name:Immolation
  • school:fire
  • tooltip:Burns nearby enemies for {$20153s1=0} fire damage every $t1 seconds.
  • description:Burns nearby enemies for {$20153s1=0} fire damage every $t1 seconds.
 

Action details: immolation_tick

Static Values
  • id:20153
  • school:fire
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:20153
  • name:Immolation
  • school:fire
  • tooltip:
  • description:Deals Fire damage to all enemies near the caster.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.650000
  • base_dd_min:0.00
  • base_dd_max:0.00
 
melee 29635 0.2% 22.0 1.11sec 33639 30538 Direct 22.0 28213 56390 33639 19.3%  

Stats details: melee

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 22.03 22.03 0.00 0.00 1.1016 0.0000 740904.89 1089200.37 31.98 30537.67 30537.67
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 17.78 80.74% 28213.16 24327 29193 28213.08 27321 29193 501745 737613 31.98
crit 4.24 19.26% 56390.44 48655 58386 55892.40 0 58386 239160 351587 31.70
 
 

Action details: melee

Static Values
  • id:0
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Weapon
  • normalized:false
  • weapon_power_mod:0.285714
  • weapon_multiplier:1.00
 
pet - doomguard 110362 / 9338
Doom Bolt 110362 0.7% 11.0 2.20sec 251767 116790 Direct 11.0 211062 422325 251776 19.3%  

Stats details: doom_bolt

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 10.96 10.96 0.00 0.00 2.1557 0.0000 2759159.19 2759159.19 0.00 116789.81 116789.81
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 8.85 80.73% 211062.41 204037 244844 211074.83 204037 244844 1867144 1867144 0.00
crit 2.11 19.27% 422325.03 408074 489688 379303.22 0 489688 892016 892016 0.00
 
 

Action details: doom_bolt

Static Values
  • id:85692
  • school:shadow
  • resource:energy
  • range:30.0
  • travel_speed:20.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:35.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:3.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:85692
  • name:Doom Bolt
  • school:shadow
  • tooltip:
  • description:Sends a shadowy bolt at the enemy, causing {$s1=1} Shadow damage. Deals {$s2=20}% additional damage to targets below 20% health.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:2.750000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
pet - lord_of_flames_infernal 134170 / 11362
Immolation 104559 0.7% 1.0 0.00sec 2614087 0 Periodic 46.5 47109 94237 56238 19.4% 8.1%

Stats details: immolation

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 23.24 46.48 0.0000 1.0476 2614086.60 2614086.60 0.00 107363.50 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 37.5 80.63% 47109.45 40681 48817 47114.03 45706 48352 1765733 1765733 0.00
crit 9.0 19.37% 94236.88 81362 97634 94241.24 81362 97634 848353 848353 0.00
 
 

Action details: immolation

Static Values
  • id:19483
  • school:fire
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:!ticking
Spelldata
  • id:19483
  • name:Immolation
  • school:fire
  • tooltip:Burns nearby enemies for {$20153s1=0} fire damage every $t1 seconds.
  • description:Burns nearby enemies for {$20153s1=0} fire damage every $t1 seconds.
 

Action details: immolation_tick

Static Values
  • id:20153
  • school:fire
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:20153
  • name:Immolation
  • school:fire
  • tooltip:
  • description:Deals Fire damage to all enemies near the caster.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.650000
  • base_dd_min:0.00
  • base_dd_max:0.00
 
melee 29611 0.2% 22.0 1.11sec 33612 30513 Direct 22.0 28208 56434 33612 19.1%  

Stats details: melee

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 22.03 22.03 0.00 0.00 1.1016 0.0000 740308.81 1088324.08 31.98 30513.10 30513.10
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 17.81 80.86% 28207.94 24327 29193 28208.12 27424 29193 502341 738489 31.98
crit 4.22 19.14% 56434.26 48655 58386 55910.36 0 58386 237968 349835 31.68
 
 

Action details: melee

Static Values
  • id:0
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Weapon
  • normalized:false
  • weapon_power_mod:0.285714
  • weapon_multiplier:1.00
 
pet - lord_of_flames_infernal 134160 / 11361
Immolation 104508 0.7% 1.0 0.00sec 2612812 0 Periodic 46.5 47111 94224 56209 19.3% 8.1%

Stats details: immolation

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 23.24 46.48 0.0000 1.0476 2612812.35 2612812.35 0.00 107311.17 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 37.5 80.69% 47110.93 40681 48817 47115.38 45653 48222 1767008 1767008 0.00
crit 9.0 19.31% 94224.49 81362 97634 94232.43 0 97634 845805 845805 0.00
 
 

Action details: immolation

Static Values
  • id:19483
  • school:fire
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:!ticking
Spelldata
  • id:19483
  • name:Immolation
  • school:fire
  • tooltip:Burns nearby enemies for {$20153s1=0} fire damage every $t1 seconds.
  • description:Burns nearby enemies for {$20153s1=0} fire damage every $t1 seconds.
 

Action details: immolation_tick

Static Values
  • id:20153
  • school:fire
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:20153
  • name:Immolation
  • school:fire
  • tooltip:
  • description:Deals Fire damage to all enemies near the caster.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.650000
  • base_dd_min:0.00
  • base_dd_max:0.00
 
melee 29652 0.2% 22.0 1.11sec 33658 30555 Direct 22.0 28208 56435 33658 19.3%  

Stats details: melee

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 22.03 22.03 0.00 0.00 1.1016 0.0000 741319.96 1089810.56 31.98 30554.78 30554.78
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 17.77 80.69% 28207.87 24327 29193 28207.62 27166 29193 501330 737003 31.98
crit 4.25 19.31% 56434.72 48655 58386 55968.59 0 58386 239990 352808 31.71
 
 

Action details: melee

Static Values
  • id:0
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Weapon
  • normalized:false
  • weapon_power_mod:0.285714
  • weapon_multiplier:1.00
 
pet - lord_of_flames_infernal 134114 / 11358
Immolation 104453 0.7% 1.0 0.00sec 2611424 0 Periodic 46.5 47114 94195 56180 19.3% 8.1%

Stats details: immolation

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 23.24 46.48 0.0000 1.0476 2611424.18 2611424.18 0.00 107254.16 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 37.5 80.75% 47114.46 40681 48817 47119.07 45896 48430 1768396 1768396 0.00
crit 8.9 19.25% 94194.89 81362 97634 94197.08 81362 97634 843028 843028 0.00
 
 

Action details: immolation

Static Values
  • id:19483
  • school:fire
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:!ticking
Spelldata
  • id:19483
  • name:Immolation
  • school:fire
  • tooltip:Burns nearby enemies for {$20153s1=0} fire damage every $t1 seconds.
  • description:Burns nearby enemies for {$20153s1=0} fire damage every $t1 seconds.
 

Action details: immolation_tick

Static Values
  • id:20153
  • school:fire
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:20153
  • name:Immolation
  • school:fire
  • tooltip:
  • description:Deals Fire damage to all enemies near the caster.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.650000
  • base_dd_min:0.00
  • base_dd_max:0.00
 
melee 29661 0.2% 22.0 1.11sec 33669 30565 Direct 22.0 28210 56415 33670 19.4%  

Stats details: melee

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 22.03 22.03 0.00 0.00 1.1016 0.0000 741565.69 1090171.80 31.98 30564.90 30564.90
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 17.76 80.65% 28210.28 24327 29193 28210.33 27166 29193 501084 736641 31.98
crit 4.26 19.35% 56414.61 48655 58386 55932.99 0 58386 240481 353530 31.71
 
 

Action details: melee

Static Values
  • id:0
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Weapon
  • normalized:false
  • weapon_power_mod:0.285714
  • weapon_multiplier:1.00
 
pet - shadowy_tear 135256 / 18067
Shadow Bolt 135256 1.4% 3.3 70.70sec 1630600 0 Periodic 36.6 123853 248092 147812 19.3% 15.0%

Stats details: shadow_bolt

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 3.31 0.00 36.77 36.56 0.0000 1.2270 5404609.39 5404609.39 0.00 119793.63 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 29.5 80.71% 123852.51 79 150208 123170.77 0 150208 3655070 3655070 0.00
crit 7.1 19.29% 248091.88 163 300416 243544.73 0 300416 1749540 1749540 0.00
 
 

Action details: shadow_bolt

Static Values
  • id:196657
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:20.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:196657
  • name:Shadow Bolt
  • school:shadow
  • tooltip:
  • description:Sends a shadowy bolt at the enemy, causing {$s1=1} Shadow damage.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • dot_duration:14.00
  • base_tick_time:2.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
 
pet - flame_rift 284524 / 79476
Searing Bolt 284524 5.9% 65.9 2.66sec 361030 1107525 Direct 65.5 64195 0 64195 0.0%  
Periodic 139.8 117464 234899 140032 19.2% 45.9%

Stats details: searing_bolt

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 65.86 65.49 139.78 139.78 0.3260 0.9895 23777464.16 23777464.16 0.00 148814.70 1107525.46
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 65.49 100.00% 64195.33 59452 75105 64208.42 0 75105 4204410 4204410 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 112.9 80.78% 117463.60 119 150235 116945.62 0 133781 13263429 13263429 0.00
crit 26.9 19.22% 234899.02 238 300471 233565.17 0 300471 6309625 6309625 0.00
 
 

Action details: searing_bolt

Static Values
  • id:243050
  • school:fire
  • resource:energy
  • range:100.0
  • travel_speed:20.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:1.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:243050
  • name:Searing Bolt
  • school:fire
  • tooltip:Burning for $w2 Fire damage every $t2 sec.
  • description:Sends a searing bolt at the enemy, causing {$s1=1} Fire damage, and an additional $o2 Fire damage over {$d=30 seconds}, stacking up to {$u=20} times.
Direct Damage
  • may_crit:false
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:1.000000
  • base_dd_min:1.00
  • base_dd_max:1.00
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.100000
  • base_td:1.00
  • dot_duration:30.00
  • base_tick_time:1.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
 
pet - chaos_tear 157885 / 8386
Chaos Bolt 157885 0.6% 3.3 70.88sec 759888 382180 Direct 3.3 0 765251 765251 100.0%  

Stats details: chaos_bolt

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 3.31 3.29 0.00 0.00 1.9883 0.0000 2513980.73 2513980.73 0.00 382180.10 382180.10
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
crit 3.29 100.00% 765250.94 709162 895874 765456.64 0 895874 2513981 2513981 0.00
 
 

Action details: chaos_bolt

Static Values
  • id:215279
  • school:chromatic
  • resource:none
  • range:100.0
  • travel_speed:16.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:5.500
  • base_execute_time:3.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:215279
  • name:Chaos Bolt
  • school:chromatic
  • tooltip:
  • description:Unleashes a devastating blast of chaos, causing {$s1=1} Chaos damage. Chaos Bolt always critically strikes and your critical strike chance increases its damage.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:5.000000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
pet - chaos_portal 283043 / 16329
Chaos Barrage 283043 1.2% 3.3 71.15sec 1474478 0 Periodic 116.0 35294 70563 42107 19.3% 6.0%

Stats details: chaos_barrage

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 3.31 0.00 116.49 115.99 0.0000 0.1545 4883866.73 4883866.73 0.00 271295.79 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 93.6 80.68% 35294.37 144 41308 35164.34 0 41308 3302965 3302965 0.00
crit 22.4 19.32% 70563.40 344 82617 70253.44 0 82617 1580902 1580902 0.00
 
 

Action details: chaos_barrage

Static Values
  • id:187394
  • school:magic
  • resource:none
  • range:100.0
  • travel_speed:24.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:187394
  • name:Chaos Barrage
  • school:magic
  • tooltip:
  • description:Deals {$s1=1} Chaos damage.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • dot_duration:5.50
  • base_tick_time:0.25
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
 
Simple Action Stats Execute Interval
Alythess'
augmentation 1.0 0.00sec

Stats details: augmentation

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: augmentation

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Alythess'
  • harmful:false
  • if_expr:
 
Berserking 2.1 180.65sec

Stats details: berserking

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.06 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: berserking

Static Values
  • id:26297
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:180.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:26297
  • name:Berserking
  • school:physical
  • tooltip:Haste increased by {$s1=15}%.
  • description:Increases your haste by {$s1=15}% for {$d=10 seconds}.
 
Dimensional Rift 12.9 23.68sec

Stats details: dimensional_rift

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 12.90 0.00 0.00 0.00 1.0102 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: dimensional_rift

Static Values
  • id:196586
  • school:none
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:45.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:charges=3
Spelldata
  • id:196586
  • name:Dimensional Rift
  • school:chaos
  • tooltip:
  • description:Rips a hole in time and space, opening a portal that damages your target.
 
flask 1.0 0.00sec

Stats details: flask

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: flask

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Alythess'
  • harmful:false
  • if_expr:
 
food 1.0 0.00sec

Stats details: food

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: food

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Alythess'
  • harmful:false
  • if_expr:
 
Havoc 14.9 20.93sec

Stats details: havoc

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 14.88 0.00 0.00 0.00 1.0682 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: havoc

Static Values
  • id:80240
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:88000.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:active_enemies>1&(active_enemies<4|talent.wreak_havoc.enabled&active_enemies<6)&!debuff.havoc.remains
Spelldata
  • id:80240
  • name:Havoc
  • school:shadow
  • tooltip:Spells cast by the Warlock also hit this target.
  • description:Marks a target with Havoc for {$d=8 seconds}, causing your single target spells to also strike the Havoc victim. Limit 1.
 
Life Tap 6.6 33.93sec

Stats details: life_tap

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 6.56 0.00 0.00 0.00 1.0414 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: life_tap

Static Values
  • id:1454
  • school:shadow
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:talent.empowered_life_tap.enabled&!buff.empowered_life_tap.remains
Spelldata
  • id:1454
  • name:Life Tap
  • school:shadow
  • tooltip:
  • description:Restores {$s1=30}% of your maximum mana, at the cost of {$s2=10}% of your maximum health.
 
potion 2.0 0.00sec

Stats details: potion

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: potion

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:60.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
 
Grimoire: Imp (service_imp) 3.7 91.34sec

Stats details: service_imp

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 3.69 0.00 0.00 0.00 0.9703 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: service_imp

Static Values
  • id:111859
  • school:shadow
  • resource:soul_shard
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:1.0
  • secondary_cost:0.0
  • cooldown:90.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:111859
  • name:Grimoire: Imp
  • school:shadow
  • tooltip:
  • description:Summons an Imp who attacks the target for {$108501s1=25} sec. Imps cast ranged Firebolts and cleanse a hostile magic effect from their master.
 
Soul Harvest 2.9 120.90sec

Stats details: soul_harvest

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.90 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: soul_harvest

Static Values
  • id:196098
  • school:shadow
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:120.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:196098
  • name:Soul Harvest
  • school:shadow
  • tooltip:Damage increased by {$s1=20}%.
  • description:Increases your damage and your pets' damage by {$s1=20}%. Lasts {$d=15 seconds}, increased by {$s2=2} sec for each target afflicted by your {$?s137043=false}[Agony][]{$?s137044=false}[Doom][]{$?s137046=false}[Immolate][], up to a maximum of {$s3=35} sec.
 
Summon Doomguard 1.0 0.00sec

Stats details: summon_doomguard

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 1.0789 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: summon_doomguard

Static Values
  • id:18540
  • school:shadow
  • resource:soul_shard
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:1.0
  • secondary_cost:0.0
  • cooldown:180.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:talent.grimoire_of_supremacy.enabled&active_enemies=1&artifact.lord_of_flames.rank=0
Spelldata
  • id:18540
  • name:Summon Doomguard
  • school:shadow
  • tooltip:
  • description:Summons a Doomguard for {$60478d=25 seconds} to assault the target with its Doom Bolts.
 
Summon Imp 1.0 0.00sec

Stats details: summon_imp

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: summon_imp

Static Values
  • id:688
  • school:shadow
  • resource:soul_shard
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:1.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:2.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:!talent.grimoire_of_supremacy.enabled&(!talent.grimoire_of_sacrifice.enabled|buff.demonic_power.down)
Spelldata
  • id:688
  • name:Summon Imp
  • school:shadow
  • tooltip:
  • description:Summons an Imp under your command that casts ranged Firebolts.$?s74434[ |cFFFFFFFFSoulburn:|r |cFF8282FFInstant cast.|r][]
 
Summon Infernal 1.0 0.00sec

Stats details: summon_infernal

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.7577 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: summon_infernal

Static Values
  • id:1122
  • school:shadow
  • resource:soul_shard
  • range:30.0
  • travel_speed:1.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:1.0
  • secondary_cost:0.0
  • cooldown:180.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:talent.grimoire_of_supremacy.enabled&artifact.lord_of_flames.rank>0
Spelldata
  • id:1122
  • name:Summon Infernal
  • school:shadow
  • tooltip:
  • description:Summons an Infernal from the Twisting Nether, impacting for {$22703s1=0} Fire damage and stunning all enemy targets in the area for {$22703d=2 seconds}. The Infernal will serve you for {$111685d=25 seconds}, dealing strong area-of-effect damage.
 

Buffs

Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit Overflow Expiry
Accelerando 20.1 0.0 15.4sec 15.4sec 78.48% 78.48% 1.5(1.5) 19.3

Buff details

  • buff initial source:Alythess'
  • cooldown name:buff_accelerando
  • max_stacks:5
  • duration:12.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00

Stat Buff details

  • stat:haste_rating
  • amount:734.41

Stack Uptimes

  • accelerando_1:29.70%
  • accelerando_2:24.50%
  • accelerando_3:14.71%
  • accelerando_4:6.56%
  • accelerando_5:3.02%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:225719
  • name:Accelerando
  • tooltip:Haste increased by $w1.
  • description:{$@spelldesc225125=Your damaging spells have a chance to grant you {$225719s1=528} Haste for {$225719d=12 seconds}, stacking up to 5 times. Stacking does not refresh duration.}
  • max_stacks:5
  • duration:12.00
  • cooldown:0.00
  • default_chance:101.00%
Berserking 2.1 0.0 180.6sec 180.6sec 6.86% 8.55% 0.0(0.0) 2.0

Buff details

  • buff initial source:Alythess'
  • cooldown name:buff_berserking
  • max_stacks:1
  • duration:10.00
  • cooldown:180.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • berserking_1:6.86%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:26297
  • name:Berserking
  • tooltip:Haste increased by {$s1=15}%.
  • description:Increases your haste by {$s1=15}% for {$d=10 seconds}.
  • max_stacks:0
  • duration:10.00
  • cooldown:180.00
  • default_chance:0.00%
Bloodlust 1.0 0.0 0.0sec 0.0sec 13.55% 13.55% 0.0(0.0) 1.0

Buff details

  • buff initial source:Alythess'
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • duration:40.00
  • cooldown:300.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • bloodlust_1:13.55%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:2825
  • name:Bloodlust
  • tooltip:Haste increased by {$s1=30}%.
  • description:Increases Haste by {$s1=30}% for all party and raid members for {$d=40 seconds}. Allies receiving this effect will become Sated and unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.
  • max_stacks:0
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
Conflagration of Chaos 24.2 0.0 12.3sec 12.3sec 49.28% 47.08% 0.0(0.0) 0.9

Buff details

  • buff initial source:Alythess'
  • cooldown name:buff_conflagration_of_chaos
  • max_stacks:1
  • duration:20.00
  • cooldown:0.00
  • default_chance:50.00%
  • default_value:-0.00

Stack Uptimes

  • conflagration_of_chaos_1:49.28%

Trigger Attempt Success

  • trigger_pct:49.99%

Spelldata details

  • id:196546
  • name:Conflagration of Chaos
  • tooltip:Your {$?s17877=false}[Shadowburn][Conflagrate] will always critically strike. Critical strike chance will increase the critical strike damage of {$?s17877=false}[Shadowburn][Conflagrate].
  • description:{$@spelldesc219195={$?s17877=false}[Shadowburn][Conflagrate] has a chance to guarantee your next {$?s17877=false}[Shadowburn][Conflagrate] critically strikes, and to increase its damage by your critical strike chance.}
  • max_stacks:0
  • duration:20.00
  • cooldown:0.00
  • default_chance:100.00%
Devil's Due 3.4 0.0 69.6sec 69.6sec 8.65% 8.65% 0.0(0.0) 3.2

Buff details

  • buff initial source:Alythess'
  • cooldown name:buff_devils_due
  • max_stacks:1
  • duration:8.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.18

Stack Uptimes

  • devils_due_1:8.65%

Trigger Attempt Success

  • trigger_pct:99.94%

Spelldata details

  • id:225776
  • name:Devil's Due
  • tooltip:Cast speed slowed by {$s1=7}%.
  • description:{$@spelldesc225142=Your damaging spells have a chance to grant Nefarious Pact, increasing your casting speed by {$225774s1=17}% for {$225774d=12 seconds}. When Nefarious Pact expires, your casting speed is decreased by {$225776s1=7}% for {$225776d=8 seconds}.}
  • max_stacks:0
  • duration:8.00
  • cooldown:0.00
  • default_chance:0.00%
Embrace Chaos 33.4 29.1 9.1sec 4.8sec 67.57% 80.32% 29.1(29.1) 32.7

Buff details

  • buff initial source:Alythess'
  • cooldown name:buff_embrace_chaos
  • max_stacks:1
  • duration:4.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • embrace_chaos_1:67.57%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:212019
  • name:Embrace Chaos
  • tooltip:Chaos Bolt has {$s1=40}% reduced cast time.
  • description:{$@spelldesc212018=Casting Chaos Bolt reduces the cast time of your next Chaos Bolt by {$212019s1=40}% for {$212019d=4 seconds}.}
  • max_stacks:0
  • duration:4.00
  • cooldown:0.00
  • default_chance:0.00%
Lord of Flames 1.0 0.0 0.0sec 0.0sec 97.88% 97.88% 0.0(0.0) 0.0

Buff details

  • buff initial source:Alythess'
  • cooldown name:buff_lord_of_flames
  • max_stacks:1
  • duration:600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • lord_of_flames_1:97.88%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:226802
  • name:Lord of Flames
  • tooltip:Recently activated Lord of Flames.
  • description:{$@spelldesc224103=Once every {$s2=10} minutes, {$?s152107=false}[your Infernal's Meteor Strike][Summon Infernal] will summon {$s3=3} additional Infernals to serve you for {$226804d=25 seconds}.}
  • max_stacks:0
  • duration:600.00
  • cooldown:0.00
  • default_chance:0.00%
Nefarious Pact 3.4 0.0 70.0sec 69.2sec 13.45% 13.45% 0.0(0.0) 3.3

Buff details

  • buff initial source:Alythess'
  • cooldown name:buff_nefarious_pact
  • max_stacks:1
  • duration:12.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.44

Stack Uptimes

  • nefarious_pact_1:13.45%

Trigger Attempt Success

  • trigger_pct:99.94%

Spelldata details

  • id:225774
  • name:Nefarious Pact
  • tooltip:Cast speed increased by {$s1=17}%.
  • description:{$@spelldesc225142=Your damaging spells have a chance to grant Nefarious Pact, increasing your casting speed by {$225774s1=17}% for {$225774d=12 seconds}. When Nefarious Pact expires, your casting speed is decreased by {$225776s1=7}% for {$225776d=8 seconds}.}
  • max_stacks:0
  • duration:12.00
  • cooldown:0.00
  • default_chance:0.00%
Potion of Deadly Grace 1.0 0.0 0.0sec 0.0sec 10.16% 10.16% 0.0(0.0) 1.0

Buff details

  • buff initial source:Alythess'
  • cooldown name:buff_potion_of_deadly_grace
  • max_stacks:1
  • duration:30.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • potion_of_deadly_grace_1:10.16%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:188027
  • name:Potion of Deadly Grace
  • tooltip:Your attacks have a chance to unleash a bolt of energy at your target.
  • description:Grants your attacks a chance to unleash a bolt of energy at your target. Staying away from enemies for the entire duration of the effect will extend the effect by an additional 5 seconds.
  • max_stacks:0
  • duration:25.00
  • cooldown:1.00
  • default_chance:101.00%
Potion of Prolonged Power 1.0 0.0 0.0sec 0.0sec 19.64% 19.64% 0.0(0.0) 1.0

Buff details

  • buff initial source:Alythess'
  • cooldown name:buff_potion_of_prolonged_power
  • max_stacks:1
  • duration:60.00
  • cooldown:1.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:all
  • amount:2500.00

Stack Uptimes

  • potion_of_prolonged_power_1:19.64%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:229206
  • name:Potion of Prolonged Power
  • tooltip:All stats increased by {$s1=2500}.
  • description:Drink to increase all stats by {$s1=2500} for {$d=60 seconds}.
  • max_stacks:0
  • duration:60.00
  • cooldown:1.00
  • default_chance:0.00%
Soul Harvest 2.9 0.0 120.9sec 120.9sec 17.79% 17.79% 0.0(0.0) 2.7

Buff details

  • buff initial source:Alythess'
  • cooldown name:buff_soul_harvest
  • max_stacks:1
  • duration:15.00
  • cooldown:120.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • soul_harvest_1:17.79%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:196098
  • name:Soul Harvest
  • tooltip:Damage increased by {$s1=20}%.
  • description:Increases your damage and your pets' damage by {$s1=20}%. Lasts {$d=15 seconds}, increased by {$s2=2} sec for each target afflicted by your {$?s137043=false}[Agony][]{$?s137044=false}[Doom][]{$?s137046=false}[Immolate][], up to a maximum of {$s3=35} sec.
  • max_stacks:0
  • duration:15.00
  • cooldown:120.00
  • default_chance:0.00%
Constant Buffs
Well Fed (azshari_salad)

Buff details

  • buff initial source:Alythess'
  • cooldown name:buff_azshari_salad
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:haste_rating
  • amount:375.00

Stack Uptimes

  • azshari_salad_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:225603
  • name:Well Fed
  • tooltip:Haste increased by $w1.
  • description:Increases haste by {$s1=375} for {$d=3600 seconds}.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Defiled Augmentation

Buff details

  • buff initial source:Alythess'
  • cooldown name:buff_defiled_augmentation
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:agility
  • amount:325.00
  • stat:strength
  • amount:325.00
  • stat:intellect
  • amount:325.00

Stack Uptimes

  • defiled_augmentation_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:224001
  • name:Defiled Augmentation
  • tooltip:Agility, Intellect and Strength increased by $w1.
  • description:Increases Agility, Intellect and Strength by {$s1=325} for {$d=3600 seconds}. Augment Rune.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Flask of the Whispered Pact

Buff details

  • buff initial source:Alythess'
  • cooldown name:buff_flask_of_the_whispered_pact
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:intellect
  • amount:1300.00

Stack Uptimes

  • flask_of_the_whispered_pact_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:188031
  • name:Flask of the Whispered Pact
  • tooltip:Intellect increased by $w1.
  • description:Increases Intellect by {$s1=1300} for {$d=3600 seconds}. Counts as both a Battle and Guardian elixir. This effect persists through death.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:101.00%
Tormented Souls

Buff details

  • buff initial source:Alythess'
  • cooldown name:buff_tormented_souls
  • max_stacks:12
  • duration:0.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00

Stack Uptimes

  • tormented_souls_2:0.37%
  • tormented_souls_3:99.63%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:216695
  • name:Tormented Souls
  • tooltip:Activate Reap Souls to consume all Tormented Souls collected by |cFFFFCC99Ulthalesh|r, increasing your damage by 10% and doubling the effect of all of |cFFFFCC99Ulthalesh|r's other traits for {$216708d=5 seconds} per soul consumed.
  • description:Activate Reap Souls to consume all Tormented Souls collected by |cFFFFCC99Ulthalesh|r, increasing your damage by 10% and doubling the effect of all of |cFFFFCC99Ulthalesh|r's other traits for {$216708d=5 seconds} per soul consumed.
  • max_stacks:12
  • duration:-0.00
  • cooldown:0.00
  • default_chance:101.00%

Procs

Count Interval
shadowy_tear 3.2 70.6sec
flame_rift 3.2 70.9sec
chaos_tear 3.2 70.9sec
chaos_portal 3.2 71.1sec
dimension_ripper 3.8 56.6sec
t19_2pc_chaos_bolt 44.1 6.6sec

Resources

Resource Usage Type Count Total Average RPE APR
Alythess'
chaos_bolt Soul Shard 62.5 125.0 2.0 2.0 955320.0
havoc Mana 14.9 1309803.9 88000.0 88000.3 0.0
immolate Mana 20.0 1319709.7 66000.0 66000.0 68.3
incinerate Mana 75.1 4953510.1 66000.0 65999.3 8.8
service_imp Soul Shard 3.7 3.7 1.0 1.0 0.0
summon_doomguard Soul Shard 1.0 1.0 1.0 1.0 0.0
summon_infernal Soul Shard 1.0 1.0 1.0 1.0 0.0
pet - imp
firebolt Energy 108.7 4349.6 40.0 40.0 3380.0
pet - service_imp
firebolt Energy 49.3 1971.5 40.0 40.0 6908.5
pet - doomguard
doom_bolt Energy 11.0 383.6 35.0 35.0 7193.4
pet - flame_rift
searing_bolt Energy 64.0 64.0 1.0 1.0 371485.2
Resource Gains Type Count Total Average Overflow
life_tap Mana 6.56 2165536.34 (32.24%) 330000.00 0.00 0.00%
immolate Soul Shard 73.48 72.33 (55.66%) 0.98 1.16 1.57%
conflagrate Soul Shard 48.36 48.25 (37.14%) 1.00 0.11 0.22%
mp5_regen Mana 521.38 4550901.42 (67.76%) 8728.54 76242.27 1.65%
soulsnatcher Soul Shard 9.36 9.36 (7.20%) 1.00 0.00 0.00%
pet - imp
energy_regen Energy 1900.22 4183.26 (100.00%) 2.20 21.59 0.51%
pet - service_imp
energy_regen Energy 444.80 1350.10 (100.00%) 3.04 61.93 4.39%
pet - doomguard
energy_regen Energy 15.79 342.61 (100.00%) 21.70 42.79 11.10%
Resource RPS-Gain RPS-Loss
Health 0.00 7141.94
Mana 22313.37 25192.23
Soul Shard 0.43 0.43
Combat End Resource Mean Min Max
Mana 233899.42 9843.66 518153.78
Soul Shard 2.28 0.00 5.00

Benefits & Uptimes

Benefits %
Uptimes %
Mana Cap 1.2%

Statistics & Data Analysis

Fight Length
Sample Data Alythess' Fight Length
Count 9999
Mean 301.01
Minimum 217.68
Maximum 385.07
Spread ( max - min ) 167.39
Range [ ( max - min ) / 2 * 100% ] 27.80%
DPS
Sample Data Alythess' Damage Per Second
Count 9999
Mean 1331660.44
Minimum 1141837.73
Maximum 1577562.05
Spread ( max - min ) 435724.32
Range [ ( max - min ) / 2 * 100% ] 16.36%
Standard Deviation 57902.2741
5th Percentile 1241791.45
95th Percentile 1432901.68
( 95th Percentile - 5th Percentile ) 191110.23
Mean Distribution
Standard Deviation 579.0517
95.00% Confidence Intervall ( 1330525.52 - 1332795.37 )
Normalized 95.00% Confidence Intervall ( 99.91% - 100.09% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 73
0.1% Error 7263
0.1 Scale Factor Error with Delta=300 28620348
0.05 Scale Factor Error with Delta=300 114481392
0.01 Scale Factor Error with Delta=300 2862034798
Priority Target DPS
Sample Data Alythess' Priority Target Damage Per Second
Count 9999
Mean 797524.99
Minimum 661778.68
Maximum 997761.63
Spread ( max - min ) 335982.94
Range [ ( max - min ) / 2 * 100% ] 21.06%
Standard Deviation 44351.5825
5th Percentile 730123.71
95th Percentile 874712.78
( 95th Percentile - 5th Percentile ) 144589.08
Mean Distribution
Standard Deviation 443.5380
95.00% Confidence Intervall ( 796655.67 - 798394.31 )
Normalized 95.00% Confidence Intervall ( 99.89% - 100.11% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 119
0.1% Error 11881
0.1 Scale Factor Error with Delta=300 16791981
0.05 Scale Factor Error with Delta=300 67167921
0.01 Scale Factor Error with Delta=300 1679198004
DPS(e)
Sample Data Alythess' Damage Per Second (Effective)
Count 9999
Mean 1331660.44
Minimum 1141837.73
Maximum 1577562.05
Spread ( max - min ) 435724.32
Range [ ( max - min ) / 2 * 100% ] 16.36%
Damage
Sample Data Alythess' Damage
Count 9999
Mean 319675493.72
Minimum 224890890.19
Maximum 424288201.19
Spread ( max - min ) 199397311.00
Range [ ( max - min ) / 2 * 100% ] 31.19%
DTPS
Sample Data Alythess' Damage Taken Per Second
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HPS
Sample Data Alythess' Healing Per Second
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
HPS(e)
Sample Data Alythess' Healing Per Second (Effective)
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
Sample Data Alythess' Heal
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
Sample Data Alythess' Healing Taken Per Second
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
TMI
Sample Data Alythess' Theck-Meloree Index
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
ETMI
Sample Data Alythess'Theck-Meloree Index (Effective)
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
MSD
Sample Data Alythess' Max Spike Value
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 flask,type=whispered_pact
1 0.00 food,type=azshari_salad
2 0.00 summon_pet,if=!talent.grimoire_of_supremacy.enabled&(!talent.grimoire_of_sacrifice.enabled|buff.demonic_power.down)
3 0.00 summon_infernal,if=talent.grimoire_of_supremacy.enabled&artifact.lord_of_flames.rank>0
4 0.00 summon_infernal,if=talent.grimoire_of_supremacy.enabled&active_enemies>1
5 0.00 summon_doomguard,if=talent.grimoire_of_supremacy.enabled&active_enemies=1&artifact.lord_of_flames.rank=0
6 0.00 augmentation,type=defiled
7 0.00 snapshot_stats
8 0.00 grimoire_of_sacrifice,if=talent.grimoire_of_sacrifice.enabled
9 0.00 life_tap,if=talent.empowered_life_tap.enabled&!buff.empowered_life_tap.remains
A 0.00 potion,name=prolonged_power
B 0.00 chaos_bolt
Default action list Executed every time the actor is available.
# count action,conditions
C 14.88 havoc,target=2,if=active_enemies>1&(active_enemies<4|talent.wreak_havoc.enabled&active_enemies<6)&!debuff.havoc.remains
D 1.00 dimensional_rift,if=charges=3
E 10.34 immolate,if=remains<=tick_time
F 0.65 immolate,cycle_targets=1,if=active_enemies>1&remains<=tick_time&(!talent.roaring_blaze.enabled|(!debuff.roaring_blaze.remains&action.conflagrate.charges<2+set_bonus.tier19_4pc))
G 9.04 immolate,if=talent.roaring_blaze.enabled&remains<=duration&!debuff.roaring_blaze.remains&target.time_to_die>10&(action.conflagrate.charges=2+set_bonus.tier19_4pc|(action.conflagrate.charges>=1+set_bonus.tier19_4pc&action.conflagrate.recharge_time<cast_time+gcd)|target.time_to_die<24)
H 2.06 berserking
0.00 blood_fury
0.00 arcane_torrent
I 1.00 potion,name=deadly_grace,if=(buff.soul_harvest.remains|trinket.proc.any.react|target.time_to_die<=45)
0.00 shadowburn,if=buff.conflagration_of_chaos.remains<=action.chaos_bolt.cast_time
0.00 shadowburn,if=(charges=1+set_bonus.tier19_4pc&recharge_time<action.chaos_bolt.cast_time|charges=2+set_bonus.tier19_4pc)&soul_shard<5
J 14.03 conflagrate,if=talent.roaring_blaze.enabled&(charges=2+set_bonus.tier19_4pc|(charges>=1+set_bonus.tier19_4pc&recharge_time<gcd)|target.time_to_die<24)
K 34.34 conflagrate,if=talent.roaring_blaze.enabled&debuff.roaring_blaze.stack>0&dot.immolate.remains>dot.immolate.duration*0.3&(active_enemies=1|soul_shard<3)&soul_shard<5
0.00 conflagrate,if=!talent.roaring_blaze.enabled&buff.backdraft.stack<3&buff.conflagration_of_chaos.remains<=action.chaos_bolt.cast_time
0.00 conflagrate,if=!talent.roaring_blaze.enabled&buff.backdraft.stack<3&(charges=1+set_bonus.tier19_4pc&recharge_time<action.chaos_bolt.cast_time|charges=2+set_bonus.tier19_4pc)&soul_shard<5
0.00 life_tap,if=talent.empowered_life_tap.enabled&buff.empowered_life_tap.remains<=gcd
0.00 dimensional_rift,if=equipped.144369&!buff.lessons_of_spacetime.remains&((!talent.grimoire_of_supremacy.enabled&!cooldown.summon_doomguard.remains)|(talent.grimoire_of_service.enabled&!cooldown.service_pet.remains)|(talent.soul_harvest.enabled&!cooldown.soul_harvest.remains))
L 3.69 service_pet
M 1.00 summon_infernal,if=artifact.lord_of_flames.rank>0&!buff.lord_of_flames.remains
N 1.00 summon_doomguard,if=!talent.grimoire_of_supremacy.enabled&spell_targets.infernal_awakening<=2&(target.time_to_die>180|target.health.pct<=20|target.time_to_die<30)
0.00 summon_infernal,if=!talent.grimoire_of_supremacy.enabled&spell_targets.infernal_awakening>2
0.00 summon_doomguard,if=talent.grimoire_of_supremacy.enabled&spell_targets.summon_infernal=1&artifact.lord_of_flames.rank>0&buff.lord_of_flames.remains&!pet.doomguard.active
0.00 summon_doomguard,if=talent.grimoire_of_supremacy.enabled&spell_targets.summon_infernal=1&equipped.132379&!cooldown.sindorei_spite_icd.remains
0.00 summon_infernal,if=talent.grimoire_of_supremacy.enabled&spell_targets.summon_infernal>1&equipped.132379&!cooldown.sindorei_spite_icd.remains
O 2.90 soul_harvest
0.00 channel_demonfire,if=dot.immolate.remains>cast_time
0.00 havoc,if=active_enemies=1&talent.wreak_havoc.enabled&equipped.132375&!debuff.havoc.remains
0.00 rain_of_fire,if=active_enemies>=3&cooldown.havoc.remains<=12&!talent.wreak_havoc.enabled
0.00 rain_of_fire,if=active_enemies>=6&talent.wreak_havoc.enabled
P 11.91 dimensional_rift,if=!equipped.144369|charges>1|((!talent.grimoire_of_service.enabled|recharge_time<cooldown.service_pet.remains)&(!talent.soul_harvest.enabled|recharge_time<cooldown.soul_harvest.remains)&(!talent.grimoire_of_supremacy.enabled|recharge_time<cooldown.summon_doomguard.remains))
0.00 life_tap,if=talent.empowered_life_tap.enabled&buff.empowered_life_tap.remains<duration*0.3
0.00 cataclysm
Q 61.80 chaos_bolt,if=(cooldown.havoc.remains>12&cooldown.havoc.remains|active_enemies<3|talent.wreak_havoc.enabled&active_enemies<6)&(set_bonus.tier19_4pc=0|!talent.eradication.enabled|buff.embrace_chaos.remains<=cast_time|soul_shard>=3)
0.00 shadowburn
0.00 conflagrate,if=!talent.roaring_blaze.enabled&buff.backdraft.stack<3
0.00 immolate,if=!talent.roaring_blaze.enabled&remains<=duration*0.3
R 75.38 incinerate
S 6.56 life_tap

Sample Sequence

0126ABCDEGHJKLKMOPPQQKQKRRQRKRCQRPREQRRPRPGJQKQKRQCKQRQKPRQRRQRERRQRRCQRGJQKKQKQRRQKRCQRSERQPQRLGJKQCKQKRRQRRRKRSRQREPQCRQOIRPRRGJQKQKPQRKQCQKQRQRQSEQRRRRQRCSRGJQQKQKKQRRRKPQCHQLRQREQRRRSGJKKQRCRQKQRRRQKRQRRQESCPQNRGJQKKQKRRQCKORQRRQERRSRRRQCGJQJJPQJLQRPJQRRCQEJRQJ

Sample Sequence Table

time list # name target resources buffs
Pre precombat 0 flask Alythess' 1100000.0/1100000: 100% mana | 3.0/5: 60% soul_shard
Pre precombat 1 food Alythess' 1100000.0/1100000: 100% mana | 3.0/5: 60% soul_shard
Pre precombat 2 summon_imp Fluffy_Pillow 1100000.0/1100000: 100% mana | 3.0/5: 60% soul_shard
Pre precombat 6 augmentation Alythess' 1100000.0/1100000: 100% mana | 3.0/5: 60% soul_shard
Pre precombat A potion Fluffy_Pillow 1100000.0/1100000: 100% mana | 3.0/5: 60% soul_shard potion_of_prolonged_power
0:00.000 precombat B chaos_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 1.0/5: 20% soul_shard embrace_chaos, accelerando, potion_of_prolonged_power
0:00.000 default C havoc enemy2 1100000.0/1100000: 100% mana | 1.0/5: 20% soul_shard embrace_chaos, accelerando, potion_of_prolonged_power
0:01.145 default D dimensional_rift Fluffy_Pillow 1033543.2/1100000: 94% mana | 1.0/5: 20% soul_shard bloodlust, embrace_chaos, accelerando, potion_of_prolonged_power
0:02.024 default E immolate Fluffy_Pillow 1050081.5/1100000: 95% mana | 1.0/5: 20% soul_shard bloodlust, embrace_chaos, accelerando, potion_of_prolonged_power
0:02.905 default G immolate Fluffy_Pillow 1000657.5/1100000: 91% mana | 1.0/5: 20% soul_shard bloodlust, embrace_chaos, accelerando, potion_of_prolonged_power
0:03.786 default H berserking Fluffy_Pillow 951233.5/1100000: 86% mana | 1.0/5: 20% soul_shard bloodlust, embrace_chaos, accelerando, potion_of_prolonged_power
0:03.786 default J conflagrate Fluffy_Pillow 951233.5/1100000: 86% mana | 1.0/5: 20% soul_shard bloodlust, berserking, embrace_chaos, accelerando, potion_of_prolonged_power
0:04.553 default K conflagrate Fluffy_Pillow 967829.3/1100000: 88% mana | 2.0/5: 40% soul_shard bloodlust, berserking, accelerando, potion_of_prolonged_power
0:05.320 default L service_imp Fluffy_Pillow 984425.1/1100000: 89% mana | 3.0/5: 60% soul_shard bloodlust, berserking, accelerando, potion_of_prolonged_power
0:06.088 default K conflagrate Fluffy_Pillow 1001042.5/1100000: 91% mana | 2.0/5: 40% soul_shard bloodlust, berserking, accelerando, potion_of_prolonged_power
0:06.855 default M summon_infernal Fluffy_Pillow 1017638.2/1100000: 93% mana | 3.0/5: 60% soul_shard bloodlust, berserking, accelerando, potion_of_prolonged_power
0:07.621 default O soul_harvest Fluffy_Pillow 1034212.3/1100000: 94% mana | 2.0/5: 40% soul_shard bloodlust, berserking, lord_of_flames, accelerando, potion_of_prolonged_power
0:07.621 default P dimensional_rift Fluffy_Pillow 1034212.3/1100000: 94% mana | 2.0/5: 40% soul_shard bloodlust, berserking, soul_harvest, lord_of_flames, accelerando, potion_of_prolonged_power
0:08.388 default P dimensional_rift Fluffy_Pillow 1050808.1/1100000: 96% mana | 3.0/5: 60% soul_shard bloodlust, berserking, soul_harvest, lord_of_flames, accelerando, potion_of_prolonged_power
0:09.155 default Q chaos_bolt Fluffy_Pillow 1067403.9/1100000: 97% mana | 3.0/5: 60% soul_shard bloodlust, berserking, soul_harvest, lord_of_flames, accelerando, potion_of_prolonged_power
0:10.686 default Q chaos_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 3.0/5: 60% soul_shard bloodlust, berserking, soul_harvest, lord_of_flames, embrace_chaos, accelerando(2), potion_of_prolonged_power
0:11.592 default K conflagrate Fluffy_Pillow 1100000.0/1100000: 100% mana | 1.0/5: 20% soul_shard bloodlust, berserking, soul_harvest, lord_of_flames, embrace_chaos, accelerando(2), potion_of_prolonged_power
0:12.345 default Q chaos_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 3.0/5: 60% soul_shard bloodlust, berserking, soul_harvest, lord_of_flames, conflagration_of_chaos, embrace_chaos, potion_of_prolonged_power
0:13.277 default K conflagrate Fluffy_Pillow 1100000.0/1100000: 100% mana | 1.0/5: 20% soul_shard bloodlust, berserking, soul_harvest, lord_of_flames, conflagration_of_chaos, embrace_chaos, potion_of_prolonged_power
0:14.056 default R incinerate Fluffy_Pillow 1100000.0/1100000: 100% mana | 2.0/5: 40% soul_shard bloodlust, soul_harvest, lord_of_flames, conflagration_of_chaos, embrace_chaos, potion_of_prolonged_power
0:15.174 default R incinerate Fluffy_Pillow 1034055.6/1100000: 94% mana | 2.0/5: 40% soul_shard bloodlust, soul_harvest, lord_of_flames, conflagration_of_chaos, embrace_chaos, potion_of_prolonged_power
0:16.292 default Q chaos_bolt Fluffy_Pillow 988777.8/1100000: 90% mana | 2.0/5: 40% soul_shard bloodlust, soul_harvest, lord_of_flames, conflagration_of_chaos, embrace_chaos, potion_of_prolonged_power
0:17.364 default R incinerate Fluffy_Pillow 1008648.6/1100000: 92% mana | 1.0/5: 20% soul_shard bloodlust, soul_harvest, lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando, potion_of_prolonged_power
0:18.465 default K conflagrate Fluffy_Pillow 963363.9/1100000: 88% mana | 1.0/5: 20% soul_shard bloodlust, soul_harvest, lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando, potion_of_prolonged_power
0:19.345 default R incinerate Fluffy_Pillow 979921.1/1100000: 89% mana | 2.0/5: 40% soul_shard bloodlust, soul_harvest, lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando, potion_of_prolonged_power
0:20.448 default C havoc enemy2 934674.0/1100000: 85% mana | 2.0/5: 40% soul_shard bloodlust, soul_harvest, lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando, potion_of_prolonged_power
0:21.330 default Q chaos_bolt Fluffy_Pillow 863268.8/1100000: 78% mana | 3.0/5: 60% soul_shard bloodlust, soul_harvest, lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando, potion_of_prolonged_power
0:22.385 default R incinerate Fluffy_Pillow 883118.6/1100000: 80% mana | 1.0/5: 20% soul_shard bloodlust, soul_harvest, lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando, potion_of_prolonged_power
0:23.488 default P dimensional_rift Fluffy_Pillow 837871.5/1100000: 76% mana | 1.0/5: 20% soul_shard bloodlust, soul_harvest, lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando, potion_of_prolonged_power
0:24.369 default R incinerate Fluffy_Pillow 854447.5/1100000: 78% mana | 1.0/5: 20% soul_shard bloodlust, soul_harvest, lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando, potion_of_prolonged_power
0:25.472 default E immolate Fluffy_Pillow 809366.1/1100000: 74% mana | 1.0/5: 20% soul_shard bloodlust, soul_harvest, lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(2), potion_of_prolonged_power
0:26.342 default Q chaos_bolt Fluffy_Pillow 759979.0/1100000: 69% mana | 3.0/5: 60% soul_shard bloodlust, soul_harvest, lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(2), potion_of_prolonged_power
0:27.384 default R incinerate Fluffy_Pillow 779876.3/1100000: 71% mana | 1.0/5: 20% soul_shard bloodlust, lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(2), potion_of_prolonged_power
0:28.471 default R incinerate Fluffy_Pillow 734634.2/1100000: 67% mana | 1.0/5: 20% soul_shard bloodlust, lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(3), potion_of_prolonged_power
0:29.542 default P dimensional_rift Fluffy_Pillow 689233.3/1100000: 63% mana | 1.0/5: 20% soul_shard bloodlust, lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando, potion_of_prolonged_power
0:30.424 default R incinerate Fluffy_Pillow 705828.1/1100000: 64% mana | 1.0/5: 20% soul_shard bloodlust, lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando, potion_of_prolonged_power
0:31.527 default P dimensional_rift Fluffy_Pillow 660837.5/1100000: 60% mana | 1.0/5: 20% soul_shard bloodlust, lord_of_flames, conflagration_of_chaos, accelerando(2), potion_of_prolonged_power
0:32.396 default G immolate Fluffy_Pillow 677431.2/1100000: 62% mana | 1.0/5: 20% soul_shard bloodlust, lord_of_flames, conflagration_of_chaos, accelerando(2), potion_of_prolonged_power
0:33.265 default J conflagrate Fluffy_Pillow 628026.4/1100000: 57% mana | 1.0/5: 20% soul_shard bloodlust, lord_of_flames, conflagration_of_chaos, accelerando(3), potion_of_prolonged_power
0:34.120 default Q chaos_bolt Fluffy_Pillow 644592.2/1100000: 59% mana | 3.0/5: 60% soul_shard bloodlust, lord_of_flames, conflagration_of_chaos, accelerando(3), potion_of_prolonged_power
0:35.826 default K conflagrate Fluffy_Pillow 677661.6/1100000: 62% mana | 2.0/5: 40% soul_shard bloodlust, lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(4), potion_of_prolonged_power
0:36.671 default Q chaos_bolt Fluffy_Pillow 694270.5/1100000: 63% mana | 3.0/5: 60% soul_shard bloodlust, lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(4), potion_of_prolonged_power
0:37.684 default K conflagrate Fluffy_Pillow 714181.5/1100000: 65% mana | 1.0/5: 20% soul_shard bloodlust, lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(4), potion_of_prolonged_power
0:38.527 default R incinerate Fluffy_Pillow 730751.0/1100000: 66% mana | 2.0/5: 40% soul_shard bloodlust, lord_of_flames, embrace_chaos, accelerando(4), potion_of_prolonged_power
0:39.583 default Q chaos_bolt Fluffy_Pillow 685507.2/1100000: 62% mana | 3.0/5: 60% soul_shard bloodlust, lord_of_flames, embrace_chaos, accelerando(4), potion_of_prolonged_power
0:40.594 default C havoc enemy2 705378.8/1100000: 64% mana | 1.0/5: 20% soul_shard bloodlust, lord_of_flames, embrace_chaos, accelerando(4), potion_of_prolonged_power
0:41.438 default K conflagrate Fluffy_Pillow 630139.7/1100000: 57% mana | 1.0/5: 20% soul_shard lord_of_flames, embrace_chaos, accelerando(4), potion_of_prolonged_power
0:42.532 default Q chaos_bolt Fluffy_Pillow 645823.9/1100000: 59% mana | 4.0/5: 80% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, potion_of_prolonged_power
0:43.926 default R incinerate Fluffy_Pillow 665699.2/1100000: 61% mana | 2.0/5: 40% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, potion_of_prolonged_power
0:45.382 default Q chaos_bolt Fluffy_Pillow 620459.8/1100000: 56% mana | 3.0/5: 60% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando, potion_of_prolonged_power
0:46.753 default K conflagrate Fluffy_Pillow 640302.4/1100000: 58% mana | 1.0/5: 20% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando, potion_of_prolonged_power
0:47.896 default P dimensional_rift Fluffy_Pillow 656845.1/1100000: 60% mana | 2.0/5: 40% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando, potion_of_prolonged_power
0:49.041 default R incinerate Fluffy_Pillow 673416.8/1100000: 61% mana | 2.0/5: 40% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando, potion_of_prolonged_power
0:50.473 default Q chaos_bolt Fluffy_Pillow 628142.2/1100000: 57% mana | 2.0/5: 40% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando, potion_of_prolonged_power
0:51.845 default R incinerate Fluffy_Pillow 647999.2/1100000: 59% mana | 2.0/5: 40% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, nefarious_pact, accelerando, potion_of_prolonged_power
0:52.839 default R incinerate Fluffy_Pillow 596385.5/1100000: 54% mana | 2.0/5: 40% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, nefarious_pact, accelerando, potion_of_prolonged_power
0:53.832 default Q chaos_bolt Fluffy_Pillow 544758.1/1100000: 50% mana | 3.0/5: 60% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, nefarious_pact, accelerando(2), potion_of_prolonged_power
0:54.771 default R incinerate Fluffy_Pillow 558550.7/1100000: 51% mana | 1.0/5: 20% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, nefarious_pact, accelerando(2), potion_of_prolonged_power
0:55.750 default E immolate Fluffy_Pillow 506930.9/1100000: 46% mana | 1.0/5: 20% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, nefarious_pact, accelerando(2), potion_of_prolonged_power
0:56.532 default R incinerate Fluffy_Pillow 452417.5/1100000: 41% mana | 1.0/5: 20% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, nefarious_pact, accelerando(2), potion_of_prolonged_power
0:57.512 default R incinerate Fluffy_Pillow 400777.7/1100000: 36% mana | 2.0/5: 40% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, nefarious_pact, potion_of_prolonged_power
0:58.522 default Q chaos_bolt Fluffy_Pillow 349178.0/1100000: 32% mana | 2.0/5: 40% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, nefarious_pact
0:59.487 default R incinerate Fluffy_Pillow 362937.6/1100000: 33% mana | 0.0/5: 0% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, nefarious_pact, accelerando
1:00.482 default R incinerate Fluffy_Pillow 311338.3/1100000: 28% mana | 1.0/5: 20% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, nefarious_pact, accelerando
1:01.477 default C havoc enemy2 259739.0/1100000: 24% mana | 3.0/5: 60% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, nefarious_pact, accelerando
1:02.271 default Q chaos_bolt Fluffy_Pillow 183230.6/1100000: 17% mana | 3.0/5: 60% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, nefarious_pact, accelerando
1:03.222 default R incinerate Fluffy_Pillow 197047.3/1100000: 18% mana | 2.0/5: 40% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, nefarious_pact, accelerando(2)
1:04.202 default G immolate Fluffy_Pillow 145442.2/1100000: 13% mana | 2.0/5: 40% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, devils_due, accelerando(2)
1:05.529 default J conflagrate Fluffy_Pillow 98934.1/1100000: 9% mana | 2.0/5: 40% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, devils_due, accelerando(2)
1:06.856 default Q chaos_bolt Fluffy_Pillow 118426.0/1100000: 11% mana | 3.0/5: 60% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, devils_due, accelerando(2)
1:08.448 default K conflagrate Fluffy_Pillow 141810.3/1100000: 13% mana | 1.0/5: 20% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, devils_due, accelerando(2)
1:09.776 default K conflagrate Fluffy_Pillow 161316.9/1100000: 15% mana | 2.0/5: 40% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, devils_due, accelerando(2)
1:11.104 default Q chaos_bolt Fluffy_Pillow 180823.4/1100000: 16% mana | 4.0/5: 80% soul_shard lord_of_flames, embrace_chaos, devils_due, accelerando(2)
1:12.697 default K conflagrate Fluffy_Pillow 203699.3/1100000: 19% mana | 2.0/5: 40% soul_shard lord_of_flames, embrace_chaos
1:13.859 default Q chaos_bolt Fluffy_Pillow 220266.9/1100000: 20% mana | 3.0/5: 60% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos
1:15.250 default R incinerate Fluffy_Pillow 240198.9/1100000: 22% mana | 1.0/5: 20% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando
1:16.683 default R incinerate Fluffy_Pillow 194939.8/1100000: 18% mana | 1.0/5: 20% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(2)
1:18.097 default Q chaos_bolt Fluffy_Pillow 149785.0/1100000: 14% mana | 2.0/5: 40% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(3)
1:19.429 default K conflagrate Fluffy_Pillow 169637.1/1100000: 15% mana | 0.0/5: 0% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(3)
1:20.540 default R incinerate Fluffy_Pillow 186195.4/1100000: 17% mana | 1.0/5: 20% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(3)
1:21.930 default C havoc enemy2 140993.6/1100000: 13% mana | 2.0/5: 40% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(4)
1:23.026 default Q chaos_bolt Fluffy_Pillow 69564.7/1100000: 6% mana | 2.0/5: 40% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(4)
1:24.340 default R incinerate Fluffy_Pillow 89431.8/1100000: 8% mana | 0.0/5: 0% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(4)
1:25.712 default S life_tap Fluffy_Pillow 44175.9/1100000: 4% mana | 0.0/5: 0% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(4)
1:26.808 default E immolate Fluffy_Pillow 390729.7/1100000: 36% mana | 0.0/5: 0% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos
1:27.970 default R incinerate Fluffy_Pillow 341297.2/1100000: 31% mana | 0.0/5: 0% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos
1:29.427 default Q chaos_bolt Fluffy_Pillow 296072.2/1100000: 27% mana | 2.0/5: 40% soul_shard lord_of_flames, conflagration_of_chaos, accelerando
1:31.713 default P dimensional_rift Fluffy_Pillow 329157.7/1100000: 30% mana | 2.0/5: 40% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando
1:32.858 default Q chaos_bolt Fluffy_Pillow 345763.0/1100000: 31% mana | 4.0/5: 80% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(2)
1:34.209 default R incinerate Fluffy_Pillow 365608.2/1100000: 33% mana | 2.0/5: 40% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(3)
1:35.601 default L service_imp Fluffy_Pillow 320354.6/1100000: 29% mana | 2.0/5: 40% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(3)
1:36.714 default G immolate Fluffy_Pillow 336942.7/1100000: 31% mana | 1.0/5: 20% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(3)
1:37.825 default J conflagrate Fluffy_Pillow 287501.0/1100000: 26% mana | 1.0/5: 20% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(3)
1:38.937 default K conflagrate Fluffy_Pillow 304074.2/1100000: 28% mana | 2.0/5: 40% soul_shard lord_of_flames, accelerando(3)
1:40.047 default Q chaos_bolt Fluffy_Pillow 320617.6/1100000: 29% mana | 3.0/5: 60% soul_shard lord_of_flames, conflagration_of_chaos, accelerando(3)
1:42.266 default C havoc enemy2 353142.8/1100000: 32% mana | 1.0/5: 20% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos
1:43.428 default K conflagrate Fluffy_Pillow 281710.4/1100000: 26% mana | 1.0/5: 20% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos
1:44.591 default Q chaos_bolt Fluffy_Pillow 298292.1/1100000: 27% mana | 3.0/5: 60% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos
1:45.984 default K conflagrate Fluffy_Pillow 318154.3/1100000: 29% mana | 1.0/5: 20% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando
1:47.129 default R incinerate Fluffy_Pillow 334725.9/1100000: 30% mana | 2.0/5: 40% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, nefarious_pact, accelerando
1:48.123 default R incinerate Fluffy_Pillow 283112.2/1100000: 26% mana | 2.0/5: 40% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, nefarious_pact, accelerando
1:49.116 default Q chaos_bolt Fluffy_Pillow 231483.9/1100000: 21% mana | 2.0/5: 40% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, nefarious_pact, accelerando
1:50.066 default R incinerate Fluffy_Pillow 245233.3/1100000: 22% mana | 0.0/5: 0% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, nefarious_pact, accelerando
1:51.059 default R incinerate Fluffy_Pillow 193605.1/1100000: 18% mana | 0.0/5: 0% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, nefarious_pact, accelerando
1:52.053 default R incinerate Fluffy_Pillow 141991.3/1100000: 13% mana | 0.0/5: 0% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, nefarious_pact, accelerando
1:53.047 default K conflagrate Fluffy_Pillow 90377.5/1100000: 8% mana | 0.0/5: 0% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, nefarious_pact, accelerando
1:53.841 default R incinerate Fluffy_Pillow 101869.2/1100000: 9% mana | 1.0/5: 20% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, nefarious_pact, accelerando
1:54.835 default S life_tap Fluffy_Pillow 50255.4/1100000: 5% mana | 1.0/5: 20% soul_shard lord_of_flames, conflagration_of_chaos, nefarious_pact, accelerando
1:55.629 default R incinerate Fluffy_Pillow 391747.0/1100000: 36% mana | 1.0/5: 20% soul_shard lord_of_flames, conflagration_of_chaos, nefarious_pact, accelerando
1:56.623 default Q chaos_bolt Fluffy_Pillow 340371.6/1100000: 31% mana | 2.0/5: 40% soul_shard lord_of_flames, conflagration_of_chaos, nefarious_pact, accelerando(3)
1:58.163 default R incinerate Fluffy_Pillow 363204.8/1100000: 33% mana | 1.0/5: 20% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, nefarious_pact
1:59.172 default E immolate Fluffy_Pillow 311590.9/1100000: 28% mana | 1.0/5: 20% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, devils_due
2:00.540 default P dimensional_rift Fluffy_Pillow 265095.5/1100000: 24% mana | 2.0/5: 40% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, devils_due
2:01.909 default Q chaos_bolt Fluffy_Pillow 284614.4/1100000: 26% mana | 3.0/5: 60% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, devils_due
2:03.550 default C havoc enemy2 308012.5/1100000: 28% mana | 1.0/5: 20% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, devils_due, accelerando
2:04.897 default R incinerate Fluffy_Pillow 239507.7/1100000: 22% mana | 2.0/5: 40% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, devils_due, accelerando
2:06.586 default Q chaos_bolt Fluffy_Pillow 197954.0/1100000: 18% mana | 2.0/5: 40% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(2)
2:07.938 default O soul_harvest Fluffy_Pillow 217814.1/1100000: 20% mana | 0.0/5: 0% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, nefarious_pact, accelerando(3)
2:07.938 default I potion Fluffy_Pillow 217814.1/1100000: 20% mana | 0.0/5: 0% soul_shard soul_harvest, lord_of_flames, conflagration_of_chaos, embrace_chaos, nefarious_pact, accelerando(3)
2:07.938 default R incinerate Fluffy_Pillow 217814.1/1100000: 20% mana | 0.0/5: 0% soul_shard soul_harvest, lord_of_flames, conflagration_of_chaos, embrace_chaos, nefarious_pact, accelerando(3), potion_of_deadly_grace
2:08.904 default P dimensional_rift Fluffy_Pillow 166211.4/1100000: 15% mana | 1.0/5: 20% soul_shard soul_harvest, lord_of_flames, conflagration_of_chaos, embrace_chaos, nefarious_pact, accelerando(3), potion_of_deadly_grace
2:09.676 default R incinerate Fluffy_Pillow 177717.2/1100000: 16% mana | 1.0/5: 20% soul_shard soul_harvest, lord_of_flames, conflagration_of_chaos, embrace_chaos, nefarious_pact, accelerando(3), potion_of_deadly_grace
2:10.643 default R incinerate Fluffy_Pillow 126129.4/1100000: 11% mana | 1.0/5: 20% soul_shard soul_harvest, lord_of_flames, conflagration_of_chaos, embrace_chaos, nefarious_pact, accelerando(3), potion_of_deadly_grace
2:11.610 default G immolate Fluffy_Pillow 74541.5/1100000: 7% mana | 1.0/5: 20% soul_shard soul_harvest, lord_of_flames, conflagration_of_chaos, embrace_chaos, nefarious_pact, accelerando(3), potion_of_deadly_grace
2:12.381 default J conflagrate Fluffy_Pillow 20032.5/1100000: 2% mana | 2.0/5: 40% soul_shard soul_harvest, lord_of_flames, conflagration_of_chaos, nefarious_pact, accelerando(3), potion_of_deadly_grace
2:13.152 default Q chaos_bolt Fluffy_Pillow 31523.5/1100000: 3% mana | 3.0/5: 60% soul_shard soul_harvest, lord_of_flames, nefarious_pact, accelerando(3), potion_of_deadly_grace
2:14.689 default K conflagrate Fluffy_Pillow 54430.9/1100000: 5% mana | 2.0/5: 40% soul_shard soul_harvest, lord_of_flames, embrace_chaos, nefarious_pact, accelerando(3), potion_of_deadly_grace
2:15.460 default Q chaos_bolt Fluffy_Pillow 65921.8/1100000: 6% mana | 3.0/5: 60% soul_shard soul_harvest, lord_of_flames, embrace_chaos, nefarious_pact, accelerando(3), potion_of_deadly_grace
2:16.385 default K conflagrate Fluffy_Pillow 79165.2/1100000: 7% mana | 2.0/5: 40% soul_shard soul_harvest, lord_of_flames, embrace_chaos, nefarious_pact, potion_of_deadly_grace
2:17.192 default P dimensional_rift Fluffy_Pillow 90671.2/1100000: 8% mana | 3.0/5: 60% soul_shard soul_harvest, lord_of_flames, conflagration_of_chaos, embrace_chaos, nefarious_pact, potion_of_deadly_grace
2:17.995 default Q chaos_bolt Fluffy_Pillow 102120.2/1100000: 9% mana | 4.0/5: 80% soul_shard soul_harvest, lord_of_flames, conflagration_of_chaos, embrace_chaos, nefarious_pact, potion_of_deadly_grace
2:18.959 default R incinerate Fluffy_Pillow 116038.2/1100000: 11% mana | 2.0/5: 40% soul_shard soul_harvest, lord_of_flames, conflagration_of_chaos, embrace_chaos, devils_due, accelerando, potion_of_deadly_grace
2:20.646 default K conflagrate Fluffy_Pillow 74455.1/1100000: 7% mana | 2.0/5: 40% soul_shard soul_harvest, lord_of_flames, conflagration_of_chaos, embrace_chaos, devils_due, accelerando(2), potion_of_deadly_grace
2:21.972 default Q chaos_bolt Fluffy_Pillow 93932.3/1100000: 9% mana | 3.0/5: 60% soul_shard soul_harvest, lord_of_flames, conflagration_of_chaos, embrace_chaos, devils_due, accelerando(2), potion_of_deadly_grace
2:23.565 default C havoc enemy2 117573.1/1100000: 11% mana | 3.0/5: 60% soul_shard soul_harvest, lord_of_flames, conflagration_of_chaos, embrace_chaos, devils_due, accelerando(3), potion_of_deadly_grace
2:24.875 default Q chaos_bolt Fluffy_Pillow 49097.3/1100000: 4% mana | 3.0/5: 60% soul_shard soul_harvest, lord_of_flames, conflagration_of_chaos, embrace_chaos, devils_due, accelerando(3), potion_of_deadly_grace
2:26.445 default K conflagrate Fluffy_Pillow 72788.9/1100000: 7% mana | 2.0/5: 40% soul_shard soul_harvest, lord_of_flames, conflagration_of_chaos, embrace_chaos, devils_due, accelerando(4), potion_of_deadly_grace
2:27.735 default Q chaos_bolt Fluffy_Pillow 92449.7/1100000: 8% mana | 4.0/5: 80% soul_shard lord_of_flames, embrace_chaos, accelerando(5), potion_of_deadly_grace
2:29.029 default R incinerate Fluffy_Pillow 112293.0/1100000: 10% mana | 2.0/5: 40% soul_shard lord_of_flames, embrace_chaos, accelerando(5), potion_of_deadly_grace
2:30.383 default Q chaos_bolt Fluffy_Pillow 66808.7/1100000: 6% mana | 4.0/5: 80% soul_shard lord_of_flames, embrace_chaos, potion_of_deadly_grace
2:31.776 default R incinerate Fluffy_Pillow 86669.8/1100000: 8% mana | 2.0/5: 40% soul_shard lord_of_flames, embrace_chaos, potion_of_deadly_grace
2:33.229 default Q chaos_bolt Fluffy_Pillow 41387.0/1100000: 4% mana | 3.0/5: 60% soul_shard lord_of_flames, embrace_chaos, accelerando, potion_of_deadly_grace
2:34.601 default S life_tap Fluffy_Pillow 61315.2/1100000: 6% mana | 1.0/5: 20% soul_shard lord_of_flames, embrace_chaos, accelerando(2), potion_of_deadly_grace
2:35.728 default E immolate Fluffy_Pillow 407869.3/1100000: 37% mana | 1.0/5: 20% soul_shard lord_of_flames, embrace_chaos, accelerando(2), potion_of_deadly_grace
2:36.854 default Q chaos_bolt Fluffy_Pillow 358408.7/1100000: 33% mana | 3.0/5: 60% soul_shard lord_of_flames, embrace_chaos, nefarious_pact, accelerando(2), potion_of_deadly_grace
2:37.791 default R incinerate Fluffy_Pillow 372172.0/1100000: 34% mana | 1.0/5: 20% soul_shard lord_of_flames, embrace_chaos, nefarious_pact, accelerando(2), potion_of_deadly_grace
2:38.770 default R incinerate Fluffy_Pillow 320552.2/1100000: 29% mana | 1.0/5: 20% soul_shard lord_of_flames, embrace_chaos, nefarious_pact, accelerando(2)
2:39.750 default R incinerate Fluffy_Pillow 268947.1/1100000: 24% mana | 1.0/5: 20% soul_shard lord_of_flames, embrace_chaos, nefarious_pact, accelerando(2)
2:40.730 default R incinerate Fluffy_Pillow 217342.0/1100000: 20% mana | 2.0/5: 40% soul_shard lord_of_flames, embrace_chaos, nefarious_pact, accelerando(2)
2:41.710 default Q chaos_bolt Fluffy_Pillow 165736.9/1100000: 15% mana | 3.0/5: 60% soul_shard lord_of_flames, embrace_chaos, nefarious_pact, accelerando(2)
2:42.647 default R incinerate Fluffy_Pillow 179500.2/1100000: 16% mana | 1.0/5: 20% soul_shard lord_of_flames, embrace_chaos, nefarious_pact, accelerando(2)
2:43.626 default C havoc enemy2 127880.4/1100000: 12% mana | 1.0/5: 20% soul_shard lord_of_flames, embrace_chaos, nefarious_pact, accelerando(2)
2:44.407 default S life_tap Fluffy_Pillow 51352.2/1100000: 5% mana | 1.0/5: 20% soul_shard lord_of_flames, embrace_chaos, nefarious_pact, accelerando(2)
2:45.189 default R incinerate Fluffy_Pillow 392848.7/1100000: 36% mana | 2.0/5: 40% soul_shard lord_of_flames, embrace_chaos, nefarious_pact, accelerando(3)
2:46.155 default G immolate Fluffy_Pillow 340645.6/1100000: 31% mana | 2.0/5: 40% soul_shard lord_of_flames, embrace_chaos, nefarious_pact
2:46.961 default J conflagrate Fluffy_Pillow 286137.3/1100000: 26% mana | 2.0/5: 40% soul_shard lord_of_flames, nefarious_pact
2:47.766 default Q chaos_bolt Fluffy_Pillow 297614.8/1100000: 27% mana | 3.0/5: 60% soul_shard lord_of_flames, nefarious_pact
2:49.375 default Q chaos_bolt Fluffy_Pillow 320555.6/1100000: 29% mana | 3.0/5: 60% soul_shard lord_of_flames, embrace_chaos, devils_due
2:51.015 default K conflagrate Fluffy_Pillow 343938.3/1100000: 31% mana | 2.0/5: 40% soul_shard lord_of_flames, embrace_chaos, devils_due
2:52.383 default Q chaos_bolt Fluffy_Pillow 363442.9/1100000: 33% mana | 3.0/5: 60% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, devils_due
2:54.024 default K conflagrate Fluffy_Pillow 386841.0/1100000: 35% mana | 1.0/5: 20% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, devils_due, accelerando
2:55.371 default K conflagrate Fluffy_Pillow 406336.2/1100000: 37% mana | 2.0/5: 40% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, devils_due, accelerando
2:56.718 default Q chaos_bolt Fluffy_Pillow 425831.4/1100000: 39% mana | 3.0/5: 60% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, nefarious_pact, accelerando
2:57.669 default R incinerate Fluffy_Pillow 439595.3/1100000: 40% mana | 1.0/5: 20% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, nefarious_pact, accelerando
2:58.666 default R incinerate Fluffy_Pillow 388024.9/1100000: 35% mana | 1.0/5: 20% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, nefarious_pact, accelerando
2:59.659 default R incinerate Fluffy_Pillow 336396.7/1100000: 31% mana | 2.0/5: 40% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, nefarious_pact, accelerando
3:00.652 default K conflagrate Fluffy_Pillow 284768.4/1100000: 26% mana | 2.0/5: 40% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, nefarious_pact, accelerando
3:01.672 default P dimensional_rift Fluffy_Pillow 299531.0/1100000: 27% mana | 4.0/5: 80% soul_shard lord_of_flames, conflagration_of_chaos, nefarious_pact, accelerando
3:02.466 default Q chaos_bolt Fluffy_Pillow 311022.6/1100000: 28% mana | 4.0/5: 80% soul_shard lord_of_flames, conflagration_of_chaos, nefarious_pact, accelerando
3:04.050 default C havoc enemy2 334216.5/1100000: 30% mana | 3.0/5: 60% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, nefarious_pact, accelerando(3)
3:04.822 default H berserking Fluffy_Pillow 257722.4/1100000: 23% mana | 3.0/5: 60% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, nefarious_pact, accelerando(3)
3:04.822 default Q chaos_bolt Fluffy_Pillow 257722.4/1100000: 23% mana | 3.0/5: 60% soul_shard berserking, lord_of_flames, conflagration_of_chaos, embrace_chaos, nefarious_pact, accelerando(3)
3:05.625 default L service_imp Fluffy_Pillow 271485.4/1100000: 25% mana | 2.0/5: 40% soul_shard berserking, lord_of_flames, conflagration_of_chaos, embrace_chaos, nefarious_pact, accelerando(3)
3:06.380 default R incinerate Fluffy_Pillow 284157.5/1100000: 26% mana | 2.0/5: 40% soul_shard berserking, lord_of_flames, conflagration_of_chaos, embrace_chaos, nefarious_pact
3:07.258 default Q chaos_bolt Fluffy_Pillow 232553.6/1100000: 21% mana | 3.0/5: 60% soul_shard berserking, lord_of_flames, conflagration_of_chaos, embrace_chaos, nefarious_pact
3:08.095 default R incinerate Fluffy_Pillow 246277.4/1100000: 22% mana | 2.0/5: 40% soul_shard berserking, lord_of_flames, conflagration_of_chaos, embrace_chaos, devils_due
3:09.586 default E immolate Fluffy_Pillow 204724.5/1100000: 19% mana | 2.0/5: 40% soul_shard berserking, lord_of_flames, conflagration_of_chaos, embrace_chaos, devils_due
3:10.775 default Q chaos_bolt Fluffy_Pillow 158219.8/1100000: 14% mana | 2.0/5: 40% soul_shard berserking, lord_of_flames, conflagration_of_chaos, embrace_chaos, devils_due
3:12.201 default R incinerate Fluffy_Pillow 181601.1/1100000: 17% mana | 0.0/5: 0% soul_shard berserking, lord_of_flames, conflagration_of_chaos, embrace_chaos, devils_due
3:13.691 default R incinerate Fluffy_Pillow 140167.7/1100000: 13% mana | 0.0/5: 0% soul_shard berserking, lord_of_flames, conflagration_of_chaos, embrace_chaos, devils_due, accelerando
3:15.160 default R incinerate Fluffy_Pillow 97884.0/1100000: 9% mana | 0.0/5: 0% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, devils_due, accelerando
3:16.846 default S life_tap Fluffy_Pillow 56285.6/1100000: 5% mana | 0.0/5: 0% soul_shard lord_of_flames, conflagration_of_chaos, accelerando
3:17.990 default G immolate Fluffy_Pillow 402842.8/1100000: 37% mana | 0.0/5: 0% soul_shard lord_of_flames, conflagration_of_chaos, accelerando
3:19.134 default J conflagrate Fluffy_Pillow 353400.0/1100000: 32% mana | 0.0/5: 0% soul_shard lord_of_flames, conflagration_of_chaos, nefarious_pact, accelerando
3:19.928 default K conflagrate Fluffy_Pillow 364891.6/1100000: 33% mana | 1.0/5: 20% soul_shard lord_of_flames, nefarious_pact, accelerando
3:20.723 default K conflagrate Fluffy_Pillow 376397.7/1100000: 34% mana | 2.0/5: 40% soul_shard lord_of_flames, nefarious_pact, accelerando
3:21.517 default Q chaos_bolt Fluffy_Pillow 387889.3/1100000: 35% mana | 4.0/5: 80% soul_shard lord_of_flames, conflagration_of_chaos, nefarious_pact, accelerando
3:23.100 default R incinerate Fluffy_Pillow 410800.2/1100000: 37% mana | 2.0/5: 40% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, nefarious_pact, accelerando
3:24.094 default C havoc enemy2 359292.5/1100000: 33% mana | 2.0/5: 40% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, nefarious_pact, accelerando(2)
3:24.876 default R incinerate Fluffy_Pillow 282779.0/1100000: 26% mana | 2.0/5: 40% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, nefarious_pact, accelerando(2)
3:25.857 default Q chaos_bolt Fluffy_Pillow 230880.5/1100000: 21% mana | 3.0/5: 60% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, nefarious_pact
3:26.823 default K conflagrate Fluffy_Pillow 244653.5/1100000: 22% mana | 2.0/5: 40% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, nefarious_pact
3:27.627 default Q chaos_bolt Fluffy_Pillow 256116.7/1100000: 23% mana | 3.0/5: 60% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, nefarious_pact
3:28.592 default R incinerate Fluffy_Pillow 269875.5/1100000: 25% mana | 1.0/5: 20% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, nefarious_pact
3:29.599 default R incinerate Fluffy_Pillow 218233.0/1100000: 20% mana | 2.0/5: 40% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, nefarious_pact
3:30.608 default R incinerate Fluffy_Pillow 166752.2/1100000: 15% mana | 2.0/5: 40% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, devils_due, accelerando
3:32.296 default Q chaos_bolt Fluffy_Pillow 125443.2/1100000: 11% mana | 2.0/5: 40% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, devils_due, accelerando(2)
3:33.887 default K conflagrate Fluffy_Pillow 148812.8/1100000: 14% mana | 0.0/5: 0% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, devils_due, accelerando(2)
3:35.214 default R incinerate Fluffy_Pillow 168304.7/1100000: 15% mana | 2.0/5: 40% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, devils_due, accelerando(2)
3:36.877 default Q chaos_bolt Fluffy_Pillow 126731.9/1100000: 12% mana | 3.0/5: 60% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, devils_due, accelerando(2)
3:38.469 default R incinerate Fluffy_Pillow 150116.3/1100000: 14% mana | 1.0/5: 20% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(2)
3:39.881 default R incinerate Fluffy_Pillow 104856.7/1100000: 10% mana | 2.0/5: 40% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(2)
3:41.293 default Q chaos_bolt Fluffy_Pillow 59637.4/1100000: 5% mana | 3.0/5: 60% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(3)
3:42.625 default E immolate Fluffy_Pillow 79099.6/1100000: 7% mana | 2.0/5: 40% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando
3:43.771 default S life_tap Fluffy_Pillow 29685.7/1100000: 3% mana | 2.0/5: 40% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando
3:44.915 default C havoc enemy2 376242.9/1100000: 34% mana | 2.0/5: 40% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando
3:46.060 default P dimensional_rift Fluffy_Pillow 304814.5/1100000: 28% mana | 2.0/5: 40% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando
3:47.291 default Q chaos_bolt Fluffy_Pillow 322630.9/1100000: 29% mana | 2.0/5: 40% soul_shard lord_of_flames, conflagration_of_chaos, accelerando
3:49.577 default N summon_doomguard Fluffy_Pillow 355716.3/1100000: 32% mana | 1.0/5: 20% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando
3:50.721 default R incinerate Fluffy_Pillow 372273.5/1100000: 34% mana | 1.0/5: 20% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando
3:52.156 default G immolate Fluffy_Pillow 327060.7/1100000: 30% mana | 1.0/5: 20% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(2)
3:53.283 default J conflagrate Fluffy_Pillow 277614.8/1100000: 25% mana | 2.0/5: 40% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(2)
3:54.411 default Q chaos_bolt Fluffy_Pillow 294183.6/1100000: 27% mana | 3.0/5: 60% soul_shard lord_of_flames, conflagration_of_chaos, accelerando(2)
3:56.660 default K conflagrate Fluffy_Pillow 326629.8/1100000: 30% mana | 1.0/5: 20% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando
3:57.805 default K conflagrate Fluffy_Pillow 343201.5/1100000: 31% mana | 2.0/5: 40% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando
3:58.951 default Q chaos_bolt Fluffy_Pillow 359787.6/1100000: 33% mana | 3.0/5: 60% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando
4:00.322 default K conflagrate Fluffy_Pillow 379630.8/1100000: 35% mana | 1.0/5: 20% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(2)
4:01.448 default R incinerate Fluffy_Pillow 396170.3/1100000: 36% mana | 2.0/5: 40% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(2)
4:02.860 default R incinerate Fluffy_Pillow 351110.9/1100000: 32% mana | 2.0/5: 40% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(4)
4:04.233 default Q chaos_bolt Fluffy_Pillow 305873.5/1100000: 28% mana | 2.0/5: 40% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(5)
4:05.530 default C havoc enemy2 325762.9/1100000: 30% mana | 0.0/5: 0% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(5)
4:06.609 default K conflagrate Fluffy_Pillow 254309.2/1100000: 23% mana | 1.0/5: 20% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(5)
4:07.779 default O soul_harvest Fluffy_Pillow 271553.0/1100000: 25% mana | 2.0/5: 40% soul_shard lord_of_flames, embrace_chaos
4:07.938 default R incinerate Fluffy_Pillow 273820.0/1100000: 25% mana | 2.0/5: 40% soul_shard soul_harvest, lord_of_flames, embrace_chaos
4:09.393 default Q chaos_bolt Fluffy_Pillow 228565.1/1100000: 21% mana | 2.0/5: 40% soul_shard soul_harvest, lord_of_flames, embrace_chaos
4:10.788 default R incinerate Fluffy_Pillow 248456.1/1100000: 23% mana | 1.0/5: 20% soul_shard soul_harvest, lord_of_flames, embrace_chaos, accelerando
4:12.222 default R incinerate Fluffy_Pillow 203211.8/1100000: 18% mana | 1.0/5: 20% soul_shard soul_harvest, lord_of_flames, embrace_chaos, accelerando(2)
4:13.634 default Q chaos_bolt Fluffy_Pillow 157952.2/1100000: 14% mana | 2.0/5: 40% soul_shard soul_harvest, lord_of_flames, embrace_chaos, accelerando(2)
4:14.986 default E immolate Fluffy_Pillow 177811.3/1100000: 16% mana | 0.0/5: 0% soul_shard soul_harvest, lord_of_flames, embrace_chaos, accelerando(2)
4:16.113 default R incinerate Fluffy_Pillow 128366.3/1100000: 12% mana | 1.0/5: 20% soul_shard soul_harvest, lord_of_flames, embrace_chaos, accelerando(3)
4:17.506 default R incinerate Fluffy_Pillow 83127.5/1100000: 8% mana | 1.0/5: 20% soul_shard soul_harvest, lord_of_flames, embrace_chaos, accelerando(3)
4:18.899 default S life_tap Fluffy_Pillow 37888.7/1100000: 3% mana | 1.0/5: 20% soul_shard soul_harvest, lord_of_flames, embrace_chaos, accelerando(3)
4:20.011 default R incinerate Fluffy_Pillow 384462.0/1100000: 35% mana | 1.0/5: 20% soul_shard soul_harvest, lord_of_flames, accelerando(3)
4:21.403 default R incinerate Fluffy_Pillow 339272.1/1100000: 31% mana | 1.0/5: 20% soul_shard soul_harvest, lord_of_flames, accelerando(4)
4:22.774 default R incinerate Fluffy_Pillow 294001.1/1100000: 27% mana | 1.0/5: 20% soul_shard soul_harvest, lord_of_flames, accelerando(4)
4:24.146 default Q chaos_bolt Fluffy_Pillow 247568.7/1100000: 23% mana | 2.0/5: 40% soul_shard soul_harvest, lord_of_flames
4:26.465 default C havoc enemy2 280632.5/1100000: 26% mana | 1.0/5: 20% soul_shard soul_harvest, lord_of_flames, embrace_chaos
4:27.626 default G immolate Fluffy_Pillow 209185.7/1100000: 19% mana | 1.0/5: 20% soul_shard lord_of_flames, embrace_chaos
4:28.789 default J conflagrate Fluffy_Pillow 159767.5/1100000: 15% mana | 2.0/5: 40% soul_shard lord_of_flames, embrace_chaos
4:29.952 default Q chaos_bolt Fluffy_Pillow 176349.3/1100000: 16% mana | 3.0/5: 60% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos
4:31.345 default J conflagrate Fluffy_Pillow 196211.4/1100000: 18% mana | 1.0/5: 20% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando
4:32.490 default J conflagrate Fluffy_Pillow 212783.1/1100000: 19% mana | 2.0/5: 40% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando
4:33.634 default P dimensional_rift Fluffy_Pillow 229586.9/1100000: 21% mana | 3.0/5: 60% soul_shard lord_of_flames, embrace_chaos, accelerando(2)
4:34.763 default Q chaos_bolt Fluffy_Pillow 246413.5/1100000: 22% mana | 3.0/5: 60% soul_shard lord_of_flames, embrace_chaos, accelerando(3)
4:36.093 default J conflagrate Fluffy_Pillow 266235.8/1100000: 24% mana | 2.0/5: 40% soul_shard lord_of_flames, embrace_chaos, accelerando(3)
4:37.206 default L service_imp Fluffy_Pillow 282867.2/1100000: 26% mana | 4.0/5: 80% soul_shard lord_of_flames, embrace_chaos, accelerando(4)
4:38.302 default Q chaos_bolt Fluffy_Pillow 299438.3/1100000: 27% mana | 3.0/5: 60% soul_shard lord_of_flames, embrace_chaos, accelerando(4)
4:39.618 default R incinerate Fluffy_Pillow 319335.7/1100000: 29% mana | 2.0/5: 40% soul_shard lord_of_flames, embrace_chaos, accelerando(4)
4:40.989 default P dimensional_rift Fluffy_Pillow 274064.6/1100000: 25% mana | 2.0/5: 40% soul_shard lord_of_flames, embrace_chaos, accelerando(4)
4:42.084 default J conflagrate Fluffy_Pillow 290620.5/1100000: 26% mana | 2.0/5: 40% soul_shard lord_of_flames, embrace_chaos, accelerando(4)
4:43.314 default Q chaos_bolt Fluffy_Pillow 309217.6/1100000: 28% mana | 3.0/5: 60% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(4)
4:44.628 default R incinerate Fluffy_Pillow 328199.7/1100000: 30% mana | 1.0/5: 20% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando
4:46.060 default R incinerate Fluffy_Pillow 282925.1/1100000: 26% mana | 2.0/5: 40% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando
4:47.495 default C havoc enemy2 237695.5/1100000: 22% mana | 2.0/5: 40% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(2)
4:48.623 default Q chaos_bolt Fluffy_Pillow 166264.3/1100000: 15% mana | 3.0/5: 60% soul_shard lord_of_flames, conflagration_of_chaos, accelerando(2)
4:50.874 default E immolate Fluffy_Pillow 199328.5/1100000: 18% mana | 1.0/5: 20% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(2)
4:52.002 default J conflagrate Fluffy_Pillow 149898.4/1100000: 14% mana | 1.0/5: 20% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(3)
4:53.111 default R incinerate Fluffy_Pillow 166426.9/1100000: 15% mana | 2.0/5: 40% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(3)
4:54.500 default Q chaos_bolt Fluffy_Pillow 121372.4/1100000: 11% mana | 2.0/5: 40% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(4)
4:55.813 default J conflagrate Fluffy_Pillow 141027.0/1100000: 13% mana | 0.0/5: 0% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando

Stats

Raid-Buffed Unbuffed Gear Amount
Strength 4201 3876 0
Agility 7254 6929 0
Stamina 54592 54592 34105
Intellect 49775 48068 38456 (1278)
Spirit 1 1 0
Health 3275520 3275520 0
Mana 1100000 1100000 0
Soul Shard 5 5 0
Spell Power 49775 48068 0
Crit 19.29% 19.29% 5714
Haste 29.62% 28.62% 10731
Damage / Heal Versatility 3.41% 3.41% 1620
ManaReg per Second 14258 14148 0
Mastery 66.15% 66.15% 5618
Armor 1954 1954 1954
Run Speed 7 0 0

Gear

Source Slot Average Item Level: 906.00
Local Head Eyes of Azj'Aqir
ilevel: 900, stats: { 253 Armor, +3255 Sta, +2170 Int, +1074 Haste, +578 Vers }
Local Neck Radiant String of Scorpid Eyes
ilevel: 900, stats: { +1831 Sta, +2011 Haste, +922 Crit }, enchant: mark_of_the_hidden_satyr
Local Shoulders Pauldrons of Azj'Aqir
ilevel: 900, stats: { 233 Armor, +2442 Sta, +1628 Int, +752 Mastery, +487 Vers }
Local Chest Robes of Fluctuating Energy
ilevel: 900, stats: { 311 Armor, +3255 Sta, +2170 Int, +1145 Haste, +507 Mastery }
Local Waist Man'ari Skullbuckled Cinch
ilevel: 900, stats: { 175 Armor, +2442 Sta, +1628 Int, +699 Haste, +540 Mastery }
Local Legs Leggings of Azj'Aqir
ilevel: 900, stats: { 272 Armor, +3255 Sta, +2170 Int, +932 Crit, +720 Haste }
Local Feet Outcast Wanderer's Footrags
ilevel: 910, stats: { 222 Armor, +2680 Sta, +1786 Int, +864 Crit, +422 Mastery }
Local Wrists Woven Lasher Tendril Bracers
ilevel: 900, stats: { 136 Armor, +1831 Sta, +1221 Int, +644 Haste, +285 Vers }
Local Hands Clutch of Azj'Aqir
ilevel: 900, stats: { 194 Armor, +2442 Sta, +1628 Int, +859 Crit, +380 Mastery }
Local Finger1 Ring of the Scoured Clan
ilevel: 900, stats: { +1831 Sta, +2095 Mastery, +838 Haste }, enchant: { +200 Haste }
Local Finger2 Alythess's Pyrogenics
ilevel: 940, stats: { +2658 Sta, +2137 Crit, +1602 Haste }, enchant: { +200 Haste }
Local Trinket1 Whispers in the Dark
ilevel: 905, stats: { +2162 Int }
Local Trinket2 Erratic Metronome
ilevel: 900, stats: { +2063 Int }
Local Back Astromancer's Greatcloak
ilevel: 905, stats: { 158 Armor, +1918 Sta, +1278 StrAgiInt, +676 Haste, +270 Vers }, enchant: { +200 Int }
Local Main Hand Scepter of Sargeras
ilevel: 929, weapon: { 7005 - 10509, 3.6 }, stats: { +2843 Int, +4265 Sta, +922 Haste, +922 Mastery, +15509 Int }, relics: { +61 ilevels, +59 ilevels, +61 ilevels }

Talents

Level
15 Backdraft (Destruction Warlock) Roaring Blaze (Destruction Warlock) Shadowburn (Destruction Warlock)
30 Reverse Entropy (Destruction Warlock) Eradication (Destruction Warlock) Empowered Life Tap
45 Demonic Circle Mortal Coil Shadowfury
60 Cataclysm (Destruction Warlock) Fire and Brimstone (Destruction Warlock) Soul Harvest
75 Demon Skin Burning Rush Dark Pact
90 Grimoire of Supremacy Grimoire of Service Grimoire of Sacrifice
100 Wreak Havoc (Destruction Warlock) Channel Demonfire (Destruction Warlock) Soul Conduit

Profile

warlock="Alythess'"
level=110
race=troll
role=spell
position=back
talents=2203021
artifact=38:0:0:0:0:803:1:804:3:805:3:806:3:807:3:808:3:809:3:810:3:811:3:812:3:813:1:814:1:815:1:816:1:817:1:818:1:1355:1:1392:1:1609:4:1610:1:1611:1:1713:1
spec=destruction

# This default action priority list is automatically created based on your character.
# It is a attempt to provide you with a action list that is both simple and practicable,
# while resulting in a meaningful and good simulation. It may not result in the absolutely highest possible dps.
# Feel free to edit, adapt and improve it to your own needs.
# SimulationCraft is always looking for updates and improvements to the default action lists.

# Executed before combat begins. Accepts non-harmful actions only.
actions.precombat=flask,type=whispered_pact
actions.precombat+=/food,type=azshari_salad
actions.precombat+=/summon_pet,if=!talent.grimoire_of_supremacy.enabled&(!talent.grimoire_of_sacrifice.enabled|buff.demonic_power.down)
actions.precombat+=/summon_infernal,if=talent.grimoire_of_supremacy.enabled&artifact.lord_of_flames.rank>0
actions.precombat+=/summon_infernal,if=talent.grimoire_of_supremacy.enabled&active_enemies>1
actions.precombat+=/summon_doomguard,if=talent.grimoire_of_supremacy.enabled&active_enemies=1&artifact.lord_of_flames.rank=0
actions.precombat+=/augmentation,type=defiled
actions.precombat+=/snapshot_stats
actions.precombat+=/grimoire_of_sacrifice,if=talent.grimoire_of_sacrifice.enabled
actions.precombat+=/life_tap,if=talent.empowered_life_tap.enabled&!buff.empowered_life_tap.remains
actions.precombat+=/potion,name=prolonged_power
actions.precombat+=/chaos_bolt

# Executed every time the actor is available.
actions=havoc,target=2,if=active_enemies>1&(active_enemies<4|talent.wreak_havoc.enabled&active_enemies<6)&!debuff.havoc.remains
actions+=/dimensional_rift,if=charges=3
actions+=/immolate,if=remains<=tick_time
actions+=/immolate,cycle_targets=1,if=active_enemies>1&remains<=tick_time&(!talent.roaring_blaze.enabled|(!debuff.roaring_blaze.remains&action.conflagrate.charges<2+set_bonus.tier19_4pc))
actions+=/immolate,if=talent.roaring_blaze.enabled&remains<=duration&!debuff.roaring_blaze.remains&target.time_to_die>10&(action.conflagrate.charges=2+set_bonus.tier19_4pc|(action.conflagrate.charges>=1+set_bonus.tier19_4pc&action.conflagrate.recharge_time<cast_time+gcd)|target.time_to_die<24)
actions+=/berserking
actions+=/blood_fury
actions+=/arcane_torrent
actions+=/potion,name=deadly_grace,if=(buff.soul_harvest.remains|trinket.proc.any.react|target.time_to_die<=45)
actions+=/shadowburn,if=buff.conflagration_of_chaos.remains<=action.chaos_bolt.cast_time
actions+=/shadowburn,if=(charges=1+set_bonus.tier19_4pc&recharge_time<action.chaos_bolt.cast_time|charges=2+set_bonus.tier19_4pc)&soul_shard<5
actions+=/conflagrate,if=talent.roaring_blaze.enabled&(charges=2+set_bonus.tier19_4pc|(charges>=1+set_bonus.tier19_4pc&recharge_time<gcd)|target.time_to_die<24)
actions+=/conflagrate,if=talent.roaring_blaze.enabled&debuff.roaring_blaze.stack>0&dot.immolate.remains>dot.immolate.duration*0.3&(active_enemies=1|soul_shard<3)&soul_shard<5
actions+=/conflagrate,if=!talent.roaring_blaze.enabled&buff.backdraft.stack<3&buff.conflagration_of_chaos.remains<=action.chaos_bolt.cast_time
actions+=/conflagrate,if=!talent.roaring_blaze.enabled&buff.backdraft.stack<3&(charges=1+set_bonus.tier19_4pc&recharge_time<action.chaos_bolt.cast_time|charges=2+set_bonus.tier19_4pc)&soul_shard<5
actions+=/life_tap,if=talent.empowered_life_tap.enabled&buff.empowered_life_tap.remains<=gcd
actions+=/dimensional_rift,if=equipped.144369&!buff.lessons_of_spacetime.remains&((!talent.grimoire_of_supremacy.enabled&!cooldown.summon_doomguard.remains)|(talent.grimoire_of_service.enabled&!cooldown.service_pet.remains)|(talent.soul_harvest.enabled&!cooldown.soul_harvest.remains))
actions+=/service_pet
actions+=/summon_infernal,if=artifact.lord_of_flames.rank>0&!buff.lord_of_flames.remains
actions+=/summon_doomguard,if=!talent.grimoire_of_supremacy.enabled&spell_targets.infernal_awakening<=2&(target.time_to_die>180|target.health.pct<=20|target.time_to_die<30)
actions+=/summon_infernal,if=!talent.grimoire_of_supremacy.enabled&spell_targets.infernal_awakening>2
actions+=/summon_doomguard,if=talent.grimoire_of_supremacy.enabled&spell_targets.summon_infernal=1&artifact.lord_of_flames.rank>0&buff.lord_of_flames.remains&!pet.doomguard.active
actions+=/summon_doomguard,if=talent.grimoire_of_supremacy.enabled&spell_targets.summon_infernal=1&equipped.132379&!cooldown.sindorei_spite_icd.remains
actions+=/summon_infernal,if=talent.grimoire_of_supremacy.enabled&spell_targets.summon_infernal>1&equipped.132379&!cooldown.sindorei_spite_icd.remains
actions+=/soul_harvest
actions+=/channel_demonfire,if=dot.immolate.remains>cast_time
actions+=/havoc,if=active_enemies=1&talent.wreak_havoc.enabled&equipped.132375&!debuff.havoc.remains
actions+=/rain_of_fire,if=active_enemies>=3&cooldown.havoc.remains<=12&!talent.wreak_havoc.enabled
actions+=/rain_of_fire,if=active_enemies>=6&talent.wreak_havoc.enabled
actions+=/dimensional_rift,if=!equipped.144369|charges>1|((!talent.grimoire_of_service.enabled|recharge_time<cooldown.service_pet.remains)&(!talent.soul_harvest.enabled|recharge_time<cooldown.soul_harvest.remains)&(!talent.grimoire_of_supremacy.enabled|recharge_time<cooldown.summon_doomguard.remains))
actions+=/life_tap,if=talent.empowered_life_tap.enabled&buff.empowered_life_tap.remains<duration*0.3
actions+=/cataclysm
actions+=/chaos_bolt,if=(cooldown.havoc.remains>12&cooldown.havoc.remains|active_enemies<3|talent.wreak_havoc.enabled&active_enemies<6)&(set_bonus.tier19_4pc=0|!talent.eradication.enabled|buff.embrace_chaos.remains<=cast_time|soul_shard>=3)
actions+=/shadowburn
actions+=/conflagrate,if=!talent.roaring_blaze.enabled&buff.backdraft.stack<3
actions+=/immolate,if=!talent.roaring_blaze.enabled&remains<=duration*0.3
actions+=/incinerate
actions+=/life_tap

head=eyes_of_azjaqir,id=138314,bonus_id=3445
neck=radiant_string_of_scorpid_eyes,id=140898,bonus_id=3445,enchant_id=5439
shoulders=pauldrons_of_azjaqir,id=138323,bonus_id=3445
back=astromancers_greatcloak,id=140909,bonus_id=3518,enchant_id=5436
chest=robes_of_fluctuating_energy,id=140848,bonus_id=3445
wrists=woven_lasher_tendril_bracers,id=140886,bonus_id=3445
hands=clutch_of_azjaqir,id=138311,bonus_id=3445
waist=manari_skullbuckled_cinch,id=140887,bonus_id=3445
legs=leggings_of_azjaqir,id=138317,bonus_id=3445
feet=outcast_wanderers_footrags,id=140914,bonus_id=3519
finger1=ring_of_the_scoured_clan,id=140897,bonus_id=3445,enchant=binding_of_haste
finger2=alythesss_pyrogenics,id=132460,ilevel=940,enchant=binding_of_haste
trinket1=whispers_in_the_dark,id=140809,ilevel=905
trinket2=erratic_metronome,id=140792,ilevel=900
main_hand=scepter_of_sargeras,id=128941,ilevel=929,gem_id=140826/140837/140826,relic_id=3519/3518:3518/3519

# Gear Summary
# gear_ilvl=905.93
# gear_stamina=34105
# gear_intellect=38456
# gear_crit_rating=5714
# gear_haste_rating=10731
# gear_mastery_rating=5618
# gear_versatility_rating=1620
# gear_armor=1954
# set_bonus=tier19_2pc=1
# set_bonus=tier19_4pc=1
default_pet=imp

Cloak : 1323962 dps, 792799 dps to main target

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR
1323962.0 1323962.0 1107.5 / 0.084% 224219.8 / 16.9% 41.8
RPS Out RPS In Primary Resource Waiting APM Active Skill
25265.6 25265.6 Mana 0.00% 50.0 100.0% 100%
Talents
  • 15: Roaring Blaze (Destruction Warlock)
  • 30: Eradication (Destruction Warlock)
  • 60: Soul Harvest
  • 90: Grimoire of Service
  • 100: Wreak Havoc (Destruction Warlock)
  • Talent Calculator
Artifact

Charts

Abilities

Damage Stats DPS DPS% Execute Interval DPE DPET Type Count Hit Crit Avg Crit% Up%
Cloak 1323962
Chaos Bolt 390334 29.5% 60.6 4.82sec 1937235 1293011 Direct 115.7 0 1013991 1013991 100.0%  

Stats details: chaos_bolt

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 60.58 115.74 0.00 0.00 1.4983 0.0000 117364025.81 117364025.81 0.00 1293011.04 1293011.04
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
crit 115.74 100.00% 1013991.26 658713 1547709 1014313.53 952673 1073739 117364026 117364026 0.00
 
 

Action details: chaos_bolt

Static Values
  • id:116858
  • school:chromatic
  • resource:soul_shard
  • range:40.0
  • travel_speed:16.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:2.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:3.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:116858
  • name:Chaos Bolt
  • school:chromatic
  • tooltip:
  • description:Unleashes a devastating blast of chaos, causing {$s1=1} Chaos damage. Chaos Bolt always critically strikes and your critical strike chance increases its damage.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:4.000000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
Conflagrate 164139 12.4% 48.3 6.22sec 1020939 981415 Direct 96.0 301351 684358 513365 55.4%  

Stats details: conflagrate

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 48.29 96.04 0.00 0.00 1.0403 0.0000 49302387.74 49302387.74 0.00 981415.47 981415.47
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 42.88 44.65% 301351.24 198012 465244 301505.14 269578 338951 12921205 12921205 0.00
crit 53.16 55.35% 684358.39 396029 1076356 684520.71 615048 761885 36381183 36381183 0.00
 
 

Action details: conflagrate

Static Values
  • id:17962
  • school:fire
  • resource:chi
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:9.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:talent.roaring_blaze.enabled&(charges=2+set_bonus.tier19_4pc|(charges>=1+set_bonus.tier19_4pc&recharge_time<gcd)|target.time_to_die<24)
Spelldata
  • id:17962
  • name:Conflagrate
  • school:fire
  • tooltip:
  • description:Triggers an explosion on the target, dealing {$s1=1} Fire damage.{$?s196406=false}[ Reduces the cast time of Incinerate and Chaos Bolt by {$117828s1=30}% for {$117828d=10 seconds}.][] |cFFFFFFFFGenerates 1 Soul Shard.|r
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:2.265510
  • base_dd_min:1.00
  • base_dd_max:1.00
 
Cry Havoc 40145 3.0% 52.3 5.53sec 230949 0 Direct 104.5 99822 199653 115475 15.7%  

Stats details: cry_havoc

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 52.27 104.53 0.00 0.00 0.0000 0.0000 12070976.54 12070976.54 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 88.14 84.32% 99822.23 71307 149591 99870.97 93271 107717 8798680 8798680 0.00
crit 16.39 15.68% 199652.99 142613 299181 199749.34 165292 241962 3272296 3272296 0.00
 
 

Action details: cry_havoc

Static Values
  • id:243011
  • school:chromatic
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:243011
  • name:Cry Havoc
  • school:chromatic
  • tooltip:
  • description:Deals {$s2=0} Chaos damage to enemies within $A2 yards.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:1.000000
  • base_dd_min:0.00
  • base_dd_max:0.00
 
Deadly Grace 6100 0.5% 14.3 2.07sec 125540 0 Direct 14.3 108683 217492 125538 15.5%  

Stats details: deadly_grace

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 14.35 14.35 0.00 0.00 0.0000 0.0000 1801020.17 1801020.17 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 12.12 84.51% 108683.16 96371 115646 108700.14 100226 115646 1317674 1317674 0.00
crit 2.22 15.49% 217492.42 192743 231291 196134.51 0 231291 483346 483346 0.00
 
 

Action details: deadly_grace

Static Values
  • id:188091
  • school:arcane
  • resource:none
  • range:40.0
  • travel_speed:25.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:188091
  • name:Deadly Grace
  • school:arcane
  • tooltip:
  • description:Deal {$s1=63339 to 95008} Arcane damage.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:63338.72
  • base_dd_max:95008.08
 
Immolate 301956 22.8% 20.0 15.24sec 4540986 4308877 Direct 38.6 157775 315786 258512 63.8%  
Periodic 292.8 168518 336791 275593 63.6% 195.9%

Stats details: immolate

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 19.97 38.63 292.84 292.84 1.0539 2.0141 90688927.46 90688927.46 0.00 148464.23 4308876.68
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 14.00 36.24% 157775.37 104077 250123 157798.53 130468 190342 2208964 2208964 0.00
crit 24.63 63.76% 315786.08 208157 501830 315759.81 273616 356598 7777462 7777462 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 106.5 36.37% 168518.29 79 485826 168765.64 140656 202707 17947984 17947984 0.00
crit 186.3 63.63% 336791.41 120 971661 337306.31 296564 381738 62754518 62754518 0.00
 
 

Action details: immolate

Static Values
  • id:348
  • school:fire
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:66000.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:1.50
  • base_crit:0.48
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:remains<=tick_time
Spelldata
  • id:348
  • name:Immolate
  • school:fire
  • tooltip:
  • description:Burns the enemy, causing {$s1=1} Fire damage immediately and an additional $157736o1 Fire damage over {$157736d=18 seconds}. |cFFFFFFFFPeriodic damage has a {$193541s1=15}% chance to generate 1 Soul Shard. Chance doubled on critical strikes.|r
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:1.332000
  • base_dd_min:1.00
  • base_dd_max:1.00
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.721500
  • base_td:0.00
  • dot_duration:18.00
  • base_tick_time:3.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
 
Incinerate 144750 11.0% 75.4 3.82sec 577573 450187 Direct 144.1 261238 522156 302193 15.7%  

Stats details: incinerate

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 75.41 144.12 0.00 0.00 1.2830 0.0000 43552909.68 43552909.68 0.00 450187.19 450187.19
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 121.50 84.30% 261238.16 168236 395281 261300.64 244256 280014 31740578 31740578 0.00
crit 22.62 15.70% 522155.93 336531 790564 522293.09 450399 612775 11812332 11812332 0.00
 
 

Action details: incinerate

Static Values
  • id:29722
  • school:fire
  • resource:mana
  • range:40.0
  • travel_speed:20.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:66000.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:1.88
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:29722
  • name:Incinerate
  • school:fire
  • tooltip:
  • description:Draws fire toward the enemy, dealing {$s2=0} Fire damage.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:2.331000
  • base_dd_min:0.00
  • base_dd_max:0.00
 
Mark of the Hidden Satyr 10268 0.8% 19.9 15.04sec 154776 0 Direct 19.9 133671 267290 154776 15.8%  

Stats details: mark_of_the_hidden_satyr

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 19.94 19.94 0.00 0.00 0.0000 0.0000 3086420.28 3086420.28 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 16.79 84.21% 133671.47 127333 160775 133704.07 127333 145593 2244563 2244563 0.00
crit 3.15 15.79% 267290.34 254666 321550 256066.47 0 321550 841857 841857 0.00
 
 

Action details: mark_of_the_hidden_satyr

Static Values
  • id:191259
  • school:fire
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:191259
  • name:Mark of the Hidden Satyr
  • school:fire
  • tooltip:
  • description:Deals fire damage.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:2.500000
  • spell_power_mod.direct:2.000000
  • base_dd_min:0.00
  • base_dd_max:0.00
 
pet - imp 48760 / 48760
Firebolt 48760 3.7% 108.6 2.77sec 134936 110638 Direct 107.7 117577 235186 135981 15.6%  

Stats details: firebolt

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 108.58 107.75 0.00 0.00 1.2196 0.0000 14651356.13 14651356.13 0.00 110638.06 110638.06
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 90.89 84.35% 117577.48 75128 142289 117608.78 114763 120128 10686071 10686071 0.00
crit 16.86 15.65% 235186.11 150256 284577 235238.10 209521 259749 3965285 3965285 0.00
 
 

Action details: firebolt

Static Values
  • id:3110
  • school:fire
  • resource:energy
  • range:40.0
  • travel_speed:16.0000
  • trigger_gcd:0.5000
  • min_gcd:0.7500
  • base_cost:40.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:1.75
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:3110
  • name:Firebolt
  • school:fire
  • tooltip:
  • description:Deals {$s1=1} Fire damage to a target.$?a231795[ Damage increased by {$231795s1=50}% if you have Immolated the target.][] |cFF777777(Right-Click to toggle)|r
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:1.000000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
pet - service_imp 141565 / 45298
Firebolt 141565 3.4% 49.2 5.53sec 275843 241248 Direct 48.9 239792 479708 277453 15.7%  

Stats details: firebolt

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 49.21 48.92 0.00 0.00 1.1434 0.0000 13573802.71 13573802.71 0.00 241247.72 241247.72
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 41.24 84.30% 239792.05 150256 284577 240026.89 228736 249960 9889926 9889926 0.00
crit 7.68 15.70% 479707.52 300512 569154 480067.33 0 569154 3683877 3683877 0.00
 
 

Action details: firebolt

Static Values
  • id:3110
  • school:fire
  • resource:energy
  • range:40.0
  • travel_speed:16.0000
  • trigger_gcd:0.5000
  • min_gcd:0.7500
  • base_cost:40.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:1.75
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:3110
  • name:Firebolt
  • school:fire
  • tooltip:
  • description:Deals {$s1=1} Fire damage to a target.$?a231795[ Damage increased by {$231795s1=50}% if you have Immolated the target.][] |cFF777777(Right-Click to toggle)|r
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:1.000000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
pet - infernal 133901 / 11340
Immolation 104335 0.7% 1.0 0.00sec 2608480 0 Periodic 46.5 48477 96962 56127 15.8% 8.1%

Stats details: immolation

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 23.24 46.47 0.0000 1.0485 2608480.35 2608480.35 0.00 107062.89 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 39.1 84.22% 48476.90 41868 50242 48481.20 47157 49684 1897472 1897472 0.00
crit 7.3 15.78% 96961.61 83737 100484 96882.80 0 100484 711008 711008 0.00
 
 

Action details: immolation

Static Values
  • id:19483
  • school:fire
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:!ticking
Spelldata
  • id:19483
  • name:Immolation
  • school:fire
  • tooltip:Burns nearby enemies for {$20153s1=0} fire damage every $t1 seconds.
  • description:Burns nearby enemies for {$20153s1=0} fire damage every $t1 seconds.
 

Action details: immolation_tick

Static Values
  • id:20153
  • school:fire
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:20153
  • name:Immolation
  • school:fire
  • tooltip:
  • description:Deals Fire damage to all enemies near the caster.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.650000
  • base_dd_min:0.00
  • base_dd_max:0.00
 
melee 29566 0.2% 22.0 1.11sec 33575 30428 Direct 22.0 29022 58063 33574 15.7%  

Stats details: melee

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 22.02 22.02 0.00 0.00 1.1035 0.0000 739180.30 1086665.06 31.98 30427.71 30427.71
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 18.56 84.32% 29022.04 25037 30045 29022.10 28257 30045 538789 792071 31.98
crit 3.45 15.68% 58062.64 50075 60090 56795.28 0 60090 200391 294594 31.28
 
 

Action details: melee

Static Values
  • id:0
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Weapon
  • normalized:false
  • weapon_power_mod:0.285714
  • weapon_multiplier:1.00
 
pet - doomguard 109601 / 9274
Doom Bolt 109601 0.7% 10.9 2.21sec 251031 116135 Direct 10.9 217391 434183 251038 15.5%  

Stats details: doom_bolt

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 10.92 10.92 0.00 0.00 2.1616 0.0000 2740081.73 2740081.73 0.00 116134.68 116134.68
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 9.22 84.48% 217390.57 210101 252121 217376.02 210101 252121 2004486 2004486 0.00
crit 1.69 15.52% 434182.67 420202 504243 363855.98 0 504243 735596 735596 0.00
 
 

Action details: doom_bolt

Static Values
  • id:85692
  • school:shadow
  • resource:energy
  • range:30.0
  • travel_speed:20.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:35.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:3.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:85692
  • name:Doom Bolt
  • school:shadow
  • tooltip:
  • description:Sends a shadowy bolt at the enemy, causing {$s1=1} Shadow damage. Deals {$s2=20}% additional damage to targets below 20% health.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:2.750000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
pet - lord_of_flames_infernal 133816 / 11332
Immolation 104263 0.7% 1.0 0.00sec 2606682 0 Periodic 46.5 48476 96975 56088 15.7% 8.1%

Stats details: immolation

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 23.24 46.47 0.0000 1.0485 2606682.34 2606682.34 0.00 106989.10 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 39.2 84.30% 48475.70 41868 50242 48480.51 47132 49988 1899270 1899270 0.00
crit 7.3 15.70% 96974.51 83737 100484 96942.68 0 100484 707412 707412 0.00
 
 

Action details: immolation

Static Values
  • id:19483
  • school:fire
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:!ticking
Spelldata
  • id:19483
  • name:Immolation
  • school:fire
  • tooltip:Burns nearby enemies for {$20153s1=0} fire damage every $t1 seconds.
  • description:Burns nearby enemies for {$20153s1=0} fire damage every $t1 seconds.
 

Action details: immolation_tick

Static Values
  • id:20153
  • school:fire
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:20153
  • name:Immolation
  • school:fire
  • tooltip:
  • description:Deals Fire damage to all enemies near the caster.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.650000
  • base_dd_min:0.00
  • base_dd_max:0.00
 
melee 29553 0.2% 22.0 1.11sec 33559 30414 Direct 22.0 29023 58048 33559 15.6%  

Stats details: melee

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 22.02 22.02 0.00 0.00 1.1035 0.0000 738846.77 1086174.73 31.98 30413.98 30413.98
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 18.58 84.37% 29023.42 25037 30045 29023.59 27959 30045 539123 792562 31.98
crit 3.44 15.63% 58047.84 50075 60090 56626.96 0 60090 199724 293613 31.19
 
 

Action details: melee

Static Values
  • id:0
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Weapon
  • normalized:false
  • weapon_power_mod:0.285714
  • weapon_multiplier:1.00
 
pet - lord_of_flames_infernal 133773 / 11329
Immolation 104236 0.7% 1.0 0.00sec 2606010 0 Periodic 46.5 48473 97003 56074 15.7% 8.1%

Stats details: immolation

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 23.24 46.47 0.0000 1.0485 2606009.86 2606009.86 0.00 106961.50 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 39.2 84.34% 48473.07 41868 50242 48477.54 47052 49658 1899943 1899943 0.00
crit 7.3 15.66% 97002.92 83737 100484 96972.45 0 100484 706067 706067 0.00
 
 

Action details: immolation

Static Values
  • id:19483
  • school:fire
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:!ticking
Spelldata
  • id:19483
  • name:Immolation
  • school:fire
  • tooltip:Burns nearby enemies for {$20153s1=0} fire damage every $t1 seconds.
  • description:Burns nearby enemies for {$20153s1=0} fire damage every $t1 seconds.
 

Action details: immolation_tick

Static Values
  • id:20153
  • school:fire
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:20153
  • name:Immolation
  • school:fire
  • tooltip:
  • description:Deals Fire damage to all enemies near the caster.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.650000
  • base_dd_min:0.00
  • base_dd_max:0.00
 
melee 29537 0.2% 22.0 1.11sec 33541 30397 Direct 22.0 29022 58061 33541 15.6%  

Stats details: melee

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 22.02 22.02 0.00 0.00 1.1035 0.0000 738444.12 1085582.81 31.98 30397.40 30397.40
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 18.59 84.44% 29022.20 25037 30045 29022.46 28257 30045 539525 793154 31.98
crit 3.43 15.56% 58061.12 50075 60090 56692.40 0 60090 198919 292429 31.22
 
 

Action details: melee

Static Values
  • id:0
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Weapon
  • normalized:false
  • weapon_power_mod:0.285714
  • weapon_multiplier:1.00
 
pet - lord_of_flames_infernal 133653 / 11317
Immolation 104110 0.7% 1.0 0.00sec 2602855 0 Periodic 46.5 48478 96954 56005 15.5% 8.1%

Stats details: immolation

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 23.24 46.47 0.0000 1.0485 2602855.18 2602855.18 0.00 106832.01 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 39.3 84.47% 48477.63 41868 50242 48481.15 46893 49790 1903097 1903097 0.00
crit 7.2 15.53% 96953.80 83737 100484 96905.01 0 100484 699758 699758 0.00
 
 

Action details: immolation

Static Values
  • id:19483
  • school:fire
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:!ticking
Spelldata
  • id:19483
  • name:Immolation
  • school:fire
  • tooltip:Burns nearby enemies for {$20153s1=0} fire damage every $t1 seconds.
  • description:Burns nearby enemies for {$20153s1=0} fire damage every $t1 seconds.
 

Action details: immolation_tick

Static Values
  • id:20153
  • school:fire
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:20153
  • name:Immolation
  • school:fire
  • tooltip:
  • description:Deals Fire damage to all enemies near the caster.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.650000
  • base_dd_min:0.00
  • base_dd_max:0.00
 
melee 29543 0.2% 22.0 1.11sec 33549 30404 Direct 22.0 29023 58055 33549 15.6%  

Stats details: melee

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 22.02 22.02 0.00 0.00 1.1035 0.0000 738608.89 1085825.03 31.98 30404.19 30404.19
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 18.58 84.41% 29022.74 25037 30045 29022.90 28119 30045 539361 792911 31.98
crit 3.43 15.59% 58055.16 50075 60090 56730.31 0 60090 199248 292914 31.24
 
 

Action details: melee

Static Values
  • id:0
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Weapon
  • normalized:false
  • weapon_power_mod:0.285714
  • weapon_multiplier:1.00
 
pet - shadowy_tear 135005 / 18133
Shadow Bolt 135005 1.4% 3.3 68.93sec 1629625 0 Periodic 36.8 127407 254855 147518 15.8% 15.1%

Stats details: shadow_bolt

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 3.33 0.00 36.98 36.79 0.0000 1.2278 5427213.22 5427213.22 0.00 119526.35 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 31.0 84.22% 127406.64 67 154593 126781.17 0 154593 3947838 3947838 0.00
crit 5.8 15.78% 254855.43 161 309186 246936.72 0 309186 1479375 1479375 0.00
 
 

Action details: shadow_bolt

Static Values
  • id:196657
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:20.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:196657
  • name:Shadow Bolt
  • school:shadow
  • tooltip:
  • description:Sends a shadowy bolt at the enemy, causing {$s1=1} Shadow damage.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • dot_duration:14.00
  • base_tick_time:2.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
 
pet - flame_rift 284104 / 78226
Searing Bolt 284104 5.9% 64.8 2.62sec 361494 1105709 Direct 64.4 66056 0 66056 0.0%  
Periodic 137.1 120814 241585 139758 15.7% 45.1%

Stats details: searing_bolt

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 64.77 64.38 137.11 137.11 0.3269 0.9895 23414503.67 23414503.67 0.00 149282.45 1105709.47
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 64.38 100.00% 66055.61 61219 77297 66026.83 0 77297 4252896 4252896 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 115.6 84.31% 120814.02 122 154621 120108.64 0 139194 13966211 13966211 0.00
crit 21.5 15.69% 241584.64 245 309241 239876.13 0 309241 5195397 5195397 0.00
 
 

Action details: searing_bolt

Static Values
  • id:243050
  • school:fire
  • resource:energy
  • range:100.0
  • travel_speed:20.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:1.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:243050
  • name:Searing Bolt
  • school:fire
  • tooltip:Burning for $w2 Fire damage every $t2 sec.
  • description:Sends a searing bolt at the enemy, causing {$s1=1} Fire damage, and an additional $o2 Fire damage over {$d=30 seconds}, stacking up to {$u=20} times.
Direct Damage
  • may_crit:false
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:1.000000
  • base_dd_min:1.00
  • base_dd_max:1.00
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.100000
  • base_td:1.00
  • dot_duration:30.00
  • base_tick_time:1.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
 
pet - chaos_tear 158095 / 8419
Chaos Bolt 158095 0.6% 3.3 70.62sec 759145 382500 Direct 3.3 0 764020 764020 100.0%  

Stats details: chaos_bolt

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 3.33 3.30 0.00 0.00 1.9847 0.0000 2524498.60 2524498.60 0.00 382499.79 382499.79
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
crit 3.30 100.00% 764020.08 708156 894140 763092.07 0 894140 2524499 2524499 0.00
 
 

Action details: chaos_bolt

Static Values
  • id:215279
  • school:chromatic
  • resource:none
  • range:100.0
  • travel_speed:16.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:5.500
  • base_execute_time:3.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:215279
  • name:Chaos Bolt
  • school:chromatic
  • tooltip:
  • description:Unleashes a devastating blast of chaos, causing {$s1=1} Chaos damage. Chaos Bolt always critically strikes and your critical strike chance increases its damage.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:5.000000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
pet - chaos_portal 284003 / 16487
Chaos Barrage 284003 1.2% 3.3 68.78sec 1476879 0 Periodic 117.3 36364 72723 42046 15.6% 6.0%

Stats details: chaos_barrage

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 3.34 0.00 117.77 117.25 0.0000 0.1540 4929875.25 4929875.25 0.00 271813.16 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 98.9 84.37% 36363.82 148 42514 36190.62 0 42514 3597329 3597329 0.00
crit 18.3 15.63% 72723.42 312 85028 72344.93 0 85028 1332546 1332546 0.00
 
 

Action details: chaos_barrage

Static Values
  • id:187394
  • school:magic
  • resource:none
  • range:100.0
  • travel_speed:24.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:187394
  • name:Chaos Barrage
  • school:magic
  • tooltip:
  • description:Deals {$s1=1} Chaos damage.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • dot_duration:5.50
  • base_tick_time:0.25
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
 
Simple Action Stats Execute Interval
Cloak
augmentation 1.0 0.00sec

Stats details: augmentation

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: augmentation

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Cloak
  • harmful:false
  • if_expr:
 
Berserking 2.1 180.61sec

Stats details: berserking

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.06 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: berserking

Static Values
  • id:26297
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:180.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:26297
  • name:Berserking
  • school:physical
  • tooltip:Haste increased by {$s1=15}%.
  • description:Increases your haste by {$s1=15}% for {$d=10 seconds}.
 
Dimensional Rift 12.9 23.56sec

Stats details: dimensional_rift

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 12.90 0.00 0.00 0.00 1.0107 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: dimensional_rift

Static Values
  • id:196586
  • school:none
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:45.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:charges=3
Spelldata
  • id:196586
  • name:Dimensional Rift
  • school:chaos
  • tooltip:
  • description:Rips a hole in time and space, opening a portal that damages your target.
 
flask 1.0 0.00sec

Stats details: flask

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: flask

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Cloak
  • harmful:false
  • if_expr:
 
food 1.0 0.00sec

Stats details: food

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: food

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Cloak
  • harmful:false
  • if_expr:
 
Havoc 14.9 20.91sec

Stats details: havoc

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 14.89 0.00 0.00 0.00 1.0696 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: havoc

Static Values
  • id:80240
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:88000.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:active_enemies>1&(active_enemies<4|talent.wreak_havoc.enabled&active_enemies<6)&!debuff.havoc.remains
Spelldata
  • id:80240
  • name:Havoc
  • school:shadow
  • tooltip:Spells cast by the Warlock also hit this target.
  • description:Marks a target with Havoc for {$d=8 seconds}, causing your single target spells to also strike the Havoc victim. Limit 1.
 
Life Tap 6.6 33.59sec

Stats details: life_tap

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 6.64 0.00 0.00 0.00 1.0435 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: life_tap

Static Values
  • id:1454
  • school:shadow
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:talent.empowered_life_tap.enabled&!buff.empowered_life_tap.remains
Spelldata
  • id:1454
  • name:Life Tap
  • school:shadow
  • tooltip:
  • description:Restores {$s1=30}% of your maximum mana, at the cost of {$s2=10}% of your maximum health.
 
potion 2.0 0.00sec

Stats details: potion

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: potion

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:60.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
 
Grimoire: Imp (service_imp) 3.7 91.39sec

Stats details: service_imp

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 3.69 0.00 0.00 0.00 0.9717 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: service_imp

Static Values
  • id:111859
  • school:shadow
  • resource:soul_shard
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:1.0
  • secondary_cost:0.0
  • cooldown:90.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:111859
  • name:Grimoire: Imp
  • school:shadow
  • tooltip:
  • description:Summons an Imp who attacks the target for {$108501s1=25} sec. Imps cast ranged Firebolts and cleanse a hostile magic effect from their master.
 
Soul Harvest 2.9 120.93sec

Stats details: soul_harvest

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.90 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: soul_harvest

Static Values
  • id:196098
  • school:shadow
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:120.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:196098
  • name:Soul Harvest
  • school:shadow
  • tooltip:Damage increased by {$s1=20}%.
  • description:Increases your damage and your pets' damage by {$s1=20}%. Lasts {$d=15 seconds}, increased by {$s2=2} sec for each target afflicted by your {$?s137043=false}[Agony][]{$?s137044=false}[Doom][]{$?s137046=false}[Immolate][], up to a maximum of {$s3=35} sec.
 
Summon Doomguard 1.0 0.00sec

Stats details: summon_doomguard

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 1.0831 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: summon_doomguard

Static Values
  • id:18540
  • school:shadow
  • resource:soul_shard
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:1.0
  • secondary_cost:0.0
  • cooldown:180.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:talent.grimoire_of_supremacy.enabled&active_enemies=1&artifact.lord_of_flames.rank=0
Spelldata
  • id:18540
  • name:Summon Doomguard
  • school:shadow
  • tooltip:
  • description:Summons a Doomguard for {$60478d=25 seconds} to assault the target with its Doom Bolts.
 
Summon Imp 1.0 0.00sec

Stats details: summon_imp

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: summon_imp

Static Values
  • id:688
  • school:shadow
  • resource:soul_shard
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:1.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:2.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:!talent.grimoire_of_supremacy.enabled&(!talent.grimoire_of_sacrifice.enabled|buff.demonic_power.down)
Spelldata
  • id:688
  • name:Summon Imp
  • school:shadow
  • tooltip:
  • description:Summons an Imp under your command that casts ranged Firebolts.$?s74434[ |cFFFFFFFFSoulburn:|r |cFF8282FFInstant cast.|r][]
 
Summon Infernal 1.0 0.00sec

Stats details: summon_infernal

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.7584 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: summon_infernal

Static Values
  • id:1122
  • school:shadow
  • resource:soul_shard
  • range:30.0
  • travel_speed:1.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:1.0
  • secondary_cost:0.0
  • cooldown:180.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:talent.grimoire_of_supremacy.enabled&artifact.lord_of_flames.rank>0
Spelldata
  • id:1122
  • name:Summon Infernal
  • school:shadow
  • tooltip:
  • description:Summons an Infernal from the Twisting Nether, impacting for {$22703s1=0} Fire damage and stunning all enemy targets in the area for {$22703d=2 seconds}. The Infernal will serve you for {$111685d=25 seconds}, dealing strong area-of-effect damage.
 

Buffs

Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit Overflow Expiry
Accelerando 20.1 0.0 15.4sec 15.4sec 78.46% 78.46% 1.5(1.5) 19.3

Buff details

  • buff initial source:Cloak
  • cooldown name:buff_accelerando
  • max_stacks:5
  • duration:12.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00

Stat Buff details

  • stat:haste_rating
  • amount:734.41

Stack Uptimes

  • accelerando_1:29.62%
  • accelerando_2:24.53%
  • accelerando_3:14.69%
  • accelerando_4:6.59%
  • accelerando_5:3.04%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:225719
  • name:Accelerando
  • tooltip:Haste increased by $w1.
  • description:{$@spelldesc225125=Your damaging spells have a chance to grant you {$225719s1=528} Haste for {$225719d=12 seconds}, stacking up to 5 times. Stacking does not refresh duration.}
  • max_stacks:5
  • duration:12.00
  • cooldown:0.00
  • default_chance:101.00%
Berserking 2.1 0.0 180.6sec 180.6sec 6.86% 8.55% 0.0(0.0) 2.0

Buff details

  • buff initial source:Cloak
  • cooldown name:buff_berserking
  • max_stacks:1
  • duration:10.00
  • cooldown:180.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • berserking_1:6.86%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:26297
  • name:Berserking
  • tooltip:Haste increased by {$s1=15}%.
  • description:Increases your haste by {$s1=15}% for {$d=10 seconds}.
  • max_stacks:0
  • duration:10.00
  • cooldown:180.00
  • default_chance:0.00%
Bloodlust 1.0 0.0 0.0sec 0.0sec 13.55% 13.55% 0.0(0.0) 1.0

Buff details

  • buff initial source:Cloak
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • duration:40.00
  • cooldown:300.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • bloodlust_1:13.55%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:2825
  • name:Bloodlust
  • tooltip:Haste increased by {$s1=30}%.
  • description:Increases Haste by {$s1=30}% for all party and raid members for {$d=40 seconds}. Allies receiving this effect will become Sated and unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.
  • max_stacks:0
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
Conflagration of Chaos 24.2 0.0 12.3sec 12.3sec 49.17% 47.03% 0.0(0.0) 0.9

Buff details

  • buff initial source:Cloak
  • cooldown name:buff_conflagration_of_chaos
  • max_stacks:1
  • duration:20.00
  • cooldown:0.00
  • default_chance:50.00%
  • default_value:-0.00

Stack Uptimes

  • conflagration_of_chaos_1:49.17%

Trigger Attempt Success

  • trigger_pct:50.00%

Spelldata details

  • id:196546
  • name:Conflagration of Chaos
  • tooltip:Your {$?s17877=false}[Shadowburn][Conflagrate] will always critically strike. Critical strike chance will increase the critical strike damage of {$?s17877=false}[Shadowburn][Conflagrate].
  • description:{$@spelldesc219195={$?s17877=false}[Shadowburn][Conflagrate] has a chance to guarantee your next {$?s17877=false}[Shadowburn][Conflagrate] critically strikes, and to increase its damage by your critical strike chance.}
  • max_stacks:0
  • duration:20.00
  • cooldown:0.00
  • default_chance:100.00%
Devil's Due 3.5 0.0 70.0sec 70.0sec 8.67% 8.67% 0.0(0.0) 3.2

Buff details

  • buff initial source:Cloak
  • cooldown name:buff_devils_due
  • max_stacks:1
  • duration:8.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.18

Stack Uptimes

  • devils_due_1:8.67%

Trigger Attempt Success

  • trigger_pct:99.91%

Spelldata details

  • id:225776
  • name:Devil's Due
  • tooltip:Cast speed slowed by {$s1=7}%.
  • description:{$@spelldesc225142=Your damaging spells have a chance to grant Nefarious Pact, increasing your casting speed by {$225774s1=17}% for {$225774d=12 seconds}. When Nefarious Pact expires, your casting speed is decreased by {$225776s1=7}% for {$225776d=8 seconds}.}
  • max_stacks:0
  • duration:8.00
  • cooldown:0.00
  • default_chance:0.00%
Embrace Chaos 33.4 28.1 9.1sec 4.8sec 66.93% 79.72% 28.1(28.1) 32.8

Buff details

  • buff initial source:Cloak
  • cooldown name:buff_embrace_chaos
  • max_stacks:1
  • duration:4.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • embrace_chaos_1:66.93%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:212019
  • name:Embrace Chaos
  • tooltip:Chaos Bolt has {$s1=40}% reduced cast time.
  • description:{$@spelldesc212018=Casting Chaos Bolt reduces the cast time of your next Chaos Bolt by {$212019s1=40}% for {$212019d=4 seconds}.}
  • max_stacks:0
  • duration:4.00
  • cooldown:0.00
  • default_chance:0.00%
Lord of Flames 1.0 0.0 0.0sec 0.0sec 97.88% 97.88% 0.0(0.0) 0.0

Buff details

  • buff initial source:Cloak
  • cooldown name:buff_lord_of_flames
  • max_stacks:1
  • duration:600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • lord_of_flames_1:97.88%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:226802
  • name:Lord of Flames
  • tooltip:Recently activated Lord of Flames.
  • description:{$@spelldesc224103=Once every {$s2=10} minutes, {$?s152107=false}[your Infernal's Meteor Strike][Summon Infernal] will summon {$s3=3} additional Infernals to serve you for {$226804d=25 seconds}.}
  • max_stacks:0
  • duration:600.00
  • cooldown:0.00
  • default_chance:0.00%
Nefarious Pact 3.5 0.0 70.4sec 69.5sec 13.49% 13.49% 0.0(0.0) 3.3

Buff details

  • buff initial source:Cloak
  • cooldown name:buff_nefarious_pact
  • max_stacks:1
  • duration:12.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.44

Stack Uptimes

  • nefarious_pact_1:13.49%

Trigger Attempt Success

  • trigger_pct:99.91%

Spelldata details

  • id:225774
  • name:Nefarious Pact
  • tooltip:Cast speed increased by {$s1=17}%.
  • description:{$@spelldesc225142=Your damaging spells have a chance to grant Nefarious Pact, increasing your casting speed by {$225774s1=17}% for {$225774d=12 seconds}. When Nefarious Pact expires, your casting speed is decreased by {$225776s1=7}% for {$225776d=8 seconds}.}
  • max_stacks:0
  • duration:12.00
  • cooldown:0.00
  • default_chance:0.00%
Potion of Deadly Grace 1.0 0.0 0.0sec 0.0sec 10.16% 10.16% 0.0(0.0) 1.0

Buff details

  • buff initial source:Cloak
  • cooldown name:buff_potion_of_deadly_grace
  • max_stacks:1
  • duration:30.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • potion_of_deadly_grace_1:10.16%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:188027
  • name:Potion of Deadly Grace
  • tooltip:Your attacks have a chance to unleash a bolt of energy at your target.
  • description:Grants your attacks a chance to unleash a bolt of energy at your target. Staying away from enemies for the entire duration of the effect will extend the effect by an additional 5 seconds.
  • max_stacks:0
  • duration:25.00
  • cooldown:1.00
  • default_chance:101.00%
Potion of Prolonged Power 1.0 0.0 0.0sec 0.0sec 19.64% 19.64% 0.0(0.0) 1.0

Buff details

  • buff initial source:Cloak
  • cooldown name:buff_potion_of_prolonged_power
  • max_stacks:1
  • duration:60.00
  • cooldown:1.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:all
  • amount:2500.00

Stack Uptimes

  • potion_of_prolonged_power_1:19.64%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:229206
  • name:Potion of Prolonged Power
  • tooltip:All stats increased by {$s1=2500}.
  • description:Drink to increase all stats by {$s1=2500} for {$d=60 seconds}.
  • max_stacks:0
  • duration:60.00
  • cooldown:1.00
  • default_chance:0.00%
Soul Harvest 2.9 0.0 120.9sec 120.9sec 17.79% 17.79% 0.0(0.0) 2.7

Buff details

  • buff initial source:Cloak
  • cooldown name:buff_soul_harvest
  • max_stacks:1
  • duration:15.00
  • cooldown:120.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • soul_harvest_1:17.79%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:196098
  • name:Soul Harvest
  • tooltip:Damage increased by {$s1=20}%.
  • description:Increases your damage and your pets' damage by {$s1=20}%. Lasts {$d=15 seconds}, increased by {$s2=2} sec for each target afflicted by your {$?s137043=false}[Agony][]{$?s137044=false}[Doom][]{$?s137046=false}[Immolate][], up to a maximum of {$s3=35} sec.
  • max_stacks:0
  • duration:15.00
  • cooldown:120.00
  • default_chance:0.00%
Constant Buffs
Well Fed (azshari_salad)

Buff details

  • buff initial source:Cloak
  • cooldown name:buff_azshari_salad
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:haste_rating
  • amount:375.00

Stack Uptimes

  • azshari_salad_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:225603
  • name:Well Fed
  • tooltip:Haste increased by $w1.
  • description:Increases haste by {$s1=375} for {$d=3600 seconds}.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Defiled Augmentation

Buff details

  • buff initial source:Cloak
  • cooldown name:buff_defiled_augmentation
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:agility
  • amount:325.00
  • stat:strength
  • amount:325.00
  • stat:intellect
  • amount:325.00

Stack Uptimes

  • defiled_augmentation_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:224001
  • name:Defiled Augmentation
  • tooltip:Agility, Intellect and Strength increased by $w1.
  • description:Increases Agility, Intellect and Strength by {$s1=325} for {$d=3600 seconds}. Augment Rune.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Flask of the Whispered Pact

Buff details

  • buff initial source:Cloak
  • cooldown name:buff_flask_of_the_whispered_pact
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:intellect
  • amount:1300.00

Stack Uptimes

  • flask_of_the_whispered_pact_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:188031
  • name:Flask of the Whispered Pact
  • tooltip:Intellect increased by $w1.
  • description:Increases Intellect by {$s1=1300} for {$d=3600 seconds}. Counts as both a Battle and Guardian elixir. This effect persists through death.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:101.00%
Tormented Souls

Buff details

  • buff initial source:Cloak
  • cooldown name:buff_tormented_souls
  • max_stacks:12
  • duration:0.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00

Stack Uptimes

  • tormented_souls_2:0.37%
  • tormented_souls_3:99.63%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:216695
  • name:Tormented Souls
  • tooltip:Activate Reap Souls to consume all Tormented Souls collected by |cFFFFCC99Ulthalesh|r, increasing your damage by 10% and doubling the effect of all of |cFFFFCC99Ulthalesh|r's other traits for {$216708d=5 seconds} per soul consumed.
  • description:Activate Reap Souls to consume all Tormented Souls collected by |cFFFFCC99Ulthalesh|r, increasing your damage by 10% and doubling the effect of all of |cFFFFCC99Ulthalesh|r's other traits for {$216708d=5 seconds} per soul consumed.
  • max_stacks:12
  • duration:-0.00
  • cooldown:0.00
  • default_chance:101.00%

Procs

Count Interval
shadowy_tear 3.2 70.0sec
flame_rift 3.2 71.6sec
chaos_tear 3.3 70.4sec
chaos_portal 3.2 70.2sec
dimension_ripper 3.8 56.4sec
t19_2pc_chaos_bolt 42.9 6.8sec

Resources

Resource Usage Type Count Total Average RPE APR
Cloak
chaos_bolt Soul Shard 61.6 123.2 2.0 2.0 952891.1
havoc Mana 14.9 1310226.1 88000.0 88000.3 0.0
immolate Mana 20.0 1318080.0 66000.0 65999.0 68.8
incinerate Mana 75.4 4976814.4 66000.0 65999.6 8.8
service_imp Soul Shard 3.7 3.7 1.0 1.0 0.0
summon_doomguard Soul Shard 1.0 1.0 1.0 1.0 0.0
summon_infernal Soul Shard 1.0 1.0 1.0 1.0 0.0
pet - imp
firebolt Energy 108.6 4343.2 40.0 40.0 3373.4
pet - service_imp
firebolt Energy 49.2 1968.4 40.0 40.0 6895.9
pet - doomguard
doom_bolt Energy 10.9 382.0 35.0 35.0 7172.4
pet - flame_rift
searing_bolt Energy 62.8 62.8 1.0 1.0 373010.1
Resource Gains Type Count Total Average Overflow
life_tap Mana 6.64 2192654.20 (32.55%) 330000.00 0.00 0.00%
immolate Soul Shard 71.83 70.74 (55.21%) 0.98 1.08 1.51%
conflagrate Soul Shard 48.29 48.19 (37.61%) 1.00 0.10 0.21%
mp5_regen Mana 519.47 4544616.97 (67.45%) 8748.64 75278.97 1.63%
soulsnatcher Soul Shard 9.21 9.21 (7.19%) 1.00 0.00 0.00%
pet - imp
energy_regen Energy 1899.91 4176.80 (100.00%) 2.20 21.58 0.51%
pet - service_imp
energy_regen Energy 443.84 1346.56 (100.00%) 3.03 61.92 4.40%
pet - doomguard
energy_regen Energy 15.63 341.23 (100.00%) 21.83 42.84 11.15%
Resource RPS-Gain RPS-Loss
Health 0.00 7231.34
Mana 22382.45 25265.62
Soul Shard 0.43 0.43
Combat End Resource Mean Min Max
Mana 233059.46 5168.47 504905.14
Soul Shard 2.29 0.00 5.00

Benefits & Uptimes

Benefits %
Uptimes %
Mana Cap 1.1%

Statistics & Data Analysis

Fight Length
Sample Data Cloak Fight Length
Count 9999
Mean 301.01
Minimum 217.68
Maximum 385.07
Spread ( max - min ) 167.39
Range [ ( max - min ) / 2 * 100% ] 27.80%
DPS
Sample Data Cloak Damage Per Second
Count 9999
Mean 1323962.00
Minimum 1136528.24
Maximum 1578073.43
Spread ( max - min ) 441545.19
Range [ ( max - min ) / 2 * 100% ] 16.68%
Standard Deviation 56503.8866
5th Percentile 1235196.99
95th Percentile 1420781.26
( 95th Percentile - 5th Percentile ) 185584.27
Mean Distribution
Standard Deviation 565.0671
95.00% Confidence Intervall ( 1322854.49 - 1325069.51 )
Normalized 95.00% Confidence Intervall ( 99.92% - 100.08% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 70
0.1% Error 6997
0.1 Scale Factor Error with Delta=300 27254632
0.05 Scale Factor Error with Delta=300 109018526
0.01 Scale Factor Error with Delta=300 2725463133
Priority Target DPS
Sample Data Cloak Priority Target Damage Per Second
Count 9999
Mean 792798.61
Minimum 665361.47
Maximum 1000167.94
Spread ( max - min ) 334806.47
Range [ ( max - min ) / 2 * 100% ] 21.12%
Standard Deviation 43565.6737
5th Percentile 725833.62
95th Percentile 869001.87
( 95th Percentile - 5th Percentile ) 143168.25
Mean Distribution
Standard Deviation 435.6785
95.00% Confidence Intervall ( 791944.70 - 793652.53 )
Normalized 95.00% Confidence Intervall ( 99.89% - 100.11% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 117
0.1% Error 11601
0.1 Scale Factor Error with Delta=300 16202146
0.05 Scale Factor Error with Delta=300 64808584
0.01 Scale Factor Error with Delta=300 1620214588
DPS(e)
Sample Data Cloak Damage Per Second (Effective)
Count 9999
Mean 1323962.00
Minimum 1136528.24
Maximum 1578073.43
Spread ( max - min ) 441545.19
Range [ ( max - min ) / 2 * 100% ] 16.68%
Damage
Sample Data Cloak Damage
Count 9999
Mean 317866667.70
Minimum 220210182.59
Maximum 422941133.33
Spread ( max - min ) 202730950.74
Range [ ( max - min ) / 2 * 100% ] 31.89%
DTPS
Sample Data Cloak Damage Taken Per Second
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HPS
Sample Data Cloak Healing Per Second
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
HPS(e)
Sample Data Cloak Healing Per Second (Effective)
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
Sample Data Cloak Heal
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
Sample Data Cloak Healing Taken Per Second
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
TMI
Sample Data Cloak Theck-Meloree Index
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
ETMI
Sample Data CloakTheck-Meloree Index (Effective)
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
MSD
Sample Data Cloak Max Spike Value
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 flask,type=whispered_pact
1 0.00 food,type=azshari_salad
2 0.00 summon_pet,if=!talent.grimoire_of_supremacy.enabled&(!talent.grimoire_of_sacrifice.enabled|buff.demonic_power.down)
3 0.00 summon_infernal,if=talent.grimoire_of_supremacy.enabled&artifact.lord_of_flames.rank>0
4 0.00 summon_infernal,if=talent.grimoire_of_supremacy.enabled&active_enemies>1
5 0.00 summon_doomguard,if=talent.grimoire_of_supremacy.enabled&active_enemies=1&artifact.lord_of_flames.rank=0
6 0.00 augmentation,type=defiled
7 0.00 snapshot_stats
8 0.00 grimoire_of_sacrifice,if=talent.grimoire_of_sacrifice.enabled
9 0.00 life_tap,if=talent.empowered_life_tap.enabled&!buff.empowered_life_tap.remains
A 0.00 potion,name=prolonged_power
B 0.00 chaos_bolt
Default action list Executed every time the actor is available.
# count action,conditions
C 14.88 havoc,target=2,if=active_enemies>1&(active_enemies<4|talent.wreak_havoc.enabled&active_enemies<6)&!debuff.havoc.remains
D 1.00 dimensional_rift,if=charges=3
E 10.33 immolate,if=remains<=tick_time
F 0.65 immolate,cycle_targets=1,if=active_enemies>1&remains<=tick_time&(!talent.roaring_blaze.enabled|(!debuff.roaring_blaze.remains&action.conflagrate.charges<2+set_bonus.tier19_4pc))
G 9.03 immolate,if=talent.roaring_blaze.enabled&remains<=duration&!debuff.roaring_blaze.remains&target.time_to_die>10&(action.conflagrate.charges=2+set_bonus.tier19_4pc|(action.conflagrate.charges>=1+set_bonus.tier19_4pc&action.conflagrate.recharge_time<cast_time+gcd)|target.time_to_die<24)
H 2.06 berserking
0.00 blood_fury
0.00 arcane_torrent
I 1.00 potion,name=deadly_grace,if=(buff.soul_harvest.remains|trinket.proc.any.react|target.time_to_die<=45)
0.00 shadowburn,if=buff.conflagration_of_chaos.remains<=action.chaos_bolt.cast_time
0.00 shadowburn,if=(charges=1+set_bonus.tier19_4pc&recharge_time<action.chaos_bolt.cast_time|charges=2+set_bonus.tier19_4pc)&soul_shard<5
J 13.98 conflagrate,if=talent.roaring_blaze.enabled&(charges=2+set_bonus.tier19_4pc|(charges>=1+set_bonus.tier19_4pc&recharge_time<gcd)|target.time_to_die<24)
K 34.32 conflagrate,if=talent.roaring_blaze.enabled&debuff.roaring_blaze.stack>0&dot.immolate.remains>dot.immolate.duration*0.3&(active_enemies=1|soul_shard<3)&soul_shard<5
0.00 conflagrate,if=!talent.roaring_blaze.enabled&buff.backdraft.stack<3&buff.conflagration_of_chaos.remains<=action.chaos_bolt.cast_time
0.00 conflagrate,if=!talent.roaring_blaze.enabled&buff.backdraft.stack<3&(charges=1+set_bonus.tier19_4pc&recharge_time<action.chaos_bolt.cast_time|charges=2+set_bonus.tier19_4pc)&soul_shard<5
0.00 life_tap,if=talent.empowered_life_tap.enabled&buff.empowered_life_tap.remains<=gcd
0.00 dimensional_rift,if=equipped.144369&!buff.lessons_of_spacetime.remains&((!talent.grimoire_of_supremacy.enabled&!cooldown.summon_doomguard.remains)|(talent.grimoire_of_service.enabled&!cooldown.service_pet.remains)|(talent.soul_harvest.enabled&!cooldown.soul_harvest.remains))
L 3.69 service_pet
M 1.00 summon_infernal,if=artifact.lord_of_flames.rank>0&!buff.lord_of_flames.remains
N 1.00 summon_doomguard,if=!talent.grimoire_of_supremacy.enabled&spell_targets.infernal_awakening<=2&(target.time_to_die>180|target.health.pct<=20|target.time_to_die<30)
0.00 summon_infernal,if=!talent.grimoire_of_supremacy.enabled&spell_targets.infernal_awakening>2
0.00 summon_doomguard,if=talent.grimoire_of_supremacy.enabled&spell_targets.summon_infernal=1&artifact.lord_of_flames.rank>0&buff.lord_of_flames.remains&!pet.doomguard.active
0.00 summon_doomguard,if=talent.grimoire_of_supremacy.enabled&spell_targets.summon_infernal=1&equipped.132379&!cooldown.sindorei_spite_icd.remains
0.00 summon_infernal,if=talent.grimoire_of_supremacy.enabled&spell_targets.summon_infernal>1&equipped.132379&!cooldown.sindorei_spite_icd.remains
O 2.90 soul_harvest
0.00 channel_demonfire,if=dot.immolate.remains>cast_time
P 0.01 havoc,if=active_enemies=1&talent.wreak_havoc.enabled&equipped.132375&!debuff.havoc.remains
0.00 rain_of_fire,if=active_enemies>=3&cooldown.havoc.remains<=12&!talent.wreak_havoc.enabled
0.00 rain_of_fire,if=active_enemies>=6&talent.wreak_havoc.enabled
Q 11.90 dimensional_rift,if=!equipped.144369|charges>1|((!talent.grimoire_of_service.enabled|recharge_time<cooldown.service_pet.remains)&(!talent.soul_harvest.enabled|recharge_time<cooldown.soul_harvest.remains)&(!talent.grimoire_of_supremacy.enabled|recharge_time<cooldown.summon_doomguard.remains))
0.00 life_tap,if=talent.empowered_life_tap.enabled&buff.empowered_life_tap.remains<duration*0.3
0.00 cataclysm
R 60.90 chaos_bolt,if=(cooldown.havoc.remains>12&cooldown.havoc.remains|active_enemies<3|talent.wreak_havoc.enabled&active_enemies<6)&(set_bonus.tier19_4pc=0|!talent.eradication.enabled|buff.embrace_chaos.remains<=cast_time|soul_shard>=3)
0.00 shadowburn
0.00 conflagrate,if=!talent.roaring_blaze.enabled&buff.backdraft.stack<3
0.00 immolate,if=!talent.roaring_blaze.enabled&remains<=duration*0.3
S 75.74 incinerate
T 6.64 life_tap

Sample Sequence

0126ABCDEGHJKLKMOQQRKRRKSSRSKRCSSSSSEQSSSRGJKKRRSKCRSSKQRSSSSESSRCSGJRKKRKRSSRKSQCRTERSQSRSSGJKLKCRKRSSRKRSSRSETCSSOIRSGJKRKQRKSRCSKRRSRSESRTSSQRSSSCGJRRKRKRKRSSQKQHRSCTSERSLSRGJRKKRCKRRSSKRSSSERSQCNTSGJRRKKRKRRSSCKORRSSSRSERSTSSSGJCRJJQJRRSJRLSSJCERRJ

Sample Sequence Table

time list # name target resources buffs
Pre precombat 0 flask Cloak 1100000.0/1100000: 100% mana | 3.0/5: 60% soul_shard
Pre precombat 1 food Cloak 1100000.0/1100000: 100% mana | 3.0/5: 60% soul_shard
Pre precombat 2 summon_imp Fluffy_Pillow 1100000.0/1100000: 100% mana | 3.0/5: 60% soul_shard
Pre precombat 6 augmentation Cloak 1100000.0/1100000: 100% mana | 3.0/5: 60% soul_shard
Pre precombat A potion Fluffy_Pillow 1100000.0/1100000: 100% mana | 3.0/5: 60% soul_shard potion_of_prolonged_power
0:00.000 precombat B chaos_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 1.0/5: 20% soul_shard embrace_chaos, accelerando, potion_of_prolonged_power
0:00.000 default C havoc enemy2 1100000.0/1100000: 100% mana | 1.0/5: 20% soul_shard embrace_chaos, accelerando, potion_of_prolonged_power
0:01.146 default D dimensional_rift Fluffy_Pillow 1033527.5/1100000: 94% mana | 1.0/5: 20% soul_shard bloodlust, embrace_chaos, accelerando, potion_of_prolonged_power
0:02.028 default E immolate Fluffy_Pillow 1050095.7/1100000: 95% mana | 1.0/5: 20% soul_shard bloodlust, embrace_chaos, accelerando, potion_of_prolonged_power
0:02.911 default G immolate Fluffy_Pillow 1000684.1/1100000: 91% mana | 1.0/5: 20% soul_shard bloodlust, embrace_chaos, accelerando(2), potion_of_prolonged_power
0:03.779 default H berserking Fluffy_Pillow 951232.7/1100000: 86% mana | 1.0/5: 20% soul_shard bloodlust, embrace_chaos, accelerando(2), potion_of_prolonged_power
0:03.779 default J conflagrate Fluffy_Pillow 951232.7/1100000: 86% mana | 1.0/5: 20% soul_shard bloodlust, berserking, embrace_chaos, accelerando(2), potion_of_prolonged_power
0:04.535 default K conflagrate Fluffy_Pillow 967807.9/1100000: 88% mana | 2.0/5: 40% soul_shard bloodlust, berserking, conflagration_of_chaos, accelerando(2), potion_of_prolonged_power
0:05.293 default L service_imp Fluffy_Pillow 984427.0/1100000: 89% mana | 3.0/5: 60% soul_shard bloodlust, berserking, accelerando(2), potion_of_prolonged_power
0:06.049 default K conflagrate Fluffy_Pillow 1001002.2/1100000: 91% mana | 2.0/5: 40% soul_shard bloodlust, berserking, accelerando(2), potion_of_prolonged_power
0:06.806 default M summon_infernal Fluffy_Pillow 1017599.4/1100000: 93% mana | 4.0/5: 80% soul_shard bloodlust, berserking, conflagration_of_chaos, accelerando(2), potion_of_prolonged_power
0:07.563 default O soul_harvest Fluffy_Pillow 1034196.5/1100000: 94% mana | 3.0/5: 60% soul_shard bloodlust, berserking, lord_of_flames, conflagration_of_chaos, accelerando(2), potion_of_prolonged_power
0:07.563 default Q dimensional_rift Fluffy_Pillow 1034196.5/1100000: 94% mana | 3.0/5: 60% soul_shard bloodlust, berserking, soul_harvest, lord_of_flames, conflagration_of_chaos, accelerando(2), potion_of_prolonged_power
0:08.320 default Q dimensional_rift Fluffy_Pillow 1051037.4/1100000: 96% mana | 4.0/5: 80% soul_shard bloodlust, berserking, soul_harvest, lord_of_flames, conflagration_of_chaos, accelerando(3), potion_of_prolonged_power
0:09.075 default R chaos_bolt Fluffy_Pillow 1067833.7/1100000: 97% mana | 4.0/5: 80% soul_shard bloodlust, berserking, soul_harvest, lord_of_flames, conflagration_of_chaos, accelerando(3), potion_of_prolonged_power
0:10.562 default K conflagrate Fluffy_Pillow 1100000.0/1100000: 100% mana | 2.0/5: 40% soul_shard bloodlust, berserking, soul_harvest, lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(3), potion_of_prolonged_power
0:11.318 default R chaos_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 4.0/5: 80% soul_shard bloodlust, berserking, soul_harvest, lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(3), potion_of_prolonged_power
0:12.212 default R chaos_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 3.0/5: 60% soul_shard bloodlust, berserking, soul_harvest, lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando, potion_of_prolonged_power
0:13.131 default K conflagrate Fluffy_Pillow 1100000.0/1100000: 100% mana | 1.0/5: 20% soul_shard bloodlust, berserking, soul_harvest, lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando, potion_of_prolonged_power
0:13.897 default S incinerate Fluffy_Pillow 1100000.0/1100000: 100% mana | 2.0/5: 40% soul_shard bloodlust, soul_harvest, lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando, potion_of_prolonged_power
0:15.003 default S incinerate Fluffy_Pillow 1034112.7/1100000: 94% mana | 2.0/5: 40% soul_shard bloodlust, soul_harvest, lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando, potion_of_prolonged_power
0:16.109 default R chaos_bolt Fluffy_Pillow 989150.5/1100000: 90% mana | 4.0/5: 80% soul_shard bloodlust, soul_harvest, lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(2), potion_of_prolonged_power
0:17.150 default S incinerate Fluffy_Pillow 1008997.4/1100000: 92% mana | 2.0/5: 40% soul_shard bloodlust, soul_harvest, lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(2), potion_of_prolonged_power
0:18.239 default K conflagrate Fluffy_Pillow 963759.3/1100000: 88% mana | 2.0/5: 40% soul_shard bloodlust, soul_harvest, lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(2), potion_of_prolonged_power
0:19.108 default R chaos_bolt Fluffy_Pillow 980326.9/1100000: 89% mana | 3.0/5: 60% soul_shard bloodlust, soul_harvest, lord_of_flames, embrace_chaos, accelerando(2), potion_of_prolonged_power
0:20.151 default C havoc enemy2 1000211.8/1100000: 91% mana | 1.0/5: 20% soul_shard bloodlust, soul_harvest, lord_of_flames, embrace_chaos, accelerando(2), potion_of_prolonged_power
0:21.019 default S incinerate Fluffy_Pillow 928760.4/1100000: 84% mana | 1.0/5: 20% soul_shard bloodlust, soul_harvest, lord_of_flames, embrace_chaos, accelerando(2), potion_of_prolonged_power
0:22.108 default S incinerate Fluffy_Pillow 883522.3/1100000: 80% mana | 1.0/5: 20% soul_shard bloodlust, soul_harvest, lord_of_flames, embrace_chaos, accelerando(2), potion_of_prolonged_power
0:23.197 default S incinerate Fluffy_Pillow 838284.3/1100000: 76% mana | 1.0/5: 20% soul_shard bloodlust, soul_harvest, lord_of_flames, embrace_chaos, accelerando(2), potion_of_prolonged_power
0:24.285 default S incinerate Fluffy_Pillow 792935.3/1100000: 72% mana | 1.0/5: 20% soul_shard bloodlust, soul_harvest, lord_of_flames, potion_of_prolonged_power
0:25.406 default S incinerate Fluffy_Pillow 747680.5/1100000: 68% mana | 1.0/5: 20% soul_shard bloodlust, soul_harvest, lord_of_flames, accelerando, potion_of_prolonged_power
0:26.510 default E immolate Fluffy_Pillow 702418.9/1100000: 64% mana | 1.0/5: 20% soul_shard bloodlust, soul_harvest, lord_of_flames, accelerando, potion_of_prolonged_power
0:27.390 default Q dimensional_rift Fluffy_Pillow 652949.6/1100000: 59% mana | 1.0/5: 20% soul_shard bloodlust, lord_of_flames, accelerando, potion_of_prolonged_power
0:28.272 default S incinerate Fluffy_Pillow 669517.9/1100000: 61% mana | 1.0/5: 20% soul_shard bloodlust, lord_of_flames, accelerando, potion_of_prolonged_power
0:29.378 default S incinerate Fluffy_Pillow 624293.9/1100000: 57% mana | 1.0/5: 20% soul_shard bloodlust, lord_of_flames, accelerando, potion_of_prolonged_power
0:30.482 default S incinerate Fluffy_Pillow 579032.4/1100000: 53% mana | 1.0/5: 20% soul_shard bloodlust, lord_of_flames, accelerando, potion_of_prolonged_power
0:31.587 default R chaos_bolt Fluffy_Pillow 533789.7/1100000: 49% mana | 2.0/5: 40% soul_shard bloodlust, lord_of_flames, accelerando, potion_of_prolonged_power
0:33.346 default G immolate Fluffy_Pillow 566832.3/1100000: 52% mana | 0.0/5: 0% soul_shard bloodlust, lord_of_flames, embrace_chaos, accelerando, potion_of_prolonged_power
0:34.229 default J conflagrate Fluffy_Pillow 517419.3/1100000: 47% mana | 0.0/5: 0% soul_shard bloodlust, lord_of_flames, embrace_chaos, accelerando, potion_of_prolonged_power
0:35.112 default K conflagrate Fluffy_Pillow 534006.3/1100000: 49% mana | 1.0/5: 20% soul_shard bloodlust, lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando, potion_of_prolonged_power
0:35.994 default K conflagrate Fluffy_Pillow 550864.0/1100000: 50% mana | 2.0/5: 40% soul_shard bloodlust, lord_of_flames, embrace_chaos, accelerando(3), potion_of_prolonged_power
0:36.849 default R chaos_bolt Fluffy_Pillow 567404.0/1100000: 52% mana | 5.0/5: 100% soul_shard bloodlust, lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(3), potion_of_prolonged_power
0:37.878 default R chaos_bolt Fluffy_Pillow 586910.2/1100000: 53% mana | 4.0/5: 80% soul_shard bloodlust, lord_of_flames, conflagration_of_chaos, embrace_chaos, potion_of_prolonged_power
0:38.952 default S incinerate Fluffy_Pillow 606784.5/1100000: 55% mana | 2.0/5: 40% soul_shard bloodlust, lord_of_flames, conflagration_of_chaos, embrace_chaos, potion_of_prolonged_power
0:40.075 default K conflagrate Fluffy_Pillow 561565.6/1100000: 51% mana | 2.0/5: 40% soul_shard bloodlust, lord_of_flames, conflagration_of_chaos, embrace_chaos, potion_of_prolonged_power
0:40.971 default C havoc enemy2 578146.1/1100000: 53% mana | 3.0/5: 60% soul_shard bloodlust, lord_of_flames, embrace_chaos, potion_of_prolonged_power
0:41.868 default R chaos_bolt Fluffy_Pillow 502914.5/1100000: 46% mana | 3.0/5: 60% soul_shard lord_of_flames, embrace_chaos, potion_of_prolonged_power
0:43.262 default S incinerate Fluffy_Pillow 522758.4/1100000: 48% mana | 1.0/5: 20% soul_shard lord_of_flames, embrace_chaos, accelerando, potion_of_prolonged_power
0:44.698 default S incinerate Fluffy_Pillow 477508.4/1100000: 43% mana | 1.0/5: 20% soul_shard lord_of_flames, embrace_chaos, accelerando, potion_of_prolonged_power
0:46.132 default K conflagrate Fluffy_Pillow 432229.6/1100000: 39% mana | 1.0/5: 20% soul_shard lord_of_flames, embrace_chaos, accelerando, potion_of_prolonged_power
0:47.279 default Q dimensional_rift Fluffy_Pillow 448803.6/1100000: 41% mana | 2.0/5: 40% soul_shard lord_of_flames, accelerando, potion_of_prolonged_power
0:48.423 default R chaos_bolt Fluffy_Pillow 465580.9/1100000: 42% mana | 2.0/5: 40% soul_shard lord_of_flames, accelerando(2), potion_of_prolonged_power
0:50.676 default S incinerate Fluffy_Pillow 498622.3/1100000: 45% mana | 1.0/5: 20% soul_shard lord_of_flames, embrace_chaos, accelerando(2), potion_of_prolonged_power
0:52.091 default S incinerate Fluffy_Pillow 453373.9/1100000: 41% mana | 1.0/5: 20% soul_shard lord_of_flames, embrace_chaos, accelerando(2), potion_of_prolonged_power
0:53.506 default S incinerate Fluffy_Pillow 408125.6/1100000: 37% mana | 1.0/5: 20% soul_shard lord_of_flames, embrace_chaos, accelerando(2), potion_of_prolonged_power
0:54.922 default S incinerate Fluffy_Pillow 362893.2/1100000: 33% mana | 1.0/5: 20% soul_shard lord_of_flames, accelerando(3), potion_of_prolonged_power
0:56.316 default E immolate Fluffy_Pillow 316954.5/1100000: 29% mana | 1.0/5: 20% soul_shard lord_of_flames, accelerando, potion_of_prolonged_power
0:57.460 default S incinerate Fluffy_Pillow 267485.1/1100000: 24% mana | 1.0/5: 20% soul_shard lord_of_flames, accelerando, potion_of_prolonged_power
0:58.896 default S incinerate Fluffy_Pillow 222235.2/1100000: 20% mana | 1.0/5: 20% soul_shard lord_of_flames, accelerando
1:00.331 default R chaos_bolt Fluffy_Pillow 176970.8/1100000: 16% mana | 2.0/5: 40% soul_shard lord_of_flames, accelerando
1:02.620 default C havoc enemy2 210046.6/1100000: 19% mana | 1.0/5: 20% soul_shard lord_of_flames, embrace_chaos, accelerando
1:03.764 default S incinerate Fluffy_Pillow 138577.3/1100000: 13% mana | 1.0/5: 20% soul_shard lord_of_flames, embrace_chaos, accelerando
1:05.200 default G immolate Fluffy_Pillow 93484.1/1100000: 8% mana | 2.0/5: 40% soul_shard lord_of_flames, embrace_chaos, accelerando(2)
1:06.330 default J conflagrate Fluffy_Pillow 44056.1/1100000: 4% mana | 2.0/5: 40% soul_shard lord_of_flames, embrace_chaos, accelerando(2)
1:07.459 default R chaos_bolt Fluffy_Pillow 60613.4/1100000: 6% mana | 3.0/5: 60% soul_shard lord_of_flames, accelerando(2)
1:09.714 default K conflagrate Fluffy_Pillow 93239.1/1100000: 8% mana | 1.0/5: 20% soul_shard lord_of_flames, embrace_chaos, accelerando
1:10.859 default K conflagrate Fluffy_Pillow 109784.2/1100000: 10% mana | 2.0/5: 40% soul_shard lord_of_flames, embrace_chaos, accelerando
1:12.006 default R chaos_bolt Fluffy_Pillow 126605.5/1100000: 12% mana | 3.0/5: 60% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(2)
1:13.359 default K conflagrate Fluffy_Pillow 146448.6/1100000: 13% mana | 1.0/5: 20% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(3)
1:14.471 default R chaos_bolt Fluffy_Pillow 162996.0/1100000: 15% mana | 4.0/5: 80% soul_shard lord_of_flames, embrace_chaos, accelerando(3)
1:15.806 default S incinerate Fluffy_Pillow 182861.9/1100000: 17% mana | 2.0/5: 40% soul_shard lord_of_flames, embrace_chaos, accelerando(3)
1:17.199 default S incinerate Fluffy_Pillow 137590.9/1100000: 13% mana | 2.0/5: 40% soul_shard lord_of_flames, embrace_chaos, accelerando(3)
1:18.594 default R chaos_bolt Fluffy_Pillow 92349.6/1100000: 8% mana | 2.0/5: 40% soul_shard lord_of_flames, embrace_chaos, accelerando(3)
1:19.930 default K conflagrate Fluffy_Pillow 112230.3/1100000: 10% mana | 0.0/5: 0% soul_shard lord_of_flames, embrace_chaos, accelerando(3)
1:21.043 default S incinerate Fluffy_Pillow 128747.4/1100000: 12% mana | 1.0/5: 20% soul_shard lord_of_flames, embrace_chaos
1:22.499 default Q dimensional_rift Fluffy_Pillow 83492.8/1100000: 8% mana | 2.0/5: 40% soul_shard lord_of_flames, embrace_chaos, accelerando
1:23.645 default C havoc enemy2 100052.4/1100000: 9% mana | 2.0/5: 40% soul_shard lord_of_flames, embrace_chaos, accelerando
1:24.790 default R chaos_bolt Fluffy_Pillow 28618.6/1100000: 3% mana | 2.0/5: 40% soul_shard lord_of_flames, accelerando(2)
1:27.046 default T life_tap Fluffy_Pillow 61704.0/1100000: 6% mana | 2.0/5: 40% soul_shard lord_of_flames, embrace_chaos, accelerando(2)
1:28.176 default E immolate Fluffy_Pillow 408276.0/1100000: 37% mana | 2.0/5: 40% soul_shard lord_of_flames, embrace_chaos, accelerando(2)
1:29.306 default R chaos_bolt Fluffy_Pillow 358865.4/1100000: 33% mana | 3.0/5: 60% soul_shard lord_of_flames, embrace_chaos, accelerando(3)
1:30.642 default S incinerate Fluffy_Pillow 378746.2/1100000: 34% mana | 2.0/5: 40% soul_shard lord_of_flames, embrace_chaos, accelerando(3)
1:32.035 default Q dimensional_rift Fluffy_Pillow 333475.1/1100000: 30% mana | 2.0/5: 40% soul_shard lord_of_flames, embrace_chaos, accelerando(3)
1:33.148 default S incinerate Fluffy_Pillow 350037.5/1100000: 32% mana | 2.0/5: 40% soul_shard lord_of_flames, embrace_chaos, accelerando(3)
1:34.541 default R chaos_bolt Fluffy_Pillow 304679.8/1100000: 28% mana | 2.0/5: 40% soul_shard lord_of_flames, embrace_chaos
1:35.935 default S incinerate Fluffy_Pillow 324522.8/1100000: 30% mana | 0.0/5: 0% soul_shard lord_of_flames, embrace_chaos
1:37.391 default S incinerate Fluffy_Pillow 279248.4/1100000: 25% mana | 0.0/5: 0% soul_shard lord_of_flames, embrace_chaos
1:38.847 default G immolate Fluffy_Pillow 233973.9/1100000: 21% mana | 0.0/5: 0% soul_shard lord_of_flames, embrace_chaos
1:40.011 default J conflagrate Fluffy_Pillow 184544.1/1100000: 17% mana | 0.0/5: 0% soul_shard lord_of_flames, accelerando
1:41.156 default K conflagrate Fluffy_Pillow 201120.3/1100000: 18% mana | 2.0/5: 40% soul_shard lord_of_flames, accelerando(2)
1:42.284 default L service_imp Fluffy_Pillow 217662.9/1100000: 20% mana | 3.0/5: 60% soul_shard lord_of_flames, accelerando(2)
1:43.413 default K conflagrate Fluffy_Pillow 234220.3/1100000: 21% mana | 2.0/5: 40% soul_shard lord_of_flames, accelerando(2)
1:44.542 default C havoc enemy2 250777.6/1100000: 23% mana | 3.0/5: 60% soul_shard lord_of_flames, accelerando(2)
1:45.670 default R chaos_bolt Fluffy_Pillow 179354.3/1100000: 16% mana | 3.0/5: 60% soul_shard lord_of_flames, accelerando(3)
1:47.892 default K conflagrate Fluffy_Pillow 212447.5/1100000: 19% mana | 2.0/5: 40% soul_shard lord_of_flames, embrace_chaos, accelerando(4)
1:48.988 default R chaos_bolt Fluffy_Pillow 228993.1/1100000: 21% mana | 3.0/5: 60% soul_shard lord_of_flames, embrace_chaos, accelerando(4)
1:50.304 default S incinerate Fluffy_Pillow 248860.0/1100000: 23% mana | 1.0/5: 20% soul_shard lord_of_flames, embrace_chaos, accelerando(4)
1:51.678 default S incinerate Fluffy_Pillow 203602.4/1100000: 19% mana | 1.0/5: 20% soul_shard lord_of_flames, embrace_chaos, accelerando(4)
1:53.052 default R chaos_bolt Fluffy_Pillow 157443.4/1100000: 14% mana | 2.0/5: 40% soul_shard lord_of_flames, embrace_chaos
1:54.446 default K conflagrate Fluffy_Pillow 177287.3/1100000: 16% mana | 1.0/5: 20% soul_shard lord_of_flames, embrace_chaos, accelerando
1:55.590 default R chaos_bolt Fluffy_Pillow 193818.0/1100000: 18% mana | 3.0/5: 60% soul_shard lord_of_flames, embrace_chaos, accelerando
1:56.964 default S incinerate Fluffy_Pillow 213722.0/1100000: 19% mana | 2.0/5: 40% soul_shard lord_of_flames, embrace_chaos, accelerando(2)
1:58.379 default S incinerate Fluffy_Pillow 168474.7/1100000: 15% mana | 2.0/5: 40% soul_shard lord_of_flames, embrace_chaos, accelerando(3)
1:59.772 default R chaos_bolt Fluffy_Pillow 123203.7/1100000: 11% mana | 2.0/5: 40% soul_shard lord_of_flames, embrace_chaos, accelerando(3)
2:01.108 default S incinerate Fluffy_Pillow 143084.4/1100000: 13% mana | 0.0/5: 0% soul_shard lord_of_flames, embrace_chaos, accelerando(3)
2:02.502 default E immolate Fluffy_Pillow 97828.2/1100000: 9% mana | 1.0/5: 20% soul_shard lord_of_flames, embrace_chaos, accelerando(3)
2:03.616 default T life_tap Fluffy_Pillow 48405.5/1100000: 4% mana | 1.0/5: 20% soul_shard lord_of_flames, embrace_chaos, accelerando(3)
2:04.729 default C havoc enemy2 394967.8/1100000: 36% mana | 1.0/5: 20% soul_shard lord_of_flames, embrace_chaos, accelerando(3)
2:05.842 default S incinerate Fluffy_Pillow 323530.1/1100000: 29% mana | 1.0/5: 20% soul_shard lord_of_flames, accelerando(3)
2:07.233 default S incinerate Fluffy_Pillow 277718.2/1100000: 25% mana | 1.0/5: 20% soul_shard lord_of_flames
2:08.690 default O soul_harvest Fluffy_Pillow 232459.0/1100000: 21% mana | 2.0/5: 40% soul_shard lord_of_flames, accelerando
2:08.690 default I potion Fluffy_Pillow 232459.0/1100000: 21% mana | 2.0/5: 40% soul_shard soul_harvest, lord_of_flames, accelerando
2:08.690 default R chaos_bolt Fluffy_Pillow 232459.0/1100000: 21% mana | 2.0/5: 40% soul_shard soul_harvest, lord_of_flames, accelerando, potion_of_deadly_grace
2:10.979 default S incinerate Fluffy_Pillow 265534.8/1100000: 24% mana | 1.0/5: 20% soul_shard soul_harvest, lord_of_flames, embrace_chaos, accelerando, potion_of_deadly_grace
2:12.415 default G immolate Fluffy_Pillow 220286.0/1100000: 20% mana | 1.0/5: 20% soul_shard soul_harvest, lord_of_flames, embrace_chaos, accelerando(2), potion_of_deadly_grace
2:13.544 default J conflagrate Fluffy_Pillow 170843.3/1100000: 16% mana | 1.0/5: 20% soul_shard soul_harvest, lord_of_flames, embrace_chaos, accelerando(2), potion_of_deadly_grace
2:14.673 default K conflagrate Fluffy_Pillow 187400.6/1100000: 17% mana | 2.0/5: 40% soul_shard soul_harvest, lord_of_flames, embrace_chaos, accelerando(2), potion_of_deadly_grace
2:15.804 default R chaos_bolt Fluffy_Pillow 203987.3/1100000: 19% mana | 3.0/5: 60% soul_shard soul_harvest, lord_of_flames, accelerando(2), potion_of_deadly_grace
2:18.059 default K conflagrate Fluffy_Pillow 237254.8/1100000: 22% mana | 1.0/5: 20% soul_shard soul_harvest, lord_of_flames, embrace_chaos, accelerando(3), potion_of_deadly_grace
2:19.173 default Q dimensional_rift Fluffy_Pillow 253832.0/1100000: 23% mana | 2.0/5: 40% soul_shard soul_harvest, lord_of_flames, embrace_chaos, accelerando(3), potion_of_deadly_grace
2:20.287 default R chaos_bolt Fluffy_Pillow 270409.2/1100000: 25% mana | 3.0/5: 60% soul_shard soul_harvest, lord_of_flames, embrace_chaos, accelerando(3), potion_of_deadly_grace
2:21.624 default K conflagrate Fluffy_Pillow 289698.0/1100000: 26% mana | 1.0/5: 20% soul_shard soul_harvest, lord_of_flames, embrace_chaos, potion_of_deadly_grace
2:22.789 default S incinerate Fluffy_Pillow 306281.3/1100000: 28% mana | 2.0/5: 40% soul_shard soul_harvest, lord_of_flames, conflagration_of_chaos, embrace_chaos, potion_of_deadly_grace
2:24.244 default R chaos_bolt Fluffy_Pillow 260992.7/1100000: 24% mana | 3.0/5: 60% soul_shard soul_harvest, lord_of_flames, conflagration_of_chaos, embrace_chaos, potion_of_deadly_grace
2:25.638 default C havoc enemy2 280835.7/1100000: 26% mana | 2.0/5: 40% soul_shard soul_harvest, lord_of_flames, conflagration_of_chaos, embrace_chaos, potion_of_deadly_grace
2:26.802 default S incinerate Fluffy_Pillow 209404.7/1100000: 19% mana | 2.0/5: 40% soul_shard soul_harvest, lord_of_flames, conflagration_of_chaos, embrace_chaos, potion_of_deadly_grace
2:28.259 default K conflagrate Fluffy_Pillow 164145.6/1100000: 15% mana | 2.0/5: 40% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando, potion_of_deadly_grace
2:29.404 default R chaos_bolt Fluffy_Pillow 180690.7/1100000: 16% mana | 5.0/5: 100% soul_shard lord_of_flames, embrace_chaos, accelerando, potion_of_deadly_grace
2:30.779 default R chaos_bolt Fluffy_Pillow 200559.3/1100000: 18% mana | 3.0/5: 60% soul_shard lord_of_flames, embrace_chaos, accelerando, potion_of_deadly_grace
2:32.154 default S incinerate Fluffy_Pillow 220427.9/1100000: 20% mana | 2.0/5: 40% soul_shard lord_of_flames, embrace_chaos, accelerando, potion_of_deadly_grace
2:33.590 default R chaos_bolt Fluffy_Pillow 175178.0/1100000: 16% mana | 3.0/5: 60% soul_shard lord_of_flames, embrace_chaos, nefarious_pact, accelerando, potion_of_deadly_grace
2:34.545 default S incinerate Fluffy_Pillow 188978.9/1100000: 17% mana | 1.0/5: 20% soul_shard lord_of_flames, embrace_chaos, nefarious_pact, accelerando(2), potion_of_deadly_grace
2:35.527 default E immolate Fluffy_Pillow 137380.4/1100000: 12% mana | 2.0/5: 40% soul_shard lord_of_flames, embrace_chaos, nefarious_pact, accelerando(2), potion_of_deadly_grace
2:36.310 default S incinerate Fluffy_Pillow 82863.5/1100000: 8% mana | 2.0/5: 40% soul_shard lord_of_flames, embrace_chaos, nefarious_pact, accelerando(2), potion_of_deadly_grace
2:37.289 default R chaos_bolt Fluffy_Pillow 31221.0/1100000: 3% mana | 3.0/5: 60% soul_shard lord_of_flames, embrace_chaos, nefarious_pact, accelerando(2), potion_of_deadly_grace
2:38.231 default T life_tap Fluffy_Pillow 45037.4/1100000: 4% mana | 1.0/5: 20% soul_shard lord_of_flames, embrace_chaos, nefarious_pact, accelerando(3), potion_of_deadly_grace
2:39.001 default S incinerate Fluffy_Pillow 386495.7/1100000: 35% mana | 1.0/5: 20% soul_shard lord_of_flames, embrace_chaos, nefarious_pact, accelerando(3)
2:39.967 default S incinerate Fluffy_Pillow 334870.5/1100000: 30% mana | 1.0/5: 20% soul_shard lord_of_flames, embrace_chaos, nefarious_pact, accelerando(3)
2:40.933 default Q dimensional_rift Fluffy_Pillow 282806.6/1100000: 26% mana | 2.0/5: 40% soul_shard lord_of_flames, embrace_chaos, nefarious_pact
2:41.741 default R chaos_bolt Fluffy_Pillow 294308.1/1100000: 27% mana | 2.0/5: 40% soul_shard lord_of_flames, embrace_chaos, nefarious_pact
2:42.710 default S incinerate Fluffy_Pillow 308102.7/1100000: 28% mana | 0.0/5: 0% soul_shard lord_of_flames, embrace_chaos, nefarious_pact, accelerando
2:43.705 default S incinerate Fluffy_Pillow 256480.4/1100000: 23% mana | 1.0/5: 20% soul_shard lord_of_flames, embrace_chaos, nefarious_pact, accelerando
2:44.701 default S incinerate Fluffy_Pillow 204872.5/1100000: 19% mana | 1.0/5: 20% soul_shard lord_of_flames, embrace_chaos, nefarious_pact, accelerando
2:45.696 default C havoc enemy2 153251.0/1100000: 14% mana | 1.0/5: 20% soul_shard lord_of_flames, embrace_chaos, devils_due, accelerando(2)
2:47.025 default G immolate Fluffy_Pillow 84741.4/1100000: 8% mana | 3.0/5: 60% soul_shard lord_of_flames, devils_due, accelerando(2)
2:48.355 default J conflagrate Fluffy_Pillow 38246.5/1100000: 3% mana | 3.0/5: 60% soul_shard lord_of_flames, devils_due, accelerando(2)
2:49.684 default R chaos_bolt Fluffy_Pillow 57737.0/1100000: 5% mana | 4.0/5: 80% soul_shard lord_of_flames, conflagration_of_chaos, devils_due, accelerando(2)
2:52.339 default R chaos_bolt Fluffy_Pillow 96673.9/1100000: 9% mana | 3.0/5: 60% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, devils_due, accelerando(2)
2:53.934 default K conflagrate Fluffy_Pillow 120065.3/1100000: 11% mana | 1.0/5: 20% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(2)
2:55.063 default R chaos_bolt Fluffy_Pillow 136468.0/1100000: 12% mana | 3.0/5: 60% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, nefarious_pact
2:56.029 default K conflagrate Fluffy_Pillow 150218.6/1100000: 14% mana | 2.0/5: 40% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, nefarious_pact
2:56.836 default R chaos_bolt Fluffy_Pillow 161793.5/1100000: 15% mana | 3.0/5: 60% soul_shard lord_of_flames, embrace_chaos, nefarious_pact, accelerando
2:57.790 default K conflagrate Fluffy_Pillow 175578.7/1100000: 16% mana | 2.0/5: 40% soul_shard lord_of_flames, embrace_chaos, nefarious_pact, accelerando
2:58.586 default R chaos_bolt Fluffy_Pillow 187080.8/1100000: 17% mana | 3.0/5: 60% soul_shard lord_of_flames, embrace_chaos, nefarious_pact, accelerando
2:59.540 default S incinerate Fluffy_Pillow 200866.0/1100000: 18% mana | 2.0/5: 40% soul_shard lord_of_flames, embrace_chaos, nefarious_pact, accelerando
3:00.535 default S incinerate Fluffy_Pillow 149243.7/1100000: 14% mana | 2.0/5: 40% soul_shard lord_of_flames, embrace_chaos, nefarious_pact, accelerando
3:01.529 default Q dimensional_rift Fluffy_Pillow 97606.9/1100000: 9% mana | 2.0/5: 40% soul_shard lord_of_flames, embrace_chaos, nefarious_pact, accelerando
3:02.324 default K conflagrate Fluffy_Pillow 109094.5/1100000: 10% mana | 2.0/5: 40% soul_shard lord_of_flames, embrace_chaos, nefarious_pact, accelerando
3:03.121 default Q dimensional_rift Fluffy_Pillow 120611.1/1100000: 11% mana | 3.0/5: 60% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, nefarious_pact, accelerando
3:03.918 default H berserking Fluffy_Pillow 132127.7/1100000: 12% mana | 3.0/5: 60% soul_shard lord_of_flames, conflagration_of_chaos, nefarious_pact, accelerando
3:03.918 default R chaos_bolt Fluffy_Pillow 132127.7/1100000: 12% mana | 3.0/5: 60% soul_shard berserking, lord_of_flames, conflagration_of_chaos, nefarious_pact, accelerando
3:05.297 default S incinerate Fluffy_Pillow 155252.0/1100000: 14% mana | 1.0/5: 20% soul_shard berserking, lord_of_flames, conflagration_of_chaos, embrace_chaos, nefarious_pact, accelerando(2)
3:06.150 default C havoc enemy2 103638.2/1100000: 9% mana | 1.0/5: 20% soul_shard berserking, lord_of_flames, conflagration_of_chaos, embrace_chaos, nefarious_pact, accelerando(2)
3:06.903 default T life_tap Fluffy_Pillow 28337.7/1100000: 3% mana | 1.0/5: 20% soul_shard berserking, lord_of_flames, conflagration_of_chaos, embrace_chaos, devils_due, accelerando(2)
3:08.059 default S incinerate Fluffy_Pillow 377834.0/1100000: 34% mana | 1.0/5: 20% soul_shard berserking, lord_of_flames, conflagration_of_chaos, embrace_chaos, devils_due, accelerando(2)
3:09.507 default E immolate Fluffy_Pillow 335720.8/1100000: 31% mana | 2.0/5: 40% soul_shard berserking, lord_of_flames, conflagration_of_chaos, devils_due
3:10.700 default R chaos_bolt Fluffy_Pillow 289250.0/1100000: 26% mana | 2.0/5: 40% soul_shard berserking, lord_of_flames, conflagration_of_chaos, devils_due
3:13.079 default S incinerate Fluffy_Pillow 328193.7/1100000: 30% mana | 0.0/5: 0% soul_shard berserking, lord_of_flames, conflagration_of_chaos, embrace_chaos, devils_due
3:14.571 default L service_imp Fluffy_Pillow 285398.1/1100000: 26% mana | 1.0/5: 20% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando
3:15.718 default S incinerate Fluffy_Pillow 301972.1/1100000: 27% mana | 0.0/5: 0% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando
3:17.154 default R chaos_bolt Fluffy_Pillow 256722.2/1100000: 23% mana | 2.0/5: 40% soul_shard lord_of_flames, conflagration_of_chaos, accelerando
3:19.443 default G immolate Fluffy_Pillow 290014.9/1100000: 26% mana | 1.0/5: 20% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(2)
3:20.573 default J conflagrate Fluffy_Pillow 240586.9/1100000: 22% mana | 1.0/5: 20% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(2)
3:21.702 default R chaos_bolt Fluffy_Pillow 257144.2/1100000: 23% mana | 3.0/5: 60% soul_shard lord_of_flames, embrace_chaos, accelerando(2)
3:23.058 default K conflagrate Fluffy_Pillow 277030.6/1100000: 25% mana | 1.0/5: 20% soul_shard lord_of_flames, embrace_chaos, accelerando(2)
3:24.187 default K conflagrate Fluffy_Pillow 293588.0/1100000: 27% mana | 2.0/5: 40% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(2)
3:25.318 default R chaos_bolt Fluffy_Pillow 310174.6/1100000: 28% mana | 4.0/5: 80% soul_shard lord_of_flames, embrace_chaos, accelerando(2)
3:26.672 default C havoc enemy2 329646.9/1100000: 30% mana | 2.0/5: 40% soul_shard lord_of_flames, embrace_chaos
3:27.836 default K conflagrate Fluffy_Pillow 258294.8/1100000: 23% mana | 2.0/5: 40% soul_shard lord_of_flames, embrace_chaos, accelerando
3:28.981 default R chaos_bolt Fluffy_Pillow 274839.9/1100000: 25% mana | 4.0/5: 80% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando
3:30.356 default R chaos_bolt Fluffy_Pillow 294708.5/1100000: 27% mana | 3.0/5: 60% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando
3:31.731 default S incinerate Fluffy_Pillow 314577.1/1100000: 29% mana | 1.0/5: 20% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando
3:33.165 default S incinerate Fluffy_Pillow 269298.3/1100000: 24% mana | 1.0/5: 20% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando
3:34.601 default K conflagrate Fluffy_Pillow 224048.3/1100000: 20% mana | 1.0/5: 20% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando
3:35.748 default R chaos_bolt Fluffy_Pillow 240622.3/1100000: 22% mana | 2.0/5: 40% soul_shard lord_of_flames, conflagration_of_chaos, accelerando
3:38.035 default S incinerate Fluffy_Pillow 273827.9/1100000: 25% mana | 1.0/5: 20% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(2)
3:39.450 default S incinerate Fluffy_Pillow 228693.7/1100000: 21% mana | 1.0/5: 20% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(3)
3:40.844 default S incinerate Fluffy_Pillow 182549.7/1100000: 17% mana | 1.0/5: 20% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos
3:42.301 default E immolate Fluffy_Pillow 137289.4/1100000: 12% mana | 2.0/5: 40% soul_shard lord_of_flames, conflagration_of_chaos
3:43.464 default R chaos_bolt Fluffy_Pillow 87844.3/1100000: 8% mana | 2.0/5: 40% soul_shard lord_of_flames, conflagration_of_chaos
3:45.787 default S incinerate Fluffy_Pillow 120911.2/1100000: 11% mana | 1.0/5: 20% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos
3:47.242 default Q dimensional_rift Fluffy_Pillow 75622.5/1100000: 7% mana | 1.0/5: 20% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos
3:48.406 default C havoc enemy2 92191.6/1100000: 8% mana | 1.0/5: 20% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos
3:49.569 default N summon_doomguard Fluffy_Pillow 20746.4/1100000: 2% mana | 1.0/5: 20% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos
3:50.734 default T life_tap Fluffy_Pillow 37392.6/1100000: 3% mana | 0.0/5: 0% soul_shard lord_of_flames, conflagration_of_chaos, accelerando
3:51.880 default S incinerate Fluffy_Pillow 383952.2/1100000: 35% mana | 1.0/5: 20% soul_shard lord_of_flames, conflagration_of_chaos, accelerando
3:53.315 default G immolate Fluffy_Pillow 338807.4/1100000: 31% mana | 2.0/5: 40% soul_shard lord_of_flames, conflagration_of_chaos, accelerando(2)
3:54.444 default J conflagrate Fluffy_Pillow 289365.6/1100000: 26% mana | 2.0/5: 40% soul_shard lord_of_flames, conflagration_of_chaos, accelerando(3)
3:55.557 default R chaos_bolt Fluffy_Pillow 305928.0/1100000: 28% mana | 3.0/5: 60% soul_shard lord_of_flames, accelerando(3)
3:57.779 default R chaos_bolt Fluffy_Pillow 339105.0/1100000: 31% mana | 3.0/5: 60% soul_shard lord_of_flames, embrace_chaos, accelerando(4)
3:59.097 default K conflagrate Fluffy_Pillow 359002.0/1100000: 33% mana | 1.0/5: 20% soul_shard lord_of_flames, embrace_chaos, accelerando(4)
4:00.194 default K conflagrate Fluffy_Pillow 375562.8/1100000: 34% mana | 2.0/5: 40% soul_shard lord_of_flames, embrace_chaos, accelerando(4)
4:01.289 default R chaos_bolt Fluffy_Pillow 392093.4/1100000: 36% mana | 3.0/5: 60% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(4)
4:02.604 default K conflagrate Fluffy_Pillow 411988.9/1100000: 37% mana | 2.0/5: 40% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos
4:03.767 default R chaos_bolt Fluffy_Pillow 428543.8/1100000: 39% mana | 3.0/5: 60% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos
4:05.162 default R chaos_bolt Fluffy_Pillow 448608.8/1100000: 41% mana | 4.0/5: 80% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando
4:06.537 default S incinerate Fluffy_Pillow 468477.4/1100000: 43% mana | 2.0/5: 40% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, nefarious_pact, accelerando
4:07.533 default S incinerate Fluffy_Pillow 416869.5/1100000: 38% mana | 2.0/5: 40% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, nefarious_pact, accelerando
4:08.529 default C havoc enemy2 365449.6/1100000: 33% mana | 2.0/5: 40% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, nefarious_pact, accelerando(2)
4:09.312 default K conflagrate Fluffy_Pillow 288993.2/1100000: 26% mana | 2.0/5: 40% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, nefarious_pact, accelerando(3)
4:10.085 default O soul_harvest Fluffy_Pillow 300496.0/1100000: 27% mana | 4.0/5: 80% soul_shard lord_of_flames, embrace_chaos, nefarious_pact, accelerando(3)
4:10.085 default R chaos_bolt Fluffy_Pillow 300496.0/1100000: 27% mana | 4.0/5: 80% soul_shard soul_harvest, lord_of_flames, embrace_chaos, nefarious_pact, accelerando(3)
4:11.010 default R chaos_bolt Fluffy_Pillow 314260.8/1100000: 29% mana | 3.0/5: 60% soul_shard soul_harvest, lord_of_flames, embrace_chaos, nefarious_pact, accelerando(3)
4:11.934 default S incinerate Fluffy_Pillow 328010.6/1100000: 30% mana | 2.0/5: 40% soul_shard soul_harvest, lord_of_flames, embrace_chaos, nefarious_pact, accelerando(3)
4:12.902 default S incinerate Fluffy_Pillow 276415.2/1100000: 25% mana | 2.0/5: 40% soul_shard soul_harvest, lord_of_flames, embrace_chaos, nefarious_pact, accelerando(3)
4:13.866 default S incinerate Fluffy_Pillow 224760.3/1100000: 20% mana | 2.0/5: 40% soul_shard soul_harvest, lord_of_flames, embrace_chaos, nefarious_pact, accelerando(3)
4:14.832 default R chaos_bolt Fluffy_Pillow 173135.2/1100000: 16% mana | 3.0/5: 60% soul_shard soul_harvest, lord_of_flames, embrace_chaos, nefarious_pact, accelerando(3)
4:15.757 default S incinerate Fluffy_Pillow 186899.9/1100000: 17% mana | 2.0/5: 40% soul_shard soul_harvest, lord_of_flames, embrace_chaos, nefarious_pact, accelerando(3)
4:16.723 default E immolate Fluffy_Pillow 134934.9/1100000: 12% mana | 3.0/5: 60% soul_shard soul_harvest, lord_of_flames, embrace_chaos, nefarious_pact
4:17.531 default R chaos_bolt Fluffy_Pillow 80437.5/1100000: 7% mana | 3.0/5: 60% soul_shard soul_harvest, lord_of_flames, embrace_chaos, nefarious_pact, accelerando
4:18.485 default S incinerate Fluffy_Pillow 94222.7/1100000: 9% mana | 1.0/5: 20% soul_shard soul_harvest, lord_of_flames, embrace_chaos, devils_due, accelerando
4:20.176 default T life_tap Fluffy_Pillow 52657.5/1100000: 5% mana | 1.0/5: 20% soul_shard soul_harvest, lord_of_flames, embrace_chaos, devils_due, accelerando
4:21.526 default S incinerate Fluffy_Pillow 402164.8/1100000: 37% mana | 1.0/5: 20% soul_shard soul_harvest, lord_of_flames, embrace_chaos, devils_due, accelerando
4:23.216 default S incinerate Fluffy_Pillow 360585.1/1100000: 33% mana | 1.0/5: 20% soul_shard soul_harvest, lord_of_flames, devils_due, accelerando
4:24.907 default S incinerate Fluffy_Pillow 319019.9/1100000: 29% mana | 1.0/5: 20% soul_shard soul_harvest, lord_of_flames, devils_due, accelerando
4:26.598 default G immolate Fluffy_Pillow 277454.7/1100000: 25% mana | 1.0/5: 20% soul_shard soul_harvest, lord_of_flames, accelerando
4:27.746 default J conflagrate Fluffy_Pillow 228097.3/1100000: 21% mana | 1.0/5: 20% soul_shard soul_harvest, lord_of_flames, accelerando(2)
4:28.875 default C havoc enemy2 244654.6/1100000: 22% mana | 2.0/5: 40% soul_shard soul_harvest, lord_of_flames, accelerando(2)
4:30.003 default R chaos_bolt Fluffy_Pillow 172991.7/1100000: 16% mana | 3.0/5: 60% soul_shard lord_of_flames
4:32.326 default J conflagrate Fluffy_Pillow 206147.6/1100000: 19% mana | 1.0/5: 20% soul_shard lord_of_flames, embrace_chaos, accelerando
4:33.470 default J conflagrate Fluffy_Pillow 222678.3/1100000: 20% mana | 2.0/5: 40% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando
4:34.616 default Q dimensional_rift Fluffy_Pillow 239237.9/1100000: 22% mana | 3.0/5: 60% soul_shard lord_of_flames, embrace_chaos, accelerando
4:35.758 default J conflagrate Fluffy_Pillow 255739.6/1100000: 23% mana | 3.0/5: 60% soul_shard lord_of_flames, embrace_chaos, accelerando
4:36.904 default R chaos_bolt Fluffy_Pillow 272299.2/1100000: 25% mana | 4.0/5: 80% soul_shard lord_of_flames, conflagration_of_chaos, accelerando
4:39.191 default R chaos_bolt Fluffy_Pillow 305346.1/1100000: 28% mana | 3.0/5: 60% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando
4:40.564 default S incinerate Fluffy_Pillow 325186.7/1100000: 30% mana | 2.0/5: 40% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(2)
4:41.980 default J conflagrate Fluffy_Pillow 279953.0/1100000: 25% mana | 2.0/5: 40% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(2)
4:43.109 default R chaos_bolt Fluffy_Pillow 296510.4/1100000: 27% mana | 3.0/5: 60% soul_shard lord_of_flames, embrace_chaos, accelerando(2)
4:44.464 default L service_imp Fluffy_Pillow 316144.7/1100000: 29% mana | 2.0/5: 40% soul_shard lord_of_flames, embrace_chaos
4:45.734 default S incinerate Fluffy_Pillow 334222.6/1100000: 30% mana | 1.0/5: 20% soul_shard lord_of_flames, embrace_chaos
4:47.192 default S incinerate Fluffy_Pillow 288976.6/1100000: 26% mana | 1.0/5: 20% soul_shard lord_of_flames, embrace_chaos
4:48.649 default J conflagrate Fluffy_Pillow 243716.4/1100000: 22% mana | 2.0/5: 40% soul_shard lord_of_flames
4:49.812 default C havoc enemy2 260271.3/1100000: 24% mana | 3.0/5: 60% soul_shard lord_of_flames, conflagration_of_chaos
4:50.976 default E immolate Fluffy_Pillow 188840.3/1100000: 17% mana | 4.0/5: 80% soul_shard lord_of_flames, conflagration_of_chaos
4:52.139 default R chaos_bolt Fluffy_Pillow 139396.0/1100000: 13% mana | 5.0/5: 100% soul_shard lord_of_flames, conflagration_of_chaos, accelerando
4:54.426 default R chaos_bolt Fluffy_Pillow 172442.9/1100000: 16% mana | 3.0/5: 60% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando
4:55.798 default J conflagrate Fluffy_Pillow 192268.2/1100000: 17% mana | 1.0/5: 20% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando

Stats

Raid-Buffed Unbuffed Gear Amount
Strength 4201 3876 0
Agility 7254 6929 0
Stamina 54592 54592 34105
Intellect 50293 48587 38950
Spirit 1 1 0
Health 3275520 3275520 0
Mana 1100000 1100000 0
Soul Shard 5 5 0
Spell Power 50293 48587 0
Crit 15.68% 15.68% 4271
Haste 29.41% 28.41% 10652
Damage / Heal Versatility 5.39% 5.39% 2559
ManaReg per Second 14235 14125 0
Mastery 66.15% 66.15% 5618
Armor 1975 1975 1975
Run Speed 7 0 0

Gear

Source Slot Average Item Level: 906.00
Local Head Eyes of Azj'Aqir
ilevel: 900, stats: { 253 Armor, +3255 Sta, +2170 Int, +1074 Haste, +578 Vers }
Local Neck Radiant String of Scorpid Eyes
ilevel: 900, stats: { +1831 Sta, +2011 Haste, +922 Crit }, enchant: mark_of_the_hidden_satyr
Local Shoulders Pauldrons of Azj'Aqir
ilevel: 900, stats: { 233 Armor, +2442 Sta, +1628 Int, +752 Mastery, +487 Vers }
Local Chest Robes of Fluctuating Energy
ilevel: 900, stats: { 311 Armor, +3255 Sta, +2170 Int, +1145 Haste, +507 Mastery }
Local Waist Man'ari Skullbuckled Cinch
ilevel: 900, stats: { 175 Armor, +2442 Sta, +1628 Int, +699 Haste, +540 Mastery }
Local Legs Leggings of Azj'Aqir
ilevel: 900, stats: { 272 Armor, +3255 Sta, +2170 Int, +932 Crit, +720 Haste }
Local Feet Outcast Wanderer's Footrags
ilevel: 910, stats: { 222 Armor, +2680 Sta, +1786 Int, +864 Crit, +422 Mastery }
Local Wrists Woven Lasher Tendril Bracers
ilevel: 900, stats: { 136 Armor, +1831 Sta, +1221 Int, +644 Haste, +285 Vers }
Local Hands Clutch of Azj'Aqir
ilevel: 900, stats: { 194 Armor, +2442 Sta, +1628 Int, +859 Crit, +380 Mastery }
Local Finger1 Ring of the Scoured Clan
ilevel: 900, stats: { +1831 Sta, +2095 Mastery, +838 Haste }, enchant: { +200 Haste }
Local Finger2 Ring of Braided Stems
ilevel: 905, stats: { +1918 Sta, +1814 Haste, +1209 Vers }, enchant: { +200 Haste }
Local Trinket1 Whispers in the Dark
ilevel: 905, stats: { +2162 Int }
Local Trinket2 Erratic Metronome
ilevel: 900, stats: { +2063 Int }
Local Back Odr, Shawl of the Ymirjar
ilevel: 940, stats: { 179 Armor, +2658 Sta, +1772 Int, +694 Crit, +385 Haste }, enchant: { +200 Int }
Local Main Hand Scepter of Sargeras
ilevel: 929, weapon: { 7005 - 10509, 3.6 }, stats: { +2843 Int, +4265 Sta, +922 Haste, +922 Mastery, +15509 Int }, relics: { +61 ilevels, +59 ilevels, +61 ilevels }

Talents

Level
15 Backdraft (Destruction Warlock) Roaring Blaze (Destruction Warlock) Shadowburn (Destruction Warlock)
30 Reverse Entropy (Destruction Warlock) Eradication (Destruction Warlock) Empowered Life Tap
45 Demonic Circle Mortal Coil Shadowfury
60 Cataclysm (Destruction Warlock) Fire and Brimstone (Destruction Warlock) Soul Harvest
75 Demon Skin Burning Rush Dark Pact
90 Grimoire of Supremacy Grimoire of Service Grimoire of Sacrifice
100 Wreak Havoc (Destruction Warlock) Channel Demonfire (Destruction Warlock) Soul Conduit

Profile

warlock="Cloak"
level=110
race=troll
role=spell
position=back
talents=2203021
artifact=38:0:0:0:0:803:1:804:3:805:3:806:3:807:3:808:3:809:3:810:3:811:3:812:3:813:1:814:1:815:1:816:1:817:1:818:1:1355:1:1392:1:1609:4:1610:1:1611:1:1713:1
spec=destruction

# This default action priority list is automatically created based on your character.
# It is a attempt to provide you with a action list that is both simple and practicable,
# while resulting in a meaningful and good simulation. It may not result in the absolutely highest possible dps.
# Feel free to edit, adapt and improve it to your own needs.
# SimulationCraft is always looking for updates and improvements to the default action lists.

# Executed before combat begins. Accepts non-harmful actions only.
actions.precombat=flask,type=whispered_pact
actions.precombat+=/food,type=azshari_salad
actions.precombat+=/summon_pet,if=!talent.grimoire_of_supremacy.enabled&(!talent.grimoire_of_sacrifice.enabled|buff.demonic_power.down)
actions.precombat+=/summon_infernal,if=talent.grimoire_of_supremacy.enabled&artifact.lord_of_flames.rank>0
actions.precombat+=/summon_infernal,if=talent.grimoire_of_supremacy.enabled&active_enemies>1
actions.precombat+=/summon_doomguard,if=talent.grimoire_of_supremacy.enabled&active_enemies=1&artifact.lord_of_flames.rank=0
actions.precombat+=/augmentation,type=defiled
actions.precombat+=/snapshot_stats
actions.precombat+=/grimoire_of_sacrifice,if=talent.grimoire_of_sacrifice.enabled
actions.precombat+=/life_tap,if=talent.empowered_life_tap.enabled&!buff.empowered_life_tap.remains
actions.precombat+=/potion,name=prolonged_power
actions.precombat+=/chaos_bolt

# Executed every time the actor is available.
actions=havoc,target=2,if=active_enemies>1&(active_enemies<4|talent.wreak_havoc.enabled&active_enemies<6)&!debuff.havoc.remains
actions+=/dimensional_rift,if=charges=3
actions+=/immolate,if=remains<=tick_time
actions+=/immolate,cycle_targets=1,if=active_enemies>1&remains<=tick_time&(!talent.roaring_blaze.enabled|(!debuff.roaring_blaze.remains&action.conflagrate.charges<2+set_bonus.tier19_4pc))
actions+=/immolate,if=talent.roaring_blaze.enabled&remains<=duration&!debuff.roaring_blaze.remains&target.time_to_die>10&(action.conflagrate.charges=2+set_bonus.tier19_4pc|(action.conflagrate.charges>=1+set_bonus.tier19_4pc&action.conflagrate.recharge_time<cast_time+gcd)|target.time_to_die<24)
actions+=/berserking
actions+=/blood_fury
actions+=/arcane_torrent
actions+=/potion,name=deadly_grace,if=(buff.soul_harvest.remains|trinket.proc.any.react|target.time_to_die<=45)
actions+=/shadowburn,if=buff.conflagration_of_chaos.remains<=action.chaos_bolt.cast_time
actions+=/shadowburn,if=(charges=1+set_bonus.tier19_4pc&recharge_time<action.chaos_bolt.cast_time|charges=2+set_bonus.tier19_4pc)&soul_shard<5
actions+=/conflagrate,if=talent.roaring_blaze.enabled&(charges=2+set_bonus.tier19_4pc|(charges>=1+set_bonus.tier19_4pc&recharge_time<gcd)|target.time_to_die<24)
actions+=/conflagrate,if=talent.roaring_blaze.enabled&debuff.roaring_blaze.stack>0&dot.immolate.remains>dot.immolate.duration*0.3&(active_enemies=1|soul_shard<3)&soul_shard<5
actions+=/conflagrate,if=!talent.roaring_blaze.enabled&buff.backdraft.stack<3&buff.conflagration_of_chaos.remains<=action.chaos_bolt.cast_time
actions+=/conflagrate,if=!talent.roaring_blaze.enabled&buff.backdraft.stack<3&(charges=1+set_bonus.tier19_4pc&recharge_time<action.chaos_bolt.cast_time|charges=2+set_bonus.tier19_4pc)&soul_shard<5
actions+=/life_tap,if=talent.empowered_life_tap.enabled&buff.empowered_life_tap.remains<=gcd
actions+=/dimensional_rift,if=equipped.144369&!buff.lessons_of_spacetime.remains&((!talent.grimoire_of_supremacy.enabled&!cooldown.summon_doomguard.remains)|(talent.grimoire_of_service.enabled&!cooldown.service_pet.remains)|(talent.soul_harvest.enabled&!cooldown.soul_harvest.remains))
actions+=/service_pet
actions+=/summon_infernal,if=artifact.lord_of_flames.rank>0&!buff.lord_of_flames.remains
actions+=/summon_doomguard,if=!talent.grimoire_of_supremacy.enabled&spell_targets.infernal_awakening<=2&(target.time_to_die>180|target.health.pct<=20|target.time_to_die<30)
actions+=/summon_infernal,if=!talent.grimoire_of_supremacy.enabled&spell_targets.infernal_awakening>2
actions+=/summon_doomguard,if=talent.grimoire_of_supremacy.enabled&spell_targets.summon_infernal=1&artifact.lord_of_flames.rank>0&buff.lord_of_flames.remains&!pet.doomguard.active
actions+=/summon_doomguard,if=talent.grimoire_of_supremacy.enabled&spell_targets.summon_infernal=1&equipped.132379&!cooldown.sindorei_spite_icd.remains
actions+=/summon_infernal,if=talent.grimoire_of_supremacy.enabled&spell_targets.summon_infernal>1&equipped.132379&!cooldown.sindorei_spite_icd.remains
actions+=/soul_harvest
actions+=/channel_demonfire,if=dot.immolate.remains>cast_time
actions+=/havoc,if=active_enemies=1&talent.wreak_havoc.enabled&equipped.132375&!debuff.havoc.remains
actions+=/rain_of_fire,if=active_enemies>=3&cooldown.havoc.remains<=12&!talent.wreak_havoc.enabled
actions+=/rain_of_fire,if=active_enemies>=6&talent.wreak_havoc.enabled
actions+=/dimensional_rift,if=!equipped.144369|charges>1|((!talent.grimoire_of_service.enabled|recharge_time<cooldown.service_pet.remains)&(!talent.soul_harvest.enabled|recharge_time<cooldown.soul_harvest.remains)&(!talent.grimoire_of_supremacy.enabled|recharge_time<cooldown.summon_doomguard.remains))
actions+=/life_tap,if=talent.empowered_life_tap.enabled&buff.empowered_life_tap.remains<duration*0.3
actions+=/cataclysm
actions+=/chaos_bolt,if=(cooldown.havoc.remains>12&cooldown.havoc.remains|active_enemies<3|talent.wreak_havoc.enabled&active_enemies<6)&(set_bonus.tier19_4pc=0|!talent.eradication.enabled|buff.embrace_chaos.remains<=cast_time|soul_shard>=3)
actions+=/shadowburn
actions+=/conflagrate,if=!talent.roaring_blaze.enabled&buff.backdraft.stack<3
actions+=/immolate,if=!talent.roaring_blaze.enabled&remains<=duration*0.3
actions+=/incinerate
actions+=/life_tap

head=eyes_of_azjaqir,id=138314,bonus_id=3445
neck=radiant_string_of_scorpid_eyes,id=140898,bonus_id=3445,enchant_id=5439
shoulders=pauldrons_of_azjaqir,id=138323,bonus_id=3445
back=odr_shawl_of_the_ymirjar,id=132375,ilevel=940,enchant_id=5436
chest=robes_of_fluctuating_energy,id=140848,bonus_id=3445
wrists=woven_lasher_tendril_bracers,id=140886,bonus_id=3445
hands=clutch_of_azjaqir,id=138311,bonus_id=3445
waist=manari_skullbuckled_cinch,id=140887,bonus_id=3445
legs=leggings_of_azjaqir,id=138317,bonus_id=3445
feet=outcast_wanderers_footrags,id=140914,bonus_id=3519
finger1=ring_of_the_scoured_clan,id=140897,bonus_id=3445,enchant=binding_of_haste
finger2=ring_of_braided_stems,id=140896,bonus_id=3518,enchant=binding_of_haste
trinket1=whispers_in_the_dark,id=140809,ilevel=905
trinket2=erratic_metronome,id=140792,ilevel=900
main_hand=scepter_of_sargeras,id=128941,ilevel=929,gem_id=140826/140837/140826,relic_id=3519/3518:3518/3519

# Gear Summary
# gear_ilvl=905.93
# gear_stamina=34105
# gear_intellect=38950
# gear_crit_rating=4271
# gear_haste_rating=10652
# gear_mastery_rating=5618
# gear_versatility_rating=2559
# gear_armor=1975
# set_bonus=tier19_2pc=1
# set_bonus=tier19_4pc=1
default_pet=imp

Destro_7.2_NoLeggos : 1308303 dps, 783485 dps to main target

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR
1308303.4 1308303.4 1092.8 / 0.084% 221326.7 / 16.9% 40.9
RPS Out RPS In Primary Resource Waiting APM Active Skill
25533.1 25533.1 Mana 0.00% 50.4 100.0% 100%
Talents
  • 15: Roaring Blaze (Destruction Warlock)
  • 30: Eradication (Destruction Warlock)
  • 60: Soul Harvest
  • 90: Grimoire of Service
  • 100: Wreak Havoc (Destruction Warlock)
  • Talent Calculator
Artifact

Charts

Abilities

Damage Stats DPS DPS% Execute Interval DPE DPET Type Count Hit Crit Avg Crit% Up%
Destro_7.2_NoLeggos 1308303
Chaos Bolt 383432 29.4% 60.6 4.82sec 1901202 1281124 Direct 116.0 0 993744 993744 100.0%  

Stats details: chaos_bolt

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 60.64 116.02 0.00 0.00 1.4840 0.0000 115290939.47 115290939.47 0.00 1281124.32 1281124.32
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
crit 116.02 100.00% 993743.53 645616 1517706 994008.23 934697 1060615 115290939 115290939 0.00
 
 

Action details: chaos_bolt

Static Values
  • id:116858
  • school:chromatic
  • resource:soul_shard
  • range:40.0
  • travel_speed:16.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:2.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:3.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:116858
  • name:Chaos Bolt
  • school:chromatic
  • tooltip:
  • description:Unleashes a devastating blast of chaos, causing {$s1=1} Chaos damage. Chaos Bolt always critically strikes and your critical strike chance increases its damage.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:4.000000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
Conflagrate 162023 12.4% 48.5 6.18sec 1002386 968654 Direct 96.5 299963 673790 504018 54.6%  

Stats details: conflagrate

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 48.54 96.54 0.00 0.00 1.0348 0.0000 48656451.44 48656451.44 0.00 968653.85 968653.85
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 43.84 45.42% 299963.17 197029 463174 300101.08 264333 336772 13151391 13151391 0.00
crit 52.69 54.58% 673789.82 394103 1055493 674024.14 602007 747197 35505060 35505060 0.00
 
 

Action details: conflagrate

Static Values
  • id:17962
  • school:fire
  • resource:chi
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:9.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:talent.roaring_blaze.enabled&(charges=2+set_bonus.tier19_4pc|(charges>=1+set_bonus.tier19_4pc&recharge_time<gcd)|target.time_to_die<24)
Spelldata
  • id:17962
  • name:Conflagrate
  • school:fire
  • tooltip:
  • description:Triggers an explosion on the target, dealing {$s1=1} Fire damage.{$?s196406=false}[ Reduces the cast time of Incinerate and Chaos Bolt by {$117828s1=30}% for {$117828d=10 seconds}.][] |cFFFFFFFFGenerates 1 Soul Shard.|r
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:2.265510
  • base_dd_min:1.00
  • base_dd_max:1.00
 
Cry Havoc 39562 3.0% 52.5 5.51sec 226412 0 Direct 105.1 99364 198659 113206 13.9%  

Stats details: cry_havoc

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 52.54 105.08 0.00 0.00 0.0000 0.0000 11895841.18 11895841.18 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 90.43 86.06% 99364.14 70953 148924 99413.69 92818 107888 8985688 8985688 0.00
crit 14.65 13.94% 198659.14 141907 297849 198775.20 163880 240231 2910153 2910153 0.00
 
 

Action details: cry_havoc

Static Values
  • id:243011
  • school:chromatic
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:243011
  • name:Cry Havoc
  • school:chromatic
  • tooltip:
  • description:Deals {$s2=0} Chaos damage to enemies within $A2 yards.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:1.000000
  • base_dd_min:0.00
  • base_dd_max:0.00
 
Deadly Grace 6090 0.5% 14.4 2.08sec 124494 0 Direct 14.4 109266 218418 124492 14.0%  

Stats details: deadly_grace

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 14.44 14.44 0.00 0.00 0.0000 0.0000 1798113.87 1798113.87 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 12.43 86.05% 109266.27 96891 116269 109278.82 100767 116269 1358002 1358002 0.00
crit 2.02 13.95% 218417.89 193782 232539 192222.34 0 232539 440112 440112 0.00
 
 

Action details: deadly_grace

Static Values
  • id:188091
  • school:arcane
  • resource:none
  • range:40.0
  • travel_speed:25.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:188091
  • name:Deadly Grace
  • school:arcane
  • tooltip:
  • description:Deal {$s1=63339 to 95008} Arcane damage.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:63338.72
  • base_dd_max:95008.08
 
Immolate 299843 22.9% 20.1 15.14sec 4482464 4278617 Direct 38.8 156956 313861 254087 61.9%  
Periodic 294.8 167906 336019 272040 61.9% 195.9%

Stats details: immolate

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 20.09 38.78 294.82 294.82 1.0476 2.0004 90056338.05 90056338.05 0.00 147438.53 4278617.35
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 14.78 38.10% 156956.04 103574 243123 156937.78 133852 185395 2319129 2319129 0.00
crit 24.01 61.90% 313860.88 207118 486831 313829.17 263112 352324 7535173 7535173 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 112.2 38.06% 167905.67 53 483663 168143.57 139764 204775 18838583 18838583 0.00
crit 182.6 61.94% 336019.27 50 967339 336536.57 289682 386363 61363454 61363454 0.00
 
 

Action details: immolate

Static Values
  • id:348
  • school:fire
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:66000.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:1.50
  • base_crit:0.48
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:remains<=tick_time
Spelldata
  • id:348
  • name:Immolate
  • school:fire
  • tooltip:
  • description:Burns the enemy, causing {$s1=1} Fire damage immediately and an additional $157736o1 Fire damage over {$157736d=18 seconds}. |cFFFFFFFFPeriodic damage has a {$193541s1=15}% chance to generate 1 Soul Shard. Chance doubled on critical strikes.|r
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:1.332000
  • base_dd_min:1.00
  • base_dd_max:1.00
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.721500
  • base_td:0.00
  • dot_duration:18.00
  • base_tick_time:3.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
 
Incinerate 143786 11.0% 76.5 3.76sec 565534 443529 Direct 146.1 259852 519636 296146 14.0%  

Stats details: incinerate

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 76.50 146.09 0.00 0.00 1.2751 0.0000 43264037.15 43264037.15 0.00 443529.01 443529.01
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 125.68 86.03% 259851.93 167403 393524 259920.27 242432 276512 32657968 32657968 0.00
crit 20.41 13.97% 519636.40 334815 787007 519786.78 440823 604583 10606069 10606069 0.00
 
 

Action details: incinerate

Static Values
  • id:29722
  • school:fire
  • resource:mana
  • range:40.0
  • travel_speed:20.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:66000.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:1.88
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:29722
  • name:Incinerate
  • school:fire
  • tooltip:
  • description:Draws fire toward the enemy, dealing {$s2=0} Fire damage.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:2.331000
  • base_dd_min:0.00
  • base_dd_max:0.00
 
Mark of the Hidden Satyr 10066 0.8% 20.0 15.00sec 151383 0 Direct 20.0 133008 266125 151384 13.8%  

Stats details: mark_of_the_hidden_satyr

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 19.99 19.99 0.00 0.00 0.0000 0.0000 3025991.00 3025991.00 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 17.23 86.20% 133008.21 126701 160060 133034.97 126701 145385 2291730 2291730 0.00
crit 2.76 13.80% 266124.61 253403 320120 248719.13 0 320120 734261 734261 0.00
 
 

Action details: mark_of_the_hidden_satyr

Static Values
  • id:191259
  • school:fire
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:191259
  • name:Mark of the Hidden Satyr
  • school:fire
  • tooltip:
  • description:Deals fire damage.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:2.500000
  • spell_power_mod.direct:2.000000
  • base_dd_min:0.00
  • base_dd_max:0.00
 
pet - imp 48071 / 48071
Firebolt 48071 3.7% 109.2 2.76sec 132316 109156 Direct 108.3 117013 233987 133344 14.0%  

Stats details: firebolt

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 109.18 108.33 0.00 0.00 1.2122 0.0000 14445762.32 14445762.32 0.00 109156.43 109156.43
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 93.21 86.04% 117012.79 74755 141656 117044.97 114561 119394 10906701 10906701 0.00
crit 15.13 13.96% 233986.93 149511 283311 234062.73 206563 260213 3539062 3539062 0.00
 
 

Action details: firebolt

Static Values
  • id:3110
  • school:fire
  • resource:energy
  • range:40.0
  • travel_speed:16.0000
  • trigger_gcd:0.5000
  • min_gcd:0.7500
  • base_cost:40.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:1.75
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:3110
  • name:Firebolt
  • school:fire
  • tooltip:
  • description:Deals {$s1=1} Fire damage to a target.$?a231795[ Damage increased by {$231795s1=50}% if you have Immolated the target.][] |cFF777777(Right-Click to toggle)|r
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:1.000000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
pet - service_imp 139328 / 44583
Firebolt 139328 3.4% 49.4 5.50sec 270442 237775 Direct 49.1 238675 477322 272037 14.0%  

Stats details: firebolt

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 49.40 49.11 0.00 0.00 1.1374 0.0000 13360354.52 13360354.52 0.00 237775.27 237775.27
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 42.25 86.02% 238674.61 149511 283311 238908.27 228757 247517 10083000 10083000 0.00
crit 6.87 13.98% 477321.67 299021 566623 477158.12 0 566623 3277355 3277355 0.00
 
 

Action details: firebolt

Static Values
  • id:3110
  • school:fire
  • resource:energy
  • range:40.0
  • travel_speed:16.0000
  • trigger_gcd:0.5000
  • min_gcd:0.7500
  • base_cost:40.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:1.75
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:3110
  • name:Firebolt
  • school:fire
  • tooltip:
  • description:Deals {$s1=1} Fire damage to a target.$?a231795[ Damage increased by {$231795s1=50}% if you have Immolated the target.][] |cFF777777(Right-Click to toggle)|r
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:1.000000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
pet - infernal 131738 / 11156
Immolation 102648 0.7% 1.0 0.00sec 2566299 0 Periodic 46.6 48293 96534 55018 13.9% 8.1%

Stats details: immolation

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 23.32 46.64 0.0000 1.0421 2566299.45 2566299.45 0.00 105595.99 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 40.1 86.06% 48293.46 41682 50019 48299.72 47111 49444 1938597 1938597 0.00
crit 6.5 13.94% 96533.61 83365 100037 96403.81 0 100037 627703 627703 0.00
 
 

Action details: immolation

Static Values
  • id:19483
  • school:fire
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:!ticking
Spelldata
  • id:19483
  • name:Immolation
  • school:fire
  • tooltip:Burns nearby enemies for {$20153s1=0} fire damage every $t1 seconds.
  • description:Burns nearby enemies for {$20153s1=0} fire damage every $t1 seconds.
 

Action details: immolation_tick

Static Values
  • id:20153
  • school:fire
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:20153
  • name:Immolation
  • school:fire
  • tooltip:
  • description:Deals Fire damage to all enemies near the caster.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.650000
  • base_dd_min:0.00
  • base_dd_max:0.00
 
melee 29090 0.2% 22.1 1.10sec 32938 30037 Direct 22.1 28925 57820 32938 13.9%  

Stats details: melee

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 22.08 22.08 0.00 0.00 1.0966 0.0000 727276.68 1069165.61 31.98 30036.62 30036.62
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 19.01 86.11% 28925.12 24926 29911 28925.62 28131 29911 549979 808522 31.98
crit 3.07 13.89% 57819.68 49852 59823 55764.57 0 59823 177297 260644 30.83
 
 

Action details: melee

Static Values
  • id:0
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Weapon
  • normalized:false
  • weapon_power_mod:0.285714
  • weapon_multiplier:1.00
 
pet - doomguard 108977 / 9218
Doom Bolt 108977 0.7% 11.0 2.19sec 246663 114969 Direct 11.0 216250 432331 246673 14.1%  

Stats details: doom_bolt

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 11.05 11.05 0.00 0.00 2.1455 0.0000 2724538.23 2724538.23 0.00 114969.12 114969.12
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 9.49 85.92% 216250.34 209059 250871 216245.20 209059 250871 2052180 2052180 0.00
crit 1.56 14.08% 432330.75 418118 501741 351446.16 0 501741 672358 672358 0.00
 
 

Action details: doom_bolt

Static Values
  • id:85692
  • school:shadow
  • resource:energy
  • range:30.0
  • travel_speed:20.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:35.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:3.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:85692
  • name:Doom Bolt
  • school:shadow
  • tooltip:
  • description:Sends a shadowy bolt at the enemy, causing {$s1=1} Shadow damage. Deals {$s2=20}% additional damage to targets below 20% health.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:2.750000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
pet - lord_of_flames_infernal 131760 / 11159
Immolation 102636 0.7% 1.0 0.00sec 2566008 0 Periodic 46.6 48289 96586 55012 13.9% 8.1%

Stats details: immolation

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 23.32 46.64 0.0000 1.0421 2566007.64 2566007.64 0.00 105583.99 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 40.2 86.08% 48289.23 41682 50019 48295.45 46864 49409 1938889 1938889 0.00
crit 6.5 13.92% 96585.84 83365 100037 96499.85 0 100037 627119 627119 0.00
 
 

Action details: immolation

Static Values
  • id:19483
  • school:fire
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:!ticking
Spelldata
  • id:19483
  • name:Immolation
  • school:fire
  • tooltip:Burns nearby enemies for {$20153s1=0} fire damage every $t1 seconds.
  • description:Burns nearby enemies for {$20153s1=0} fire damage every $t1 seconds.
 

Action details: immolation_tick

Static Values
  • id:20153
  • school:fire
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:20153
  • name:Immolation
  • school:fire
  • tooltip:
  • description:Deals Fire damage to all enemies near the caster.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.650000
  • base_dd_min:0.00
  • base_dd_max:0.00
 
melee 29124 0.2% 22.1 1.10sec 32976 30071 Direct 22.1 28923 57848 32976 14.0%  

Stats details: melee

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 22.08 22.08 0.00 0.00 1.0966 0.0000 728120.76 1070406.49 31.98 30071.48 30071.48
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 18.99 85.99% 28922.86 24926 29911 28923.36 28131 29911 549135 807281 31.98
crit 3.09 14.01% 57847.79 49852 59823 55955.49 0 59823 178985 263126 30.93
 
 

Action details: melee

Static Values
  • id:0
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Weapon
  • normalized:false
  • weapon_power_mod:0.285714
  • weapon_multiplier:1.00
 
pet - lord_of_flames_infernal 131715 / 11155
Immolation 102616 0.7% 1.0 0.00sec 2565502 0 Periodic 46.6 48286 96626 55001 13.9% 8.1%

Stats details: immolation

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 23.32 46.64 0.0000 1.0421 2565502.40 2565502.40 0.00 105563.20 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 40.2 86.11% 48285.96 41682 50019 48292.30 46947 49437 1939394 1939394 0.00
crit 6.5 13.89% 96626.40 83365 100037 96565.32 0 100037 626109 626109 0.00
 
 

Action details: immolation

Static Values
  • id:19483
  • school:fire
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:!ticking
Spelldata
  • id:19483
  • name:Immolation
  • school:fire
  • tooltip:Burns nearby enemies for {$20153s1=0} fire damage every $t1 seconds.
  • description:Burns nearby enemies for {$20153s1=0} fire damage every $t1 seconds.
 

Action details: immolation_tick

Static Values
  • id:20153
  • school:fire
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:20153
  • name:Immolation
  • school:fire
  • tooltip:
  • description:Deals Fire damage to all enemies near the caster.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.650000
  • base_dd_min:0.00
  • base_dd_max:0.00
 
melee 29099 0.2% 22.1 1.10sec 32948 30046 Direct 22.1 28925 57819 32947 13.9%  

Stats details: melee

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 22.08 22.08 0.00 0.00 1.0966 0.0000 727499.04 1069492.51 31.98 30045.80 30045.80
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 19.01 86.08% 28925.15 24926 29911 28925.78 28131 29911 549757 808195 31.98
crit 3.07 13.92% 57819.44 49852 59823 55649.53 0 59823 177742 261298 30.78
 
 

Action details: melee

Static Values
  • id:0
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Weapon
  • normalized:false
  • weapon_power_mod:0.285714
  • weapon_multiplier:1.00
 
pet - lord_of_flames_infernal 131706 / 11154
Immolation 102621 0.7% 1.0 0.00sec 2565629 0 Periodic 46.6 48292 96552 55004 13.9% 8.1%

Stats details: immolation

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 23.32 46.64 0.0000 1.0421 2565629.13 2565629.13 0.00 105568.41 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 40.2 86.09% 48291.96 41682 50019 48297.81 47026 49542 1939267 1939267 0.00
crit 6.5 13.91% 96552.09 83365 100037 96442.47 0 100037 626362 626362 0.00
 
 

Action details: immolation

Static Values
  • id:19483
  • school:fire
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:!ticking
Spelldata
  • id:19483
  • name:Immolation
  • school:fire
  • tooltip:Burns nearby enemies for {$20153s1=0} fire damage every $t1 seconds.
  • description:Burns nearby enemies for {$20153s1=0} fire damage every $t1 seconds.
 

Action details: immolation_tick

Static Values
  • id:20153
  • school:fire
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:20153
  • name:Immolation
  • school:fire
  • tooltip:
  • description:Deals Fire damage to all enemies near the caster.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.650000
  • base_dd_min:0.00
  • base_dd_max:0.00
 
melee 29085 0.2% 22.1 1.10sec 32932 30032 Direct 22.1 28924 57835 32932 13.9%  

Stats details: melee

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 22.08 22.08 0.00 0.00 1.0966 0.0000 727153.53 1068984.57 31.98 30031.53 30031.53
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 19.02 86.14% 28923.88 24926 29911 28924.16 28250 29911 550103 808703 31.98
crit 3.06 13.86% 57835.03 49852 59823 55821.84 0 59823 177051 260282 30.87
 
 

Action details: melee

Static Values
  • id:0
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Weapon
  • normalized:false
  • weapon_power_mod:0.285714
  • weapon_multiplier:1.00
 
pet - shadowy_tear 133391 / 17946
Shadow Bolt 133391 1.4% 3.3 70.21sec 1603939 0 Periodic 37.1 127225 254319 144908 13.9% 15.1%

Stats details: shadow_bolt

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 3.35 0.00 37.25 37.05 0.0000 1.2227 5369188.93 5369188.93 0.00 117884.97 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 31.9 86.09% 127225.21 79 153905 126563.76 0 153905 4058114 4058114 0.00
crit 5.2 13.91% 254318.86 141 307810 244529.35 0 307810 1311075 1311075 0.00
 
 

Action details: shadow_bolt

Static Values
  • id:196657
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:20.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:196657
  • name:Shadow Bolt
  • school:shadow
  • tooltip:
  • description:Sends a shadowy bolt at the enemy, causing {$s1=1} Shadow damage.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • dot_duration:14.00
  • base_tick_time:2.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
 
pet - flame_rift 281655 / 78096
Searing Bolt 281655 6.0% 65.7 2.63sec 355804 1095374 Direct 65.4 65704 0 65704 0.0%  
Periodic 139.3 120340 240481 137070 13.9% 45.8%

Stats details: searing_bolt

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 65.75 65.36 139.34 139.34 0.3248 0.9896 23392801.43 23392801.43 0.00 146902.80 1095373.73
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 65.36 100.00% 65703.71 60915 76953 65742.51 0 76953 4294276 4294276 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 119.9 86.07% 120339.74 122 153933 119766.97 0 138993 14432690 14432690 0.00
crit 19.4 13.93% 240481.22 244 307866 239155.20 0 307866 4665835 4665835 0.00
 
 

Action details: searing_bolt

Static Values
  • id:243050
  • school:fire
  • resource:energy
  • range:100.0
  • travel_speed:20.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:1.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:243050
  • name:Searing Bolt
  • school:fire
  • tooltip:Burning for $w2 Fire damage every $t2 sec.
  • description:Sends a searing bolt at the enemy, causing {$s1=1} Fire damage, and an additional $o2 Fire damage over {$d=30 seconds}, stacking up to {$u=20} times.
Direct Damage
  • may_crit:false
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:1.000000
  • base_dd_min:1.00
  • base_dd_max:1.00
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.100000
  • base_td:1.00
  • dot_duration:30.00
  • base_tick_time:1.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
 
pet - chaos_tear 154831 / 8234
Chaos Bolt 154831 0.6% 3.3 69.00sec 744248 377051 Direct 3.3 0 748802 748802 100.0%  

Stats details: chaos_bolt

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 3.32 3.30 0.00 0.00 1.9739 0.0000 2468175.37 2468175.37 0.00 377050.93 377050.93
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
crit 3.30 100.00% 748801.84 694073 876812 749402.60 0 876812 2468175 2468175 0.00
 
 

Action details: chaos_bolt

Static Values
  • id:215279
  • school:chromatic
  • resource:none
  • range:100.0
  • travel_speed:16.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:5.500
  • base_execute_time:3.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:215279
  • name:Chaos Bolt
  • school:chromatic
  • tooltip:
  • description:Unleashes a devastating blast of chaos, causing {$s1=1} Chaos damage. Chaos Bolt always critically strikes and your critical strike chance increases its damage.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:5.000000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
pet - chaos_portal 279226 / 16306
Chaos Barrage 279226 1.2% 3.4 70.66sec 1450983 0 Periodic 118.4 36134 72283 41172 13.9% 6.1%

Stats details: chaos_barrage

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 3.36 0.00 118.87 118.37 0.0000 0.1535 4873576.93 4873576.93 0.00 267030.68 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 101.9 86.07% 36134.20 148 42325 35977.20 0 42325 3681263 3681263 0.00
crit 16.5 13.93% 72282.58 302 84650 71862.83 0 84650 1192314 1192314 0.00
 
 

Action details: chaos_barrage

Static Values
  • id:187394
  • school:magic
  • resource:none
  • range:100.0
  • travel_speed:24.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:187394
  • name:Chaos Barrage
  • school:magic
  • tooltip:
  • description:Deals {$s1=1} Chaos damage.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • dot_duration:5.50
  • base_tick_time:0.25
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
 
Simple Action Stats Execute Interval
Destro_7.2_NoLeggos
augmentation 1.0 0.00sec

Stats details: augmentation

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: augmentation

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Destro_7.2_NoLeggos
  • harmful:false
  • if_expr:
 
Berserking 2.1 180.68sec

Stats details: berserking

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.06 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: berserking

Static Values
  • id:26297
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:180.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:26297
  • name:Berserking
  • school:physical
  • tooltip:Haste increased by {$s1=15}%.
  • description:Increases your haste by {$s1=15}% for {$d=10 seconds}.
 
Dimensional Rift 13.0 23.51sec

Stats details: dimensional_rift

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 12.96 0.00 0.00 0.00 1.0055 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: dimensional_rift

Static Values
  • id:196586
  • school:none
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:45.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:charges=3
Spelldata
  • id:196586
  • name:Dimensional Rift
  • school:chaos
  • tooltip:
  • description:Rips a hole in time and space, opening a portal that damages your target.
 
flask 1.0 0.00sec

Stats details: flask

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: flask

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Destro_7.2_NoLeggos
  • harmful:false
  • if_expr:
 
food 1.0 0.00sec

Stats details: food

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: food

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Destro_7.2_NoLeggos
  • harmful:false
  • if_expr:
 
Havoc 14.9 20.92sec

Stats details: havoc

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 14.89 0.00 0.00 0.00 1.0629 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: havoc

Static Values
  • id:80240
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:88000.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:active_enemies>1&(active_enemies<4|talent.wreak_havoc.enabled&active_enemies<6)&!debuff.havoc.remains
Spelldata
  • id:80240
  • name:Havoc
  • school:shadow
  • tooltip:Spells cast by the Warlock also hit this target.
  • description:Marks a target with Havoc for {$d=8 seconds}, causing your single target spells to also strike the Havoc victim. Limit 1.
 
Life Tap 6.8 32.86sec

Stats details: life_tap

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 6.81 0.00 0.00 0.00 1.0361 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: life_tap

Static Values
  • id:1454
  • school:shadow
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:talent.empowered_life_tap.enabled&!buff.empowered_life_tap.remains
Spelldata
  • id:1454
  • name:Life Tap
  • school:shadow
  • tooltip:
  • description:Restores {$s1=30}% of your maximum mana, at the cost of {$s2=10}% of your maximum health.
 
potion 2.0 0.00sec

Stats details: potion

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: potion

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:60.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
 
Grimoire: Imp (service_imp) 3.7 91.34sec

Stats details: service_imp

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 3.69 0.00 0.00 0.00 0.9668 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: service_imp

Static Values
  • id:111859
  • school:shadow
  • resource:soul_shard
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:1.0
  • secondary_cost:0.0
  • cooldown:90.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:111859
  • name:Grimoire: Imp
  • school:shadow
  • tooltip:
  • description:Summons an Imp who attacks the target for {$108501s1=25} sec. Imps cast ranged Firebolts and cleanse a hostile magic effect from their master.
 
Soul Harvest 2.9 120.88sec

Stats details: soul_harvest

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.90 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: soul_harvest

Static Values
  • id:196098
  • school:shadow
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:120.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:196098
  • name:Soul Harvest
  • school:shadow
  • tooltip:Damage increased by {$s1=20}%.
  • description:Increases your damage and your pets' damage by {$s1=20}%. Lasts {$d=15 seconds}, increased by {$s2=2} sec for each target afflicted by your {$?s137043=false}[Agony][]{$?s137044=false}[Doom][]{$?s137046=false}[Immolate][], up to a maximum of {$s3=35} sec.
 
Summon Doomguard 1.0 0.00sec

Stats details: summon_doomguard

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 1.0744 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: summon_doomguard

Static Values
  • id:18540
  • school:shadow
  • resource:soul_shard
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:1.0
  • secondary_cost:0.0
  • cooldown:180.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:talent.grimoire_of_supremacy.enabled&active_enemies=1&artifact.lord_of_flames.rank=0
Spelldata
  • id:18540
  • name:Summon Doomguard
  • school:shadow
  • tooltip:
  • description:Summons a Doomguard for {$60478d=25 seconds} to assault the target with its Doom Bolts.
 
Summon Imp 1.0 0.00sec

Stats details: summon_imp

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: summon_imp

Static Values
  • id:688
  • school:shadow
  • resource:soul_shard
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:1.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:2.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:!talent.grimoire_of_supremacy.enabled&(!talent.grimoire_of_sacrifice.enabled|buff.demonic_power.down)
Spelldata
  • id:688
  • name:Summon Imp
  • school:shadow
  • tooltip:
  • description:Summons an Imp under your command that casts ranged Firebolts.$?s74434[ |cFFFFFFFFSoulburn:|r |cFF8282FFInstant cast.|r][]
 
Summon Infernal 1.0 0.00sec

Stats details: summon_infernal

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.7567 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: summon_infernal

Static Values
  • id:1122
  • school:shadow
  • resource:soul_shard
  • range:30.0
  • travel_speed:1.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:1.0
  • secondary_cost:0.0
  • cooldown:180.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:talent.grimoire_of_supremacy.enabled&artifact.lord_of_flames.rank>0
Spelldata
  • id:1122
  • name:Summon Infernal
  • school:shadow
  • tooltip:
  • description:Summons an Infernal from the Twisting Nether, impacting for {$22703s1=0} Fire damage and stunning all enemy targets in the area for {$22703d=2 seconds}. The Infernal will serve you for {$111685d=25 seconds}, dealing strong area-of-effect damage.
 

Buffs

Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit Overflow Expiry
Accelerando 20.1 0.0 15.4sec 15.4sec 78.48% 78.48% 1.5(1.5) 19.3

Buff details

  • buff initial source:Destro_7.2_NoLeggos
  • cooldown name:buff_accelerando
  • max_stacks:5
  • duration:12.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00

Stat Buff details

  • stat:haste_rating
  • amount:734.41

Stack Uptimes

  • accelerando_1:29.70%
  • accelerando_2:24.51%
  • accelerando_3:14.65%
  • accelerando_4:6.59%
  • accelerando_5:3.03%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:225719
  • name:Accelerando
  • tooltip:Haste increased by $w1.
  • description:{$@spelldesc225125=Your damaging spells have a chance to grant you {$225719s1=528} Haste for {$225719d=12 seconds}, stacking up to 5 times. Stacking does not refresh duration.}
  • max_stacks:5
  • duration:12.00
  • cooldown:0.00
  • default_chance:101.00%
Berserking 2.1 0.0 180.7sec 180.7sec 6.86% 8.53% 0.0(0.0) 2.0

Buff details

  • buff initial source:Destro_7.2_NoLeggos
  • cooldown name:buff_berserking
  • max_stacks:1
  • duration:10.00
  • cooldown:180.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • berserking_1:6.86%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:26297
  • name:Berserking
  • tooltip:Haste increased by {$s1=15}%.
  • description:Increases your haste by {$s1=15}% for {$d=10 seconds}.
  • max_stacks:0
  • duration:10.00
  • cooldown:180.00
  • default_chance:0.00%
Bloodlust 1.0 0.0 0.0sec 0.0sec 13.55% 13.55% 0.0(0.0) 1.0

Buff details

  • buff initial source:Destro_7.2_NoLeggos
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • duration:40.00
  • cooldown:300.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • bloodlust_1:13.55%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:2825
  • name:Bloodlust
  • tooltip:Haste increased by {$s1=30}%.
  • description:Increases Haste by {$s1=30}% for all party and raid members for {$d=40 seconds}. Allies receiving this effect will become Sated and unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.
  • max_stacks:0
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
Conflagration of Chaos 24.3 0.0 12.3sec 12.3sec 49.19% 47.24% 0.0(0.0) 0.8

Buff details

  • buff initial source:Destro_7.2_NoLeggos
  • cooldown name:buff_conflagration_of_chaos
  • max_stacks:1
  • duration:20.00
  • cooldown:0.00
  • default_chance:50.00%
  • default_value:-0.00

Stack Uptimes

  • conflagration_of_chaos_1:49.19%

Trigger Attempt Success

  • trigger_pct:49.97%

Spelldata details

  • id:196546
  • name:Conflagration of Chaos
  • tooltip:Your {$?s17877=false}[Shadowburn][Conflagrate] will always critically strike. Critical strike chance will increase the critical strike damage of {$?s17877=false}[Shadowburn][Conflagrate].
  • description:{$@spelldesc219195={$?s17877=false}[Shadowburn][Conflagrate] has a chance to guarantee your next {$?s17877=false}[Shadowburn][Conflagrate] critically strikes, and to increase its damage by your critical strike chance.}
  • max_stacks:0
  • duration:20.00
  • cooldown:0.00
  • default_chance:100.00%
Devil's Due 3.5 0.0 69.6sec 69.6sec 8.76% 8.76% 0.0(0.0) 3.3

Buff details

  • buff initial source:Destro_7.2_NoLeggos
  • cooldown name:buff_devils_due
  • max_stacks:1
  • duration:8.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.18

Stack Uptimes

  • devils_due_1:8.76%

Trigger Attempt Success

  • trigger_pct:99.93%

Spelldata details

  • id:225776
  • name:Devil's Due
  • tooltip:Cast speed slowed by {$s1=7}%.
  • description:{$@spelldesc225142=Your damaging spells have a chance to grant Nefarious Pact, increasing your casting speed by {$225774s1=17}% for {$225774d=12 seconds}. When Nefarious Pact expires, your casting speed is decreased by {$225776s1=7}% for {$225776d=8 seconds}.}
  • max_stacks:0
  • duration:8.00
  • cooldown:0.00
  • default_chance:0.00%
Embrace Chaos 33.4 28.2 9.1sec 4.8sec 66.97% 80.24% 28.2(28.2) 32.7

Buff details

  • buff initial source:Destro_7.2_NoLeggos
  • cooldown name:buff_embrace_chaos
  • max_stacks:1
  • duration:4.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • embrace_chaos_1:66.97%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:212019
  • name:Embrace Chaos
  • tooltip:Chaos Bolt has {$s1=40}% reduced cast time.
  • description:{$@spelldesc212018=Casting Chaos Bolt reduces the cast time of your next Chaos Bolt by {$212019s1=40}% for {$212019d=4 seconds}.}
  • max_stacks:0
  • duration:4.00
  • cooldown:0.00
  • default_chance:0.00%
Lord of Flames 1.0 0.0 0.0sec 0.0sec 97.89% 97.89% 0.0(0.0) 0.0

Buff details

  • buff initial source:Destro_7.2_NoLeggos
  • cooldown name:buff_lord_of_flames
  • max_stacks:1
  • duration:600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • lord_of_flames_1:97.89%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:226802
  • name:Lord of Flames
  • tooltip:Recently activated Lord of Flames.
  • description:{$@spelldesc224103=Once every {$s2=10} minutes, {$?s152107=false}[your Infernal's Meteor Strike][Summon Infernal] will summon {$s3=3} additional Infernals to serve you for {$226804d=25 seconds}.}
  • max_stacks:0
  • duration:600.00
  • cooldown:0.00
  • default_chance:0.00%
Nefarious Pact 3.5 0.0 69.9sec 69.2sec 13.61% 13.61% 0.0(0.0) 3.3

Buff details

  • buff initial source:Destro_7.2_NoLeggos
  • cooldown name:buff_nefarious_pact
  • max_stacks:1
  • duration:12.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.44

Stack Uptimes

  • nefarious_pact_1:13.61%

Trigger Attempt Success

  • trigger_pct:99.93%

Spelldata details

  • id:225774
  • name:Nefarious Pact
  • tooltip:Cast speed increased by {$s1=17}%.
  • description:{$@spelldesc225142=Your damaging spells have a chance to grant Nefarious Pact, increasing your casting speed by {$225774s1=17}% for {$225774d=12 seconds}. When Nefarious Pact expires, your casting speed is decreased by {$225776s1=7}% for {$225776d=8 seconds}.}
  • max_stacks:0
  • duration:12.00
  • cooldown:0.00
  • default_chance:0.00%
Potion of Deadly Grace 1.0 0.0 0.0sec 0.0sec 10.16% 10.16% 0.0(0.0) 1.0

Buff details

  • buff initial source:Destro_7.2_NoLeggos
  • cooldown name:buff_potion_of_deadly_grace
  • max_stacks:1
  • duration:30.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • potion_of_deadly_grace_1:10.16%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:188027
  • name:Potion of Deadly Grace
  • tooltip:Your attacks have a chance to unleash a bolt of energy at your target.
  • description:Grants your attacks a chance to unleash a bolt of energy at your target. Staying away from enemies for the entire duration of the effect will extend the effect by an additional 5 seconds.
  • max_stacks:0
  • duration:25.00
  • cooldown:1.00
  • default_chance:101.00%
Potion of Prolonged Power 1.0 0.0 0.0sec 0.0sec 19.64% 19.64% 0.0(0.0) 1.0

Buff details

  • buff initial source:Destro_7.2_NoLeggos
  • cooldown name:buff_potion_of_prolonged_power
  • max_stacks:1
  • duration:60.00
  • cooldown:1.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:all
  • amount:2500.00

Stack Uptimes

  • potion_of_prolonged_power_1:19.64%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:229206
  • name:Potion of Prolonged Power
  • tooltip:All stats increased by {$s1=2500}.
  • description:Drink to increase all stats by {$s1=2500} for {$d=60 seconds}.
  • max_stacks:0
  • duration:60.00
  • cooldown:1.00
  • default_chance:0.00%
Soul Harvest 2.9 0.0 120.9sec 120.9sec 17.80% 17.80% 0.0(0.0) 2.7

Buff details

  • buff initial source:Destro_7.2_NoLeggos
  • cooldown name:buff_soul_harvest
  • max_stacks:1
  • duration:15.00
  • cooldown:120.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • soul_harvest_1:17.80%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:196098
  • name:Soul Harvest
  • tooltip:Damage increased by {$s1=20}%.
  • description:Increases your damage and your pets' damage by {$s1=20}%. Lasts {$d=15 seconds}, increased by {$s2=2} sec for each target afflicted by your {$?s137043=false}[Agony][]{$?s137044=false}[Doom][]{$?s137046=false}[Immolate][], up to a maximum of {$s3=35} sec.
  • max_stacks:0
  • duration:15.00
  • cooldown:120.00
  • default_chance:0.00%
Constant Buffs
Well Fed (azshari_salad)

Buff details

  • buff initial source:Destro_7.2_NoLeggos
  • cooldown name:buff_azshari_salad
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:haste_rating
  • amount:375.00

Stack Uptimes

  • azshari_salad_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:225603
  • name:Well Fed
  • tooltip:Haste increased by $w1.
  • description:Increases haste by {$s1=375} for {$d=3600 seconds}.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Defiled Augmentation

Buff details

  • buff initial source:Destro_7.2_NoLeggos
  • cooldown name:buff_defiled_augmentation
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:agility
  • amount:325.00
  • stat:strength
  • amount:325.00
  • stat:intellect
  • amount:325.00

Stack Uptimes

  • defiled_augmentation_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:224001
  • name:Defiled Augmentation
  • tooltip:Agility, Intellect and Strength increased by $w1.
  • description:Increases Agility, Intellect and Strength by {$s1=325} for {$d=3600 seconds}. Augment Rune.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Flask of the Whispered Pact

Buff details

  • buff initial source:Destro_7.2_NoLeggos
  • cooldown name:buff_flask_of_the_whispered_pact
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:intellect
  • amount:1300.00

Stack Uptimes

  • flask_of_the_whispered_pact_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:188031
  • name:Flask of the Whispered Pact
  • tooltip:Intellect increased by $w1.
  • description:Increases Intellect by {$s1=1300} for {$d=3600 seconds}. Counts as both a Battle and Guardian elixir. This effect persists through death.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:101.00%
Tormented Souls

Buff details

  • buff initial source:Destro_7.2_NoLeggos
  • cooldown name:buff_tormented_souls
  • max_stacks:12
  • duration:0.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00

Stack Uptimes

  • tormented_souls_2:0.37%
  • tormented_souls_3:99.63%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:216695
  • name:Tormented Souls
  • tooltip:Activate Reap Souls to consume all Tormented Souls collected by |cFFFFCC99Ulthalesh|r, increasing your damage by 10% and doubling the effect of all of |cFFFFCC99Ulthalesh|r's other traits for {$216708d=5 seconds} per soul consumed.
  • description:Activate Reap Souls to consume all Tormented Souls collected by |cFFFFCC99Ulthalesh|r, increasing your damage by 10% and doubling the effect of all of |cFFFFCC99Ulthalesh|r's other traits for {$216708d=5 seconds} per soul consumed.
  • max_stacks:12
  • duration:-0.00
  • cooldown:0.00
  • default_chance:101.00%

Procs

Count Interval
shadowy_tear 3.2 69.9sec
flame_rift 3.2 71.3sec
chaos_tear 3.2 69.9sec
chaos_portal 3.3 70.5sec
dimension_ripper 3.8 55.7sec
t19_2pc_chaos_bolt 43.3 6.7sec

Resources

Resource Usage Type Count Total Average RPE APR
Destro_7.2_NoLeggos
chaos_bolt Soul Shard 61.6 123.3 2.0 2.0 935174.5
havoc Mana 14.9 1310613.2 88000.0 88000.3 0.0
immolate Mana 20.1 1325984.4 66000.0 65999.6 67.9
incinerate Mana 76.5 5049029.7 66000.0 65999.4 8.6
service_imp Soul Shard 3.7 3.7 1.0 1.0 0.0
summon_doomguard Soul Shard 1.0 1.0 1.0 1.0 0.0
summon_infernal Soul Shard 1.0 1.0 1.0 1.0 0.0
pet - imp
firebolt Energy 109.2 4367.1 40.0 40.0 3307.9
pet - service_imp
firebolt Energy 49.4 1976.1 40.0 40.0 6760.9
pet - doomguard
doom_bolt Energy 11.0 386.6 35.0 35.0 7047.6
pet - flame_rift
searing_bolt Energy 63.8 63.8 1.0 1.0 366489.7
Resource Gains Type Count Total Average Overflow
life_tap Mana 6.81 2248209.54 (32.97%) 330000.00 0.00 0.00%
immolate Soul Shard 71.59 70.53 (55.00%) 0.99 1.06 1.48%
conflagrate Soul Shard 48.54 48.44 (37.78%) 1.00 0.10 0.21%
mp5_regen Mana 522.92 4570682.58 (67.03%) 8740.64 76179.38 1.64%
soulsnatcher Soul Shard 9.26 9.26 (7.22%) 1.00 0.00 0.00%
pet - imp
energy_regen Energy 1902.01 4200.68 (100.00%) 2.21 21.57 0.51%
pet - service_imp
energy_regen Energy 446.83 1357.40 (100.00%) 3.04 61.93 4.36%
pet - doomguard
energy_regen Energy 16.01 345.45 (100.00%) 21.57 42.90 11.05%
Resource RPS-Gain RPS-Loss
Health 0.00 7278.59
Mana 22653.67 25533.10
Soul Shard 0.43 0.43
Combat End Resource Mean Min Max
Mana 232355.20 4453.00 485971.23
Soul Shard 2.29 0.00 5.00

Benefits & Uptimes

Benefits %
Uptimes %
Mana Cap 1.1%

Statistics & Data Analysis

Fight Length
Sample Data Destro_7.2_NoLeggos Fight Length
Count 9999
Mean 301.01
Minimum 217.68
Maximum 385.07
Spread ( max - min ) 167.39
Range [ ( max - min ) / 2 * 100% ] 27.80%
DPS
Sample Data Destro_7.2_NoLeggos Damage Per Second
Count 9999
Mean 1308303.41
Minimum 1145958.55
Maximum 1529934.13
Spread ( max - min ) 383975.58
Range [ ( max - min ) / 2 * 100% ] 14.67%
Standard Deviation 55753.6368
5th Percentile 1221282.04
95th Percentile 1406267.80
( 95th Percentile - 5th Percentile ) 184985.76
Mean Distribution
Standard Deviation 557.5642
95.00% Confidence Intervall ( 1307210.60 - 1309396.21 )
Normalized 95.00% Confidence Intervall ( 99.92% - 100.08% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 70
0.1% Error 6977
0.1 Scale Factor Error with Delta=300 26535671
0.05 Scale Factor Error with Delta=300 106142684
0.01 Scale Factor Error with Delta=300 2653567086
Priority Target DPS
Sample Data Destro_7.2_NoLeggos Priority Target Damage Per Second
Count 9999
Mean 783484.94
Minimum 660517.48
Maximum 968021.24
Spread ( max - min ) 307503.76
Range [ ( max - min ) / 2 * 100% ] 19.62%
Standard Deviation 42808.3272
5th Percentile 718645.39
95th Percentile 858676.80
( 95th Percentile - 5th Percentile ) 140031.41
Mean Distribution
Standard Deviation 428.1047
95.00% Confidence Intervall ( 782645.87 - 784324.01 )
Normalized 95.00% Confidence Intervall ( 99.89% - 100.11% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 115
0.1% Error 11469
0.1 Scale Factor Error with Delta=300 15643726
0.05 Scale Factor Error with Delta=300 62574902
0.01 Scale Factor Error with Delta=300 1564372542
DPS(e)
Sample Data Destro_7.2_NoLeggos Damage Per Second (Effective)
Count 9999
Mean 1308303.41
Minimum 1145958.55
Maximum 1529934.13
Spread ( max - min ) 383975.58
Range [ ( max - min ) / 2 * 100% ] 14.67%
Damage
Sample Data Destro_7.2_NoLeggos Damage
Count 9999
Mean 313987712.16
Minimum 219300353.96
Maximum 414202037.28
Spread ( max - min ) 194901683.32
Range [ ( max - min ) / 2 * 100% ] 31.04%
DTPS
Sample Data Destro_7.2_NoLeggos Damage Taken Per Second
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HPS
Sample Data Destro_7.2_NoLeggos Healing Per Second
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
HPS(e)
Sample Data Destro_7.2_NoLeggos Healing Per Second (Effective)
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
Sample Data Destro_7.2_NoLeggos Heal
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
Sample Data Destro_7.2_NoLeggos Healing Taken Per Second
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
TMI
Sample Data Destro_7.2_NoLeggos Theck-Meloree Index
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
ETMI
Sample Data Destro_7.2_NoLeggosTheck-Meloree Index (Effective)
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
MSD
Sample Data Destro_7.2_NoLeggos Max Spike Value
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 flask,type=whispered_pact
1 0.00 food,type=azshari_salad
2 0.00 summon_pet,if=!talent.grimoire_of_supremacy.enabled&(!talent.grimoire_of_sacrifice.enabled|buff.demonic_power.down)
3 0.00 summon_infernal,if=talent.grimoire_of_supremacy.enabled&artifact.lord_of_flames.rank>0
4 0.00 summon_infernal,if=talent.grimoire_of_supremacy.enabled&active_enemies>1
5 0.00 summon_doomguard,if=talent.grimoire_of_supremacy.enabled&active_enemies=1&artifact.lord_of_flames.rank=0
6 0.00 augmentation,type=defiled
7 0.00 snapshot_stats
8 0.00 grimoire_of_sacrifice,if=talent.grimoire_of_sacrifice.enabled
9 0.00 life_tap,if=talent.empowered_life_tap.enabled&!buff.empowered_life_tap.remains
A 0.00 potion,name=prolonged_power
B 0.00 chaos_bolt
Default action list Executed every time the actor is available.
# count action,conditions
C 14.89 havoc,target=2,if=active_enemies>1&(active_enemies<4|talent.wreak_havoc.enabled&active_enemies<6)&!debuff.havoc.remains
D 1.00 dimensional_rift,if=charges=3
E 10.34 immolate,if=remains<=tick_time
F 0.69 immolate,cycle_targets=1,if=active_enemies>1&remains<=tick_time&(!talent.roaring_blaze.enabled|(!debuff.roaring_blaze.remains&action.conflagrate.charges<2+set_bonus.tier19_4pc))
G 9.10 immolate,if=talent.roaring_blaze.enabled&remains<=duration&!debuff.roaring_blaze.remains&target.time_to_die>10&(action.conflagrate.charges=2+set_bonus.tier19_4pc|(action.conflagrate.charges>=1+set_bonus.tier19_4pc&action.conflagrate.recharge_time<cast_time+gcd)|target.time_to_die<24)
H 2.06 berserking
0.00 blood_fury
0.00 arcane_torrent
I 1.00 potion,name=deadly_grace,if=(buff.soul_harvest.remains|trinket.proc.any.react|target.time_to_die<=45)
0.00 shadowburn,if=buff.conflagration_of_chaos.remains<=action.chaos_bolt.cast_time
0.00 shadowburn,if=(charges=1+set_bonus.tier19_4pc&recharge_time<action.chaos_bolt.cast_time|charges=2+set_bonus.tier19_4pc)&soul_shard<5
J 14.00 conflagrate,if=talent.roaring_blaze.enabled&(charges=2+set_bonus.tier19_4pc|(charges>=1+set_bonus.tier19_4pc&recharge_time<gcd)|target.time_to_die<24)
K 34.54 conflagrate,if=talent.roaring_blaze.enabled&debuff.roaring_blaze.stack>0&dot.immolate.remains>dot.immolate.duration*0.3&(active_enemies=1|soul_shard<3)&soul_shard<5
0.00 conflagrate,if=!talent.roaring_blaze.enabled&buff.backdraft.stack<3&buff.conflagration_of_chaos.remains<=action.chaos_bolt.cast_time
0.00 conflagrate,if=!talent.roaring_blaze.enabled&buff.backdraft.stack<3&(charges=1+set_bonus.tier19_4pc&recharge_time<action.chaos_bolt.cast_time|charges=2+set_bonus.tier19_4pc)&soul_shard<5
0.00 life_tap,if=talent.empowered_life_tap.enabled&buff.empowered_life_tap.remains<=gcd
0.00 dimensional_rift,if=equipped.144369&!buff.lessons_of_spacetime.remains&((!talent.grimoire_of_supremacy.enabled&!cooldown.summon_doomguard.remains)|(talent.grimoire_of_service.enabled&!cooldown.service_pet.remains)|(talent.soul_harvest.enabled&!cooldown.soul_harvest.remains))
L 3.69 service_pet
M 1.00 summon_infernal,if=artifact.lord_of_flames.rank>0&!buff.lord_of_flames.remains
N 1.00 summon_doomguard,if=!talent.grimoire_of_supremacy.enabled&spell_targets.infernal_awakening<=2&(target.time_to_die>180|target.health.pct<=20|target.time_to_die<30)
0.00 summon_infernal,if=!talent.grimoire_of_supremacy.enabled&spell_targets.infernal_awakening>2
0.00 summon_doomguard,if=talent.grimoire_of_supremacy.enabled&spell_targets.summon_infernal=1&artifact.lord_of_flames.rank>0&buff.lord_of_flames.remains&!pet.doomguard.active
0.00 summon_doomguard,if=talent.grimoire_of_supremacy.enabled&spell_targets.summon_infernal=1&equipped.132379&!cooldown.sindorei_spite_icd.remains
0.00 summon_infernal,if=talent.grimoire_of_supremacy.enabled&spell_targets.summon_infernal>1&equipped.132379&!cooldown.sindorei_spite_icd.remains
O 2.90 soul_harvest
0.00 channel_demonfire,if=dot.immolate.remains>cast_time
0.00 havoc,if=active_enemies=1&talent.wreak_havoc.enabled&equipped.132375&!debuff.havoc.remains
0.00 rain_of_fire,if=active_enemies>=3&cooldown.havoc.remains<=12&!talent.wreak_havoc.enabled
0.00 rain_of_fire,if=active_enemies>=6&talent.wreak_havoc.enabled
P 11.96 dimensional_rift,if=!equipped.144369|charges>1|((!talent.grimoire_of_service.enabled|recharge_time<cooldown.service_pet.remains)&(!talent.soul_harvest.enabled|recharge_time<cooldown.soul_harvest.remains)&(!talent.grimoire_of_supremacy.enabled|recharge_time<cooldown.summon_doomguard.remains))
0.00 life_tap,if=talent.empowered_life_tap.enabled&buff.empowered_life_tap.remains<duration*0.3
0.00 cataclysm
Q 60.96 chaos_bolt,if=(cooldown.havoc.remains>12&cooldown.havoc.remains|active_enemies<3|talent.wreak_havoc.enabled&active_enemies<6)&(set_bonus.tier19_4pc=0|!talent.eradication.enabled|buff.embrace_chaos.remains<=cast_time|soul_shard>=3)
0.00 shadowburn
0.00 conflagrate,if=!talent.roaring_blaze.enabled&buff.backdraft.stack<3
0.00 immolate,if=!talent.roaring_blaze.enabled&remains<=duration*0.3
R 76.83 incinerate
S 6.81 life_tap

Sample Sequence

0126ABCDEGHJKLMOPPQQKQKQKRRKQRCRQRRERQRRGJKKQRKQRCQKRPQRRQRERRQRCGJKKQRKQRRQKQRRRRQSCERQRRPPQGJKKLQRPQQCKRRQSKQRRERRRRROIRSCGJQKPQQKQKQRKQRCQRERQRRRRSGJKQCKQKRRQRKPQHRRREQCLRQRJQKQRRSEQGJCQQKQKQKQRKQPRNRCEQRRRRRSGJKOQKQCKQRRKQQRRPRQERRGJJPPCQJQLRRJQRSREJQ

Sample Sequence Table

time list # name target resources buffs
Pre precombat 0 flask Destro_7.2_NoLeggos 1100000.0/1100000: 100% mana | 3.0/5: 60% soul_shard
Pre precombat 1 food Destro_7.2_NoLeggos 1100000.0/1100000: 100% mana | 3.0/5: 60% soul_shard
Pre precombat 2 summon_imp Fluffy_Pillow 1100000.0/1100000: 100% mana | 3.0/5: 60% soul_shard
Pre precombat 6 augmentation Destro_7.2_NoLeggos 1100000.0/1100000: 100% mana | 3.0/5: 60% soul_shard
Pre precombat A potion Fluffy_Pillow 1100000.0/1100000: 100% mana | 3.0/5: 60% soul_shard potion_of_prolonged_power
0:00.000 precombat B chaos_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 1.0/5: 20% soul_shard embrace_chaos, accelerando, potion_of_prolonged_power
0:00.000 default C havoc enemy2 1100000.0/1100000: 100% mana | 1.0/5: 20% soul_shard embrace_chaos, accelerando, potion_of_prolonged_power
0:01.139 default D dimensional_rift Fluffy_Pillow 1033522.3/1100000: 94% mana | 1.0/5: 20% soul_shard bloodlust, embrace_chaos, accelerando, potion_of_prolonged_power
0:02.018 default E immolate Fluffy_Pillow 1050131.8/1100000: 95% mana | 1.0/5: 20% soul_shard bloodlust, embrace_chaos, accelerando, potion_of_prolonged_power
0:02.894 default G immolate Fluffy_Pillow 1000685.4/1100000: 91% mana | 1.0/5: 20% soul_shard bloodlust, embrace_chaos, accelerando(2), potion_of_prolonged_power
0:03.758 default H berserking Fluffy_Pillow 951253.5/1100000: 86% mana | 1.0/5: 20% soul_shard bloodlust, embrace_chaos, accelerando(2), potion_of_prolonged_power
0:03.758 default J conflagrate Fluffy_Pillow 951253.5/1100000: 86% mana | 1.0/5: 20% soul_shard bloodlust, berserking, embrace_chaos, accelerando(2), potion_of_prolonged_power
0:04.512 default K conflagrate Fluffy_Pillow 967881.1/1100000: 88% mana | 2.0/5: 40% soul_shard bloodlust, berserking, accelerando(2), potion_of_prolonged_power
0:05.267 default L service_imp Fluffy_Pillow 984530.8/1100000: 90% mana | 4.0/5: 80% soul_shard bloodlust, berserking, conflagration_of_chaos, accelerando(2), potion_of_prolonged_power
0:06.021 default M summon_infernal Fluffy_Pillow 1001158.4/1100000: 91% mana | 3.0/5: 60% soul_shard bloodlust, berserking, conflagration_of_chaos, accelerando(2), potion_of_prolonged_power
0:06.774 default O soul_harvest Fluffy_Pillow 1017970.3/1100000: 93% mana | 3.0/5: 60% soul_shard bloodlust, berserking, lord_of_flames, conflagration_of_chaos, accelerando(3), potion_of_prolonged_power
0:06.774 default P dimensional_rift Fluffy_Pillow 1017970.3/1100000: 93% mana | 3.0/5: 60% soul_shard bloodlust, berserking, soul_harvest, lord_of_flames, conflagration_of_chaos, accelerando(3), potion_of_prolonged_power
0:07.529 default P dimensional_rift Fluffy_Pillow 1034863.0/1100000: 94% mana | 3.0/5: 60% soul_shard bloodlust, berserking, soul_harvest, lord_of_flames, conflagration_of_chaos, accelerando(3), potion_of_prolonged_power
0:08.283 default Q chaos_bolt Fluffy_Pillow 1051733.3/1100000: 96% mana | 3.0/5: 60% soul_shard bloodlust, berserking, soul_harvest, lord_of_flames, conflagration_of_chaos, accelerando(3), potion_of_prolonged_power
0:09.763 default Q chaos_bolt Fluffy_Pillow 1084847.4/1100000: 99% mana | 3.0/5: 60% soul_shard bloodlust, berserking, soul_harvest, lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(3), potion_of_prolonged_power
0:10.653 default K conflagrate Fluffy_Pillow 1100000.0/1100000: 100% mana | 2.0/5: 40% soul_shard bloodlust, berserking, soul_harvest, lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(3), potion_of_prolonged_power
0:11.406 default Q chaos_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 3.0/5: 60% soul_shard bloodlust, berserking, soul_harvest, lord_of_flames, embrace_chaos, accelerando(3), potion_of_prolonged_power
0:12.295 default K conflagrate Fluffy_Pillow 1100000.0/1100000: 100% mana | 2.0/5: 40% soul_shard bloodlust, berserking, soul_harvest, lord_of_flames, embrace_chaos, potion_of_prolonged_power
0:13.070 default Q chaos_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 3.0/5: 60% soul_shard bloodlust, berserking, soul_harvest, lord_of_flames, conflagration_of_chaos, embrace_chaos, potion_of_prolonged_power
0:14.000 default K conflagrate Fluffy_Pillow 1100000.0/1100000: 100% mana | 1.0/5: 20% soul_shard bloodlust, soul_harvest, lord_of_flames, conflagration_of_chaos, embrace_chaos, potion_of_prolonged_power
0:14.893 default R incinerate Fluffy_Pillow 1100000.0/1100000: 100% mana | 2.0/5: 40% soul_shard bloodlust, soul_harvest, lord_of_flames, embrace_chaos, potion_of_prolonged_power
0:16.007 default R incinerate Fluffy_Pillow 1034075.6/1100000: 94% mana | 2.0/5: 40% soul_shard bloodlust, soul_harvest, lord_of_flames, embrace_chaos, accelerando, potion_of_prolonged_power
0:17.106 default K conflagrate Fluffy_Pillow 988842.1/1100000: 90% mana | 2.0/5: 40% soul_shard bloodlust, soul_harvest, lord_of_flames, embrace_chaos, accelerando, potion_of_prolonged_power
0:18.217 default Q chaos_bolt Fluffy_Pillow 1009835.4/1100000: 92% mana | 3.0/5: 60% soul_shard bloodlust, soul_harvest, lord_of_flames, conflagration_of_chaos, accelerando, potion_of_prolonged_power
0:19.968 default R incinerate Fluffy_Pillow 1042922.0/1100000: 95% mana | 1.0/5: 20% soul_shard bloodlust, soul_harvest, lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando, potion_of_prolonged_power
0:21.067 default C havoc enemy2 997688.5/1100000: 91% mana | 2.0/5: 40% soul_shard bloodlust, soul_harvest, lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando, potion_of_prolonged_power
0:21.943 default R incinerate Fluffy_Pillow 926241.2/1100000: 84% mana | 2.0/5: 40% soul_shard bloodlust, soul_harvest, lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando, potion_of_prolonged_power
0:23.041 default Q chaos_bolt Fluffy_Pillow 881246.7/1100000: 80% mana | 2.0/5: 40% soul_shard bloodlust, soul_harvest, lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(2), potion_of_prolonged_power
0:24.078 default R incinerate Fluffy_Pillow 901132.3/1100000: 82% mana | 0.0/5: 0% soul_shard bloodlust, soul_harvest, lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(2), potion_of_prolonged_power
0:25.161 default R incinerate Fluffy_Pillow 855900.1/1100000: 78% mana | 0.0/5: 0% soul_shard bloodlust, soul_harvest, lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(2), potion_of_prolonged_power
0:26.241 default E immolate Fluffy_Pillow 810610.3/1100000: 74% mana | 1.0/5: 20% soul_shard bloodlust, lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(2), potion_of_prolonged_power
0:27.106 default R incinerate Fluffy_Pillow 761197.6/1100000: 69% mana | 1.0/5: 20% soul_shard bloodlust, lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(2), potion_of_prolonged_power
0:28.189 default Q chaos_bolt Fluffy_Pillow 715861.1/1100000: 65% mana | 2.0/5: 40% soul_shard bloodlust, lord_of_flames, conflagration_of_chaos, potion_of_prolonged_power
0:29.967 default R incinerate Fluffy_Pillow 748960.2/1100000: 68% mana | 0.0/5: 0% soul_shard bloodlust, lord_of_flames, conflagration_of_chaos, embrace_chaos, potion_of_prolonged_power
0:31.081 default R incinerate Fluffy_Pillow 703698.4/1100000: 64% mana | 0.0/5: 0% soul_shard bloodlust, lord_of_flames, conflagration_of_chaos, embrace_chaos, potion_of_prolonged_power
0:32.196 default G immolate Fluffy_Pillow 658455.2/1100000: 60% mana | 0.0/5: 0% soul_shard bloodlust, lord_of_flames, conflagration_of_chaos, embrace_chaos, potion_of_prolonged_power
0:33.087 default J conflagrate Fluffy_Pillow 609217.2/1100000: 55% mana | 0.0/5: 0% soul_shard bloodlust, lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando, potion_of_prolonged_power
0:33.965 default K conflagrate Fluffy_Pillow 625807.7/1100000: 57% mana | 1.0/5: 20% soul_shard bloodlust, lord_of_flames, accelerando, potion_of_prolonged_power
0:34.842 default K conflagrate Fluffy_Pillow 642379.3/1100000: 58% mana | 2.0/5: 40% soul_shard bloodlust, lord_of_flames, accelerando, potion_of_prolonged_power
0:35.719 default Q chaos_bolt Fluffy_Pillow 658951.0/1100000: 60% mana | 3.0/5: 60% soul_shard bloodlust, lord_of_flames, accelerando, potion_of_prolonged_power
0:37.468 default R incinerate Fluffy_Pillow 692000.6/1100000: 63% mana | 1.0/5: 20% soul_shard bloodlust, lord_of_flames, embrace_chaos, accelerando(2), potion_of_prolonged_power
0:38.553 default K conflagrate Fluffy_Pillow 646806.7/1100000: 59% mana | 1.0/5: 20% soul_shard bloodlust, lord_of_flames, embrace_chaos, accelerando(2), potion_of_prolonged_power
0:39.417 default Q chaos_bolt Fluffy_Pillow 663374.9/1100000: 60% mana | 3.0/5: 60% soul_shard bloodlust, lord_of_flames, embrace_chaos, accelerando(2), potion_of_prolonged_power
0:40.455 default R incinerate Fluffy_Pillow 683418.5/1100000: 62% mana | 2.0/5: 40% soul_shard bloodlust, lord_of_flames, embrace_chaos, accelerando(4), potion_of_prolonged_power
0:41.506 default C havoc enemy2 633374.5/1100000: 58% mana | 3.0/5: 60% soul_shard lord_of_flames, embrace_chaos, accelerando(4), potion_of_prolonged_power
0:42.595 default Q chaos_bolt Fluffy_Pillow 561907.5/1100000: 51% mana | 3.0/5: 60% soul_shard lord_of_flames, embrace_chaos, accelerando(4), potion_of_prolonged_power
0:43.903 default K conflagrate Fluffy_Pillow 581765.2/1100000: 53% mana | 1.0/5: 20% soul_shard lord_of_flames, embrace_chaos, accelerando(4), potion_of_prolonged_power
0:45.187 default R incinerate Fluffy_Pillow 600632.9/1100000: 55% mana | 2.0/5: 40% soul_shard lord_of_flames, embrace_chaos, potion_of_prolonged_power
0:46.636 default P dimensional_rift Fluffy_Pillow 555382.5/1100000: 50% mana | 2.0/5: 40% soul_shard lord_of_flames, embrace_chaos, potion_of_prolonged_power
0:47.792 default Q chaos_bolt Fluffy_Pillow 571936.4/1100000: 52% mana | 4.0/5: 80% soul_shard lord_of_flames, embrace_chaos, potion_of_prolonged_power
0:49.179 default R incinerate Fluffy_Pillow 591799.2/1100000: 54% mana | 2.0/5: 40% soul_shard lord_of_flames, embrace_chaos, accelerando, potion_of_prolonged_power
0:50.607 default R incinerate Fluffy_Pillow 546555.6/1100000: 50% mana | 2.0/5: 40% soul_shard lord_of_flames, embrace_chaos, accelerando, potion_of_prolonged_power
0:52.032 default Q chaos_bolt Fluffy_Pillow 501268.3/1100000: 46% mana | 2.0/5: 40% soul_shard lord_of_flames, embrace_chaos, accelerando, potion_of_prolonged_power
0:53.397 default R incinerate Fluffy_Pillow 521108.9/1100000: 47% mana | 0.0/5: 0% soul_shard lord_of_flames, embrace_chaos, accelerando, potion_of_prolonged_power
0:54.824 default E immolate Fluffy_Pillow 475895.6/1100000: 43% mana | 0.0/5: 0% soul_shard lord_of_flames, embrace_chaos, accelerando(2), potion_of_prolonged_power
0:55.946 default R incinerate Fluffy_Pillow 426446.0/1100000: 39% mana | 0.0/5: 0% soul_shard lord_of_flames, embrace_chaos, accelerando(2), potion_of_prolonged_power
0:57.349 default R incinerate Fluffy_Pillow 381141.5/1100000: 35% mana | 1.0/5: 20% soul_shard lord_of_flames, embrace_chaos, accelerando(2), potion_of_prolonged_power
0:58.753 default Q chaos_bolt Fluffy_Pillow 335859.0/1100000: 31% mana | 2.0/5: 40% soul_shard lord_of_flames, accelerando(3)
1:00.961 default R incinerate Fluffy_Pillow 368912.5/1100000: 34% mana | 0.0/5: 0% soul_shard lord_of_flames, embrace_chaos, accelerando(4)
1:02.326 default C havoc enemy2 322642.8/1100000: 29% mana | 0.0/5: 0% soul_shard lord_of_flames, embrace_chaos
1:03.482 default G immolate Fluffy_Pillow 251196.6/1100000: 23% mana | 0.0/5: 0% soul_shard lord_of_flames, embrace_chaos
1:04.638 default J conflagrate Fluffy_Pillow 201750.5/1100000: 18% mana | 0.0/5: 0% soul_shard lord_of_flames, embrace_chaos
1:05.794 default K conflagrate Fluffy_Pillow 218304.3/1100000: 20% mana | 1.0/5: 20% soul_shard lord_of_flames, conflagration_of_chaos
1:06.949 default K conflagrate Fluffy_Pillow 234843.9/1100000: 21% mana | 2.0/5: 40% soul_shard lord_of_flames
1:08.107 default Q chaos_bolt Fluffy_Pillow 251426.4/1100000: 23% mana | 3.0/5: 60% soul_shard lord_of_flames
1:10.414 default R incinerate Fluffy_Pillow 284543.2/1100000: 26% mana | 2.0/5: 40% soul_shard lord_of_flames, embrace_chaos, accelerando
1:11.841 default K conflagrate Fluffy_Pillow 239286.1/1100000: 22% mana | 2.0/5: 40% soul_shard lord_of_flames, embrace_chaos, accelerando(2)
1:12.963 default Q chaos_bolt Fluffy_Pillow 255847.8/1100000: 23% mana | 4.0/5: 80% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(3)
1:14.289 default R incinerate Fluffy_Pillow 275692.9/1100000: 25% mana | 2.0/5: 40% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(3)
1:15.675 default R incinerate Fluffy_Pillow 230436.0/1100000: 21% mana | 2.0/5: 40% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(3)
1:17.061 default Q chaos_bolt Fluffy_Pillow 185179.1/1100000: 17% mana | 3.0/5: 60% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(3)
1:18.388 default K conflagrate Fluffy_Pillow 205040.3/1100000: 19% mana | 1.0/5: 20% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(4)
1:19.478 default Q chaos_bolt Fluffy_Pillow 221588.4/1100000: 20% mana | 4.0/5: 80% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, nefarious_pact, accelerando(4)
1:20.386 default R incinerate Fluffy_Pillow 235374.5/1100000: 21% mana | 2.0/5: 40% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, nefarious_pact, accelerando(5)
1:21.321 default R incinerate Fluffy_Pillow 183770.8/1100000: 17% mana | 2.0/5: 40% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, nefarious_pact, accelerando(5)
1:22.254 default R incinerate Fluffy_Pillow 131904.6/1100000: 12% mana | 2.0/5: 40% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, nefarious_pact
1:23.257 default R incinerate Fluffy_Pillow 80406.2/1100000: 7% mana | 2.0/5: 40% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, nefarious_pact, accelerando
1:24.246 default Q chaos_bolt Fluffy_Pillow 28781.6/1100000: 3% mana | 4.0/5: 80% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, nefarious_pact, accelerando
1:25.191 default S life_tap Fluffy_Pillow 42517.4/1100000: 4% mana | 2.0/5: 40% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, nefarious_pact, accelerando
1:25.982 default C havoc enemy2 384014.8/1100000: 35% mana | 2.0/5: 40% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, nefarious_pact, accelerando
1:26.770 default E immolate Fluffy_Pillow 307503.9/1100000: 28% mana | 2.0/5: 40% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, nefarious_pact, accelerando(2)
1:27.551 default R incinerate Fluffy_Pillow 253067.0/1100000: 23% mana | 2.0/5: 40% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, nefarious_pact, accelerando(3)
1:28.512 default Q chaos_bolt Fluffy_Pillow 201449.4/1100000: 18% mana | 3.0/5: 60% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, nefarious_pact, accelerando(3)
1:29.434 default R incinerate Fluffy_Pillow 215248.2/1100000: 20% mana | 1.0/5: 20% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, nefarious_pact, accelerando(3)
1:30.395 default R incinerate Fluffy_Pillow 163630.7/1100000: 15% mana | 1.0/5: 20% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, nefarious_pact, accelerando(3)
1:31.356 default P dimensional_rift Fluffy_Pillow 112013.2/1100000: 10% mana | 1.0/5: 20% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, devils_due, accelerando(3)
1:32.660 default P dimensional_rift Fluffy_Pillow 131686.9/1100000: 12% mana | 1.0/5: 20% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, devils_due, accelerando(4)
1:33.942 default Q chaos_bolt Fluffy_Pillow 151149.9/1100000: 14% mana | 2.0/5: 40% soul_shard lord_of_flames, conflagration_of_chaos, devils_due, accelerando(4)
1:36.508 default G immolate Fluffy_Pillow 188473.2/1100000: 17% mana | 0.0/5: 0% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, devils_due
1:37.868 default J conflagrate Fluffy_Pillow 141948.3/1100000: 13% mana | 0.0/5: 0% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, devils_due
1:39.231 default K conflagrate Fluffy_Pillow 161466.4/1100000: 15% mana | 1.0/5: 20% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, nefarious_pact
1:40.034 default K conflagrate Fluffy_Pillow 172965.3/1100000: 16% mana | 2.0/5: 40% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, nefarious_pact
1:40.838 default L service_imp Fluffy_Pillow 184478.5/1100000: 17% mana | 3.0/5: 60% soul_shard lord_of_flames, conflagration_of_chaos, nefarious_pact
1:41.641 default Q chaos_bolt Fluffy_Pillow 195977.4/1100000: 18% mana | 2.0/5: 40% soul_shard lord_of_flames, conflagration_of_chaos, nefarious_pact
1:43.243 default R incinerate Fluffy_Pillow 219152.5/1100000: 20% mana | 2.0/5: 40% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, nefarious_pact, accelerando
1:44.231 default P dimensional_rift Fluffy_Pillow 167513.3/1100000: 15% mana | 3.0/5: 60% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, nefarious_pact, accelerando
1:45.022 default Q chaos_bolt Fluffy_Pillow 179010.7/1100000: 16% mana | 3.0/5: 60% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, nefarious_pact, accelerando
1:45.970 default Q chaos_bolt Fluffy_Pillow 192929.8/1100000: 18% mana | 3.0/5: 60% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, nefarious_pact, accelerando(2)
1:46.903 default C havoc enemy2 206692.4/1100000: 19% mana | 1.0/5: 20% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, nefarious_pact, accelerando(2)
1:47.682 default K conflagrate Fluffy_Pillow 130210.4/1100000: 12% mana | 1.0/5: 20% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, nefarious_pact, accelerando(3)
1:48.451 default R incinerate Fluffy_Pillow 141719.4/1100000: 13% mana | 2.0/5: 40% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, nefarious_pact, accelerando(3)
1:49.412 default R incinerate Fluffy_Pillow 90167.8/1100000: 8% mana | 2.0/5: 40% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, nefarious_pact, accelerando(4)
1:50.359 default Q chaos_bolt Fluffy_Pillow 38545.8/1100000: 4% mana | 3.0/5: 60% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, nefarious_pact, accelerando(5)
1:51.252 default S life_tap Fluffy_Pillow 52295.4/1100000: 5% mana | 1.0/5: 20% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, devils_due, accelerando(5)
1:52.518 default K conflagrate Fluffy_Pillow 401788.1/1100000: 37% mana | 1.0/5: 20% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, devils_due, accelerando(5)
1:53.785 default Q chaos_bolt Fluffy_Pillow 421296.2/1100000: 38% mana | 2.0/5: 40% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, devils_due, accelerando(5)
1:55.305 default R incinerate Fluffy_Pillow 443459.9/1100000: 40% mana | 0.0/5: 0% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, devils_due
1:57.011 default R incinerate Fluffy_Pillow 401889.8/1100000: 37% mana | 0.0/5: 0% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, devils_due
1:58.715 default E immolate Fluffy_Pillow 360291.0/1100000: 33% mana | 0.0/5: 0% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, devils_due
2:00.078 default R incinerate Fluffy_Pillow 313809.1/1100000: 29% mana | 0.0/5: 0% soul_shard lord_of_flames, conflagration_of_chaos
2:01.528 default R incinerate Fluffy_Pillow 268629.6/1100000: 24% mana | 0.0/5: 0% soul_shard lord_of_flames, conflagration_of_chaos, accelerando
2:02.956 default R incinerate Fluffy_Pillow 223385.9/1100000: 20% mana | 0.0/5: 0% soul_shard lord_of_flames, conflagration_of_chaos, accelerando
2:04.384 default R incinerate Fluffy_Pillow 178143.6/1100000: 16% mana | 0.0/5: 0% soul_shard lord_of_flames, conflagration_of_chaos, accelerando(2)
2:05.790 default R incinerate Fluffy_Pillow 132883.3/1100000: 12% mana | 0.0/5: 0% soul_shard lord_of_flames, conflagration_of_chaos, accelerando(2)
2:07.196 default O soul_harvest Fluffy_Pillow 87624.1/1100000: 8% mana | 0.0/5: 0% soul_shard lord_of_flames, conflagration_of_chaos, accelerando(3)
2:07.196 default I potion Fluffy_Pillow 87624.1/1100000: 8% mana | 0.0/5: 0% soul_shard soul_harvest, lord_of_flames, conflagration_of_chaos, accelerando(3)
2:07.196 default R incinerate Fluffy_Pillow 87624.1/1100000: 8% mana | 0.0/5: 0% soul_shard soul_harvest, lord_of_flames, conflagration_of_chaos, accelerando(3), potion_of_deadly_grace
2:08.582 default S life_tap Fluffy_Pillow 42367.2/1100000: 4% mana | 0.0/5: 0% soul_shard soul_harvest, lord_of_flames, conflagration_of_chaos, accelerando(3), potion_of_deadly_grace
2:09.688 default C havoc enemy2 388919.7/1100000: 35% mana | 0.0/5: 0% soul_shard soul_harvest, lord_of_flames, conflagration_of_chaos, accelerando(3), potion_of_deadly_grace
2:10.795 default G immolate Fluffy_Pillow 317487.3/1100000: 29% mana | 0.0/5: 0% soul_shard soul_harvest, lord_of_flames, conflagration_of_chaos, accelerando(3), potion_of_deadly_grace
2:11.901 default J conflagrate Fluffy_Pillow 268040.7/1100000: 24% mana | 0.0/5: 0% soul_shard soul_harvest, lord_of_flames, conflagration_of_chaos, accelerando(4), potion_of_deadly_grace
2:12.992 default Q chaos_bolt Fluffy_Pillow 284604.0/1100000: 26% mana | 3.0/5: 60% soul_shard soul_harvest, lord_of_flames, accelerando(4), potion_of_deadly_grace
2:15.170 default K conflagrate Fluffy_Pillow 316145.9/1100000: 29% mana | 2.0/5: 40% soul_shard soul_harvest, lord_of_flames, embrace_chaos, accelerando, potion_of_deadly_grace
2:16.309 default P dimensional_rift Fluffy_Pillow 332701.5/1100000: 30% mana | 3.0/5: 60% soul_shard soul_harvest, lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando, potion_of_deadly_grace
2:17.449 default Q chaos_bolt Fluffy_Pillow 349271.7/1100000: 32% mana | 5.0/5: 100% soul_shard soul_harvest, lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando, potion_of_deadly_grace
2:18.815 default Q chaos_bolt Fluffy_Pillow 369126.9/1100000: 34% mana | 3.0/5: 60% soul_shard soul_harvest, lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando, potion_of_deadly_grace
2:20.180 default K conflagrate Fluffy_Pillow 388967.5/1100000: 35% mana | 2.0/5: 40% soul_shard soul_harvest, lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando, potion_of_deadly_grace
2:21.320 default Q chaos_bolt Fluffy_Pillow 405537.7/1100000: 37% mana | 3.0/5: 60% soul_shard soul_harvest, lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando, potion_of_deadly_grace
2:22.686 default K conflagrate Fluffy_Pillow 425394.8/1100000: 39% mana | 2.0/5: 40% soul_shard soul_harvest, lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(2), potion_of_deadly_grace
2:23.808 default Q chaos_bolt Fluffy_Pillow 441945.3/1100000: 40% mana | 4.0/5: 80% soul_shard soul_harvest, lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(2), potion_of_deadly_grace
2:25.154 default R incinerate Fluffy_Pillow 461799.9/1100000: 42% mana | 2.0/5: 40% soul_shard soul_harvest, lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(2), potion_of_deadly_grace
2:26.561 default K conflagrate Fluffy_Pillow 416554.4/1100000: 38% mana | 2.0/5: 40% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(2), potion_of_deadly_grace
2:27.683 default Q chaos_bolt Fluffy_Pillow 432648.0/1100000: 39% mana | 3.0/5: 60% soul_shard lord_of_flames, embrace_chaos, potion_of_deadly_grace
2:29.069 default R incinerate Fluffy_Pillow 452496.4/1100000: 41% mana | 2.0/5: 40% soul_shard lord_of_flames, embrace_chaos, accelerando, potion_of_deadly_grace
2:30.497 default C havoc enemy2 407252.7/1100000: 37% mana | 2.0/5: 40% soul_shard lord_of_flames, embrace_chaos, accelerando, potion_of_deadly_grace
2:31.635 default Q chaos_bolt Fluffy_Pillow 335793.8/1100000: 31% mana | 3.0/5: 60% soul_shard lord_of_flames, embrace_chaos, accelerando, potion_of_deadly_grace
2:33.002 default R incinerate Fluffy_Pillow 355663.5/1100000: 32% mana | 1.0/5: 20% soul_shard lord_of_flames, embrace_chaos, accelerando, potion_of_deadly_grace
2:34.428 default E immolate Fluffy_Pillow 310391.6/1100000: 28% mana | 1.0/5: 20% soul_shard lord_of_flames, embrace_chaos, accelerando(2), potion_of_deadly_grace
2:35.550 default R incinerate Fluffy_Pillow 260942.1/1100000: 24% mana | 2.0/5: 40% soul_shard lord_of_flames, embrace_chaos, accelerando(2), potion_of_deadly_grace
2:36.956 default Q chaos_bolt Fluffy_Pillow 215681.8/1100000: 20% mana | 2.0/5: 40% soul_shard lord_of_flames, embrace_chaos, accelerando(2), potion_of_deadly_grace
2:38.302 default R incinerate Fluffy_Pillow 235536.4/1100000: 21% mana | 0.0/5: 0% soul_shard lord_of_flames, embrace_chaos, accelerando(2)
2:39.708 default R incinerate Fluffy_Pillow 190277.2/1100000: 17% mana | 0.0/5: 0% soul_shard lord_of_flames, embrace_chaos, accelerando(3)
2:41.093 default R incinerate Fluffy_Pillow 144987.3/1100000: 13% mana | 1.0/5: 20% soul_shard lord_of_flames, embrace_chaos
2:42.543 default R incinerate Fluffy_Pillow 99751.2/1100000: 9% mana | 1.0/5: 20% soul_shard lord_of_flames
2:43.992 default S life_tap Fluffy_Pillow 54500.8/1100000: 5% mana | 1.0/5: 20% soul_shard lord_of_flames
2:45.149 default G immolate Fluffy_Pillow 401069.0/1100000: 36% mana | 1.0/5: 20% soul_shard lord_of_flames
2:46.305 default J conflagrate Fluffy_Pillow 351622.8/1100000: 32% mana | 1.0/5: 20% soul_shard lord_of_flames
2:47.461 default K conflagrate Fluffy_Pillow 368176.7/1100000: 33% mana | 2.0/5: 40% soul_shard lord_of_flames, conflagration_of_chaos
2:48.619 default Q chaos_bolt Fluffy_Pillow 384759.2/1100000: 35% mana | 3.0/5: 60% soul_shard lord_of_flames, conflagration_of_chaos
2:50.929 default C havoc enemy2 418225.6/1100000: 38% mana | 2.0/5: 40% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(2)
2:52.052 default K conflagrate Fluffy_Pillow 346790.8/1100000: 32% mana | 2.0/5: 40% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(2)
2:53.175 default Q chaos_bolt Fluffy_Pillow 363356.0/1100000: 33% mana | 3.0/5: 60% soul_shard lord_of_flames, embrace_chaos, accelerando(2)
2:54.521 default K conflagrate Fluffy_Pillow 383210.7/1100000: 35% mana | 1.0/5: 20% soul_shard lord_of_flames, embrace_chaos, accelerando(2)
2:55.644 default R incinerate Fluffy_Pillow 399775.9/1100000: 36% mana | 2.0/5: 40% soul_shard lord_of_flames, embrace_chaos, accelerando(2)
2:57.047 default R incinerate Fluffy_Pillow 354722.6/1100000: 32% mana | 2.0/5: 40% soul_shard lord_of_flames, embrace_chaos, accelerando(3)
2:58.433 default Q chaos_bolt Fluffy_Pillow 309465.7/1100000: 28% mana | 2.0/5: 40% soul_shard lord_of_flames, embrace_chaos, accelerando(3)
2:59.761 default R incinerate Fluffy_Pillow 329340.7/1100000: 30% mana | 0.0/5: 0% soul_shard lord_of_flames, embrace_chaos, accelerando(3)
3:01.148 default K conflagrate Fluffy_Pillow 284266.8/1100000: 26% mana | 1.0/5: 20% soul_shard lord_of_flames, embrace_chaos
3:02.304 default P dimensional_rift Fluffy_Pillow 300820.6/1100000: 27% mana | 2.0/5: 40% soul_shard lord_of_flames, embrace_chaos
3:03.459 default Q chaos_bolt Fluffy_Pillow 317360.2/1100000: 29% mana | 2.0/5: 40% soul_shard lord_of_flames, embrace_chaos
3:04.848 default H berserking Fluffy_Pillow 337250.6/1100000: 31% mana | 0.0/5: 0% soul_shard lord_of_flames, embrace_chaos
3:04.848 default R incinerate Fluffy_Pillow 337250.6/1100000: 31% mana | 0.0/5: 0% soul_shard berserking, lord_of_flames, embrace_chaos
3:06.108 default R incinerate Fluffy_Pillow 292000.2/1100000: 27% mana | 0.0/5: 0% soul_shard berserking, lord_of_flames, embrace_chaos
3:07.366 default R incinerate Fluffy_Pillow 246716.8/1100000: 22% mana | 1.0/5: 20% soul_shard berserking, lord_of_flames, embrace_chaos
3:08.626 default E immolate Fluffy_Pillow 201467.7/1100000: 18% mana | 1.0/5: 20% soul_shard berserking, lord_of_flames, embrace_chaos, accelerando
3:09.618 default Q chaos_bolt Fluffy_Pillow 152049.5/1100000: 14% mana | 2.0/5: 40% soul_shard berserking, lord_of_flames, accelerando
3:11.596 default C havoc enemy2 185112.8/1100000: 17% mana | 2.0/5: 40% soul_shard berserking, lord_of_flames, embrace_chaos, accelerando
3:12.586 default L service_imp Fluffy_Pillow 113661.2/1100000: 10% mana | 3.0/5: 60% soul_shard berserking, lord_of_flames, embrace_chaos, accelerando
3:13.577 default R incinerate Fluffy_Pillow 130226.3/1100000: 12% mana | 2.0/5: 40% soul_shard berserking, lord_of_flames, embrace_chaos, accelerando
3:14.819 default Q chaos_bolt Fluffy_Pillow 85277.1/1100000: 8% mana | 2.0/5: 40% soul_shard berserking, lord_of_flames, embrace_chaos, accelerando(2)
3:15.990 default R incinerate Fluffy_Pillow 102614.5/1100000: 9% mana | 2.0/5: 40% soul_shard lord_of_flames, embrace_chaos, accelerando(2)
3:17.396 default J conflagrate Fluffy_Pillow 57355.3/1100000: 5% mana | 2.0/5: 40% soul_shard lord_of_flames, embrace_chaos, accelerando(3)
3:18.502 default Q chaos_bolt Fluffy_Pillow 73907.9/1100000: 7% mana | 3.0/5: 60% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(3)
3:19.829 default K conflagrate Fluffy_Pillow 93768.0/1100000: 9% mana | 1.0/5: 20% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(3)
3:20.938 default Q chaos_bolt Fluffy_Pillow 110160.6/1100000: 10% mana | 3.0/5: 60% soul_shard lord_of_flames, embrace_chaos
3:22.325 default R incinerate Fluffy_Pillow 130022.4/1100000: 12% mana | 1.0/5: 20% soul_shard lord_of_flames, embrace_chaos
3:23.773 default R incinerate Fluffy_Pillow 84757.6/1100000: 8% mana | 1.0/5: 20% soul_shard lord_of_flames, embrace_chaos
3:25.223 default S life_tap Fluffy_Pillow 39521.6/1100000: 4% mana | 1.0/5: 20% soul_shard lord_of_flames, embrace_chaos
3:26.379 default E immolate Fluffy_Pillow 386075.4/1100000: 35% mana | 1.0/5: 20% soul_shard lord_of_flames
3:27.532 default Q chaos_bolt Fluffy_Pillow 336734.0/1100000: 31% mana | 3.0/5: 60% soul_shard lord_of_flames, accelerando(2)
3:29.774 default G immolate Fluffy_Pillow 369806.5/1100000: 34% mana | 1.0/5: 20% soul_shard lord_of_flames, embrace_chaos, accelerando(3)
3:30.879 default J conflagrate Fluffy_Pillow 320344.8/1100000: 29% mana | 3.0/5: 60% soul_shard lord_of_flames, embrace_chaos, accelerando(4)
3:31.971 default C havoc enemy2 336923.2/1100000: 31% mana | 4.0/5: 80% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(4)
3:33.061 default Q chaos_bolt Fluffy_Pillow 265471.4/1100000: 24% mana | 4.0/5: 80% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(4)
3:34.368 default Q chaos_bolt Fluffy_Pillow 285325.3/1100000: 26% mana | 3.0/5: 60% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(5)
3:35.657 default K conflagrate Fluffy_Pillow 305172.2/1100000: 28% mana | 1.0/5: 20% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(5)
3:36.732 default Q chaos_bolt Fluffy_Pillow 321724.0/1100000: 29% mana | 3.0/5: 60% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(5)
3:38.020 default K conflagrate Fluffy_Pillow 341555.4/1100000: 31% mana | 1.0/5: 20% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(5)
3:39.096 default Q chaos_bolt Fluffy_Pillow 357854.5/1100000: 33% mana | 3.0/5: 60% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos
3:40.482 default K conflagrate Fluffy_Pillow 377701.9/1100000: 34% mana | 1.0/5: 20% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos
3:41.637 default Q chaos_bolt Fluffy_Pillow 394241.4/1100000: 36% mana | 3.0/5: 60% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos
3:43.023 default R incinerate Fluffy_Pillow 414098.6/1100000: 38% mana | 1.0/5: 20% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando
3:44.450 default K conflagrate Fluffy_Pillow 368840.4/1100000: 34% mana | 2.0/5: 40% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando
3:45.732 default Q chaos_bolt Fluffy_Pillow 387474.6/1100000: 35% mana | 3.0/5: 60% soul_shard lord_of_flames, embrace_chaos, accelerando
3:47.098 default P dimensional_rift Fluffy_Pillow 407329.7/1100000: 37% mana | 1.0/5: 20% soul_shard lord_of_flames, embrace_chaos, accelerando
3:48.238 default R incinerate Fluffy_Pillow 423899.9/1100000: 39% mana | 2.0/5: 40% soul_shard lord_of_flames, embrace_chaos, accelerando
3:49.665 default N summon_doomguard Fluffy_Pillow 378641.7/1100000: 34% mana | 2.0/5: 40% soul_shard lord_of_flames, embrace_chaos, accelerando
3:50.805 default R incinerate Fluffy_Pillow 395211.9/1100000: 36% mana | 1.0/5: 20% soul_shard lord_of_flames, embrace_chaos, accelerando
3:52.231 default C havoc enemy2 349961.4/1100000: 32% mana | 1.0/5: 20% soul_shard lord_of_flames, accelerando(2)
3:53.355 default E immolate Fluffy_Pillow 278541.4/1100000: 25% mana | 1.0/5: 20% soul_shard lord_of_flames, accelerando(2)
3:54.478 default Q chaos_bolt Fluffy_Pillow 229150.1/1100000: 21% mana | 2.0/5: 40% soul_shard lord_of_flames, accelerando(3)
3:56.686 default R incinerate Fluffy_Pillow 261091.6/1100000: 24% mana | 1.0/5: 20% soul_shard lord_of_flames, embrace_chaos
3:58.135 default R incinerate Fluffy_Pillow 215841.2/1100000: 20% mana | 1.0/5: 20% soul_shard lord_of_flames, embrace_chaos
3:59.583 default R incinerate Fluffy_Pillow 170706.1/1100000: 16% mana | 1.0/5: 20% soul_shard lord_of_flames, embrace_chaos, accelerando
4:01.008 default R incinerate Fluffy_Pillow 125418.8/1100000: 11% mana | 1.0/5: 20% soul_shard lord_of_flames, accelerando
4:02.435 default R incinerate Fluffy_Pillow 80160.7/1100000: 7% mana | 1.0/5: 20% soul_shard lord_of_flames, accelerando
4:03.862 default S life_tap Fluffy_Pillow 34976.0/1100000: 3% mana | 1.0/5: 20% soul_shard lord_of_flames, accelerando(2)
4:04.986 default G immolate Fluffy_Pillow 381555.9/1100000: 35% mana | 1.0/5: 20% soul_shard lord_of_flames, accelerando(2)
4:06.109 default J conflagrate Fluffy_Pillow 332189.6/1100000: 30% mana | 1.0/5: 20% soul_shard lord_of_flames, accelerando(3)
4:07.215 default K conflagrate Fluffy_Pillow 348742.2/1100000: 32% mana | 2.0/5: 40% soul_shard lord_of_flames, conflagration_of_chaos, accelerando(3)
4:08.322 default O soul_harvest Fluffy_Pillow 365548.4/1100000: 33% mana | 3.0/5: 60% soul_shard lord_of_flames, conflagration_of_chaos, accelerando(4)
4:08.322 default Q chaos_bolt Fluffy_Pillow 365548.4/1100000: 33% mana | 3.0/5: 60% soul_shard soul_harvest, lord_of_flames, conflagration_of_chaos, accelerando(4)
4:10.499 default K conflagrate Fluffy_Pillow 398599.9/1100000: 36% mana | 2.0/5: 40% soul_shard soul_harvest, lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(5)
4:11.573 default Q chaos_bolt Fluffy_Pillow 414498.7/1100000: 38% mana | 3.0/5: 60% soul_shard soul_harvest, lord_of_flames, embrace_chaos
4:12.962 default C havoc enemy2 434389.1/1100000: 39% mana | 2.0/5: 40% soul_shard soul_harvest, lord_of_flames, embrace_chaos
4:14.119 default K conflagrate Fluffy_Pillow 362957.3/1100000: 33% mana | 2.0/5: 40% soul_shard soul_harvest, lord_of_flames, embrace_chaos
4:15.275 default Q chaos_bolt Fluffy_Pillow 379511.2/1100000: 35% mana | 3.0/5: 60% soul_shard soul_harvest, lord_of_flames, conflagration_of_chaos, embrace_chaos
4:16.662 default R incinerate Fluffy_Pillow 399374.0/1100000: 36% mana | 1.0/5: 20% soul_shard soul_harvest, lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando
4:18.091 default R incinerate Fluffy_Pillow 354144.9/1100000: 32% mana | 1.0/5: 20% soul_shard soul_harvest, lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando
4:19.516 default K conflagrate Fluffy_Pillow 308857.6/1100000: 28% mana | 1.0/5: 20% soul_shard soul_harvest, lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando
4:20.859 default Q chaos_bolt Fluffy_Pillow 328378.5/1100000: 30% mana | 2.0/5: 40% soul_shard soul_harvest, lord_of_flames, accelerando
4:23.134 default Q chaos_bolt Fluffy_Pillow 361454.8/1100000: 33% mana | 3.0/5: 60% soul_shard soul_harvest, lord_of_flames, embrace_chaos, nefarious_pact, accelerando(2)
4:24.068 default R incinerate Fluffy_Pillow 375232.1/1100000: 34% mana | 1.0/5: 20% soul_shard soul_harvest, lord_of_flames, embrace_chaos, nefarious_pact, accelerando(2)
4:25.043 default R incinerate Fluffy_Pillow 323614.2/1100000: 29% mana | 2.0/5: 40% soul_shard soul_harvest, lord_of_flames, embrace_chaos, nefarious_pact, accelerando(2)
4:26.020 default P dimensional_rift Fluffy_Pillow 272025.8/1100000: 25% mana | 2.0/5: 40% soul_shard soul_harvest, lord_of_flames, embrace_chaos, nefarious_pact, accelerando(2)
4:26.798 default R incinerate Fluffy_Pillow 283501.9/1100000: 26% mana | 2.0/5: 40% soul_shard soul_harvest, lord_of_flames, embrace_chaos, nefarious_pact, accelerando(2)
4:27.773 default Q chaos_bolt Fluffy_Pillow 231884.0/1100000: 21% mana | 2.0/5: 40% soul_shard lord_of_flames, embrace_chaos, nefarious_pact, accelerando(2)
4:28.707 default E immolate Fluffy_Pillow 245639.8/1100000: 22% mana | 1.0/5: 20% soul_shard lord_of_flames, embrace_chaos, nefarious_pact
4:29.509 default R incinerate Fluffy_Pillow 191124.4/1100000: 17% mana | 1.0/5: 20% soul_shard lord_of_flames, embrace_chaos, nefarious_pact
4:30.513 default R incinerate Fluffy_Pillow 139502.5/1100000: 13% mana | 1.0/5: 20% soul_shard lord_of_flames, embrace_chaos, nefarious_pact, accelerando
4:31.502 default G immolate Fluffy_Pillow 87877.8/1100000: 8% mana | 1.0/5: 20% soul_shard lord_of_flames, embrace_chaos, nefarious_pact, accelerando
4:32.293 default J conflagrate Fluffy_Pillow 33376.3/1100000: 3% mana | 1.0/5: 20% soul_shard lord_of_flames, embrace_chaos, nefarious_pact, accelerando(2)
4:33.072 default J conflagrate Fluffy_Pillow 44953.1/1100000: 4% mana | 3.0/5: 60% soul_shard lord_of_flames, conflagration_of_chaos, nefarious_pact, accelerando(3)
4:33.949 default P dimensional_rift Fluffy_Pillow 58078.4/1100000: 5% mana | 4.0/5: 80% soul_shard lord_of_flames, devils_due, accelerando(3)
4:35.254 default P dimensional_rift Fluffy_Pillow 77609.3/1100000: 7% mana | 5.0/5: 100% soul_shard lord_of_flames, devils_due, accelerando(3)
4:36.557 default C havoc enemy2 97110.2/1100000: 9% mana | 5.0/5: 100% soul_shard lord_of_flames, devils_due, accelerando(3)
4:37.859 default Q chaos_bolt Fluffy_Pillow 28596.1/1100000: 3% mana | 5.0/5: 100% soul_shard lord_of_flames, devils_due, accelerando(3)
4:40.461 default J conflagrate Fluffy_Pillow 67538.1/1100000: 6% mana | 3.0/5: 60% soul_shard lord_of_flames, embrace_chaos, devils_due, accelerando(3)
4:41.765 default Q chaos_bolt Fluffy_Pillow 87053.9/1100000: 8% mana | 4.0/5: 80% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(3)
4:43.090 default L service_imp Fluffy_Pillow 106619.7/1100000: 10% mana | 2.0/5: 40% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos
4:44.246 default R incinerate Fluffy_Pillow 123173.5/1100000: 11% mana | 1.0/5: 20% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos
4:45.695 default R incinerate Fluffy_Pillow 77923.1/1100000: 7% mana | 1.0/5: 20% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos
4:47.143 default J conflagrate Fluffy_Pillow 32658.4/1100000: 3% mana | 2.0/5: 40% soul_shard lord_of_flames, conflagration_of_chaos
4:48.299 default Q chaos_bolt Fluffy_Pillow 49212.3/1100000: 4% mana | 3.0/5: 60% soul_shard lord_of_flames, conflagration_of_chaos
4:50.608 default R incinerate Fluffy_Pillow 82278.1/1100000: 7% mana | 1.0/5: 20% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando
4:52.035 default S life_tap Fluffy_Pillow 37019.9/1100000: 3% mana | 2.0/5: 40% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando
4:53.175 default R incinerate Fluffy_Pillow 383590.1/1100000: 35% mana | 2.0/5: 40% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando
4:54.602 default E immolate Fluffy_Pillow 338331.9/1100000: 31% mana | 3.0/5: 60% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando
4:55.740 default J conflagrate Fluffy_Pillow 288873.0/1100000: 26% mana | 3.0/5: 60% soul_shard lord_of_flames, conflagration_of_chaos, accelerando
4:56.878 default Q chaos_bolt Fluffy_Pillow 305414.2/1100000: 28% mana | 4.0/5: 80% soul_shard lord_of_flames, conflagration_of_chaos, accelerando

Stats

Raid-Buffed Unbuffed Gear Amount
Strength 4201 3876 0
Agility 7254 6929 0
Stamina 53591 53591 33365
Intellect 49775 48068 38456 (1278)
Spirit 1 1 0
Health 3215460 3215460 0
Mana 1100000 1100000 0
Soul Shard 5 5 0
Spell Power 49775 48068 0
Crit 13.94% 13.94% 3577
Haste 30.18% 29.18% 10943
Damage / Heal Versatility 5.96% 5.96% 2829
ManaReg per Second 14320 14210 0
Mastery 66.15% 66.15% 5618
Armor 1954 1954 1954
Run Speed 7 0 0

Gear

Source Slot Average Item Level: 904.00
Local Head Eyes of Azj'Aqir
ilevel: 900, stats: { 253 Armor, +3255 Sta, +2170 Int, +1074 Haste, +578 Vers }
Local Neck Radiant String of Scorpid Eyes
ilevel: 900, stats: { +1831 Sta, +2011 Haste, +922 Crit }, enchant: mark_of_the_hidden_satyr
Local Shoulders Pauldrons of Azj'Aqir
ilevel: 900, stats: { 233 Armor, +2442 Sta, +1628 Int, +752 Mastery, +487 Vers }
Local Chest Robes of Fluctuating Energy
ilevel: 900, stats: { 311 Armor, +3255 Sta, +2170 Int, +1145 Haste, +507 Mastery }
Local Waist Man'ari Skullbuckled Cinch
ilevel: 900, stats: { 175 Armor, +2442 Sta, +1628 Int, +699 Haste, +540 Mastery }
Local Legs Leggings of Azj'Aqir
ilevel: 900, stats: { 272 Armor, +3255 Sta, +2170 Int, +932 Crit, +720 Haste }
Local Feet Outcast Wanderer's Footrags
ilevel: 910, stats: { 222 Armor, +2680 Sta, +1786 Int, +864 Crit, +422 Mastery }
Local Wrists Woven Lasher Tendril Bracers
ilevel: 900, stats: { 136 Armor, +1831 Sta, +1221 Int, +644 Haste, +285 Vers }
Local Hands Clutch of Azj'Aqir
ilevel: 900, stats: { 194 Armor, +2442 Sta, +1628 Int, +859 Crit, +380 Mastery }
Local Finger1 Ring of the Scoured Clan
ilevel: 900, stats: { +1831 Sta, +2095 Mastery, +838 Haste }, enchant: { +200 Haste }
Local Finger2 Ring of Braided Stems
ilevel: 905, stats: { +1918 Sta, +1814 Haste, +1209 Vers }, enchant: { +200 Haste }
Local Trinket1 Whispers in the Dark
ilevel: 905, stats: { +2162 Int }
Local Trinket2 Erratic Metronome
ilevel: 900, stats: { +2063 Int }
Local Back Astromancer's Greatcloak
ilevel: 905, stats: { 158 Armor, +1918 Sta, +1278 StrAgiInt, +676 Haste, +270 Vers }, enchant: { +200 Int }
Local Main Hand Scepter of Sargeras
ilevel: 929, weapon: { 7005 - 10509, 3.6 }, stats: { +2843 Int, +4265 Sta, +922 Haste, +922 Mastery, +15509 Int }, relics: { +61 ilevels, +59 ilevels, +61 ilevels }

Talents

Level
15 Backdraft (Destruction Warlock) Roaring Blaze (Destruction Warlock) Shadowburn (Destruction Warlock)
30 Reverse Entropy (Destruction Warlock) Eradication (Destruction Warlock) Empowered Life Tap
45 Demonic Circle Mortal Coil Shadowfury
60 Cataclysm (Destruction Warlock) Fire and Brimstone (Destruction Warlock) Soul Harvest
75 Demon Skin Burning Rush Dark Pact
90 Grimoire of Supremacy Grimoire of Service Grimoire of Sacrifice
100 Wreak Havoc (Destruction Warlock) Channel Demonfire (Destruction Warlock) Soul Conduit

Profile

warlock="Destro_7.2_NoLeggos"
level=110
race=troll
role=spell
position=back
talents=2203021
artifact=38:0:0:0:0:803:1:804:3:805:3:806:3:807:3:808:3:809:3:810:3:811:3:812:3:813:1:814:1:815:1:816:1:817:1:818:1:1355:1:1392:1:1609:4:1610:1:1611:1:1713:1
spec=destruction

# This default action priority list is automatically created based on your character.
# It is a attempt to provide you with a action list that is both simple and practicable,
# while resulting in a meaningful and good simulation. It may not result in the absolutely highest possible dps.
# Feel free to edit, adapt and improve it to your own needs.
# SimulationCraft is always looking for updates and improvements to the default action lists.

# Executed before combat begins. Accepts non-harmful actions only.
actions.precombat=flask,type=whispered_pact
actions.precombat+=/food,type=azshari_salad
actions.precombat+=/summon_pet,if=!talent.grimoire_of_supremacy.enabled&(!talent.grimoire_of_sacrifice.enabled|buff.demonic_power.down)
actions.precombat+=/summon_infernal,if=talent.grimoire_of_supremacy.enabled&artifact.lord_of_flames.rank>0
actions.precombat+=/summon_infernal,if=talent.grimoire_of_supremacy.enabled&active_enemies>1
actions.precombat+=/summon_doomguard,if=talent.grimoire_of_supremacy.enabled&active_enemies=1&artifact.lord_of_flames.rank=0
actions.precombat+=/augmentation,type=defiled
actions.precombat+=/snapshot_stats
actions.precombat+=/grimoire_of_sacrifice,if=talent.grimoire_of_sacrifice.enabled
actions.precombat+=/life_tap,if=talent.empowered_life_tap.enabled&!buff.empowered_life_tap.remains
actions.precombat+=/potion,name=prolonged_power
actions.precombat+=/chaos_bolt

# Executed every time the actor is available.
actions=havoc,target=2,if=active_enemies>1&(active_enemies<4|talent.wreak_havoc.enabled&active_enemies<6)&!debuff.havoc.remains
actions+=/dimensional_rift,if=charges=3
actions+=/immolate,if=remains<=tick_time
actions+=/immolate,cycle_targets=1,if=active_enemies>1&remains<=tick_time&(!talent.roaring_blaze.enabled|(!debuff.roaring_blaze.remains&action.conflagrate.charges<2+set_bonus.tier19_4pc))
actions+=/immolate,if=talent.roaring_blaze.enabled&remains<=duration&!debuff.roaring_blaze.remains&target.time_to_die>10&(action.conflagrate.charges=2+set_bonus.tier19_4pc|(action.conflagrate.charges>=1+set_bonus.tier19_4pc&action.conflagrate.recharge_time<cast_time+gcd)|target.time_to_die<24)
actions+=/berserking
actions+=/blood_fury
actions+=/arcane_torrent
actions+=/potion,name=deadly_grace,if=(buff.soul_harvest.remains|trinket.proc.any.react|target.time_to_die<=45)
actions+=/shadowburn,if=buff.conflagration_of_chaos.remains<=action.chaos_bolt.cast_time
actions+=/shadowburn,if=(charges=1+set_bonus.tier19_4pc&recharge_time<action.chaos_bolt.cast_time|charges=2+set_bonus.tier19_4pc)&soul_shard<5
actions+=/conflagrate,if=talent.roaring_blaze.enabled&(charges=2+set_bonus.tier19_4pc|(charges>=1+set_bonus.tier19_4pc&recharge_time<gcd)|target.time_to_die<24)
actions+=/conflagrate,if=talent.roaring_blaze.enabled&debuff.roaring_blaze.stack>0&dot.immolate.remains>dot.immolate.duration*0.3&(active_enemies=1|soul_shard<3)&soul_shard<5
actions+=/conflagrate,if=!talent.roaring_blaze.enabled&buff.backdraft.stack<3&buff.conflagration_of_chaos.remains<=action.chaos_bolt.cast_time
actions+=/conflagrate,if=!talent.roaring_blaze.enabled&buff.backdraft.stack<3&(charges=1+set_bonus.tier19_4pc&recharge_time<action.chaos_bolt.cast_time|charges=2+set_bonus.tier19_4pc)&soul_shard<5
actions+=/life_tap,if=talent.empowered_life_tap.enabled&buff.empowered_life_tap.remains<=gcd
actions+=/dimensional_rift,if=equipped.144369&!buff.lessons_of_spacetime.remains&((!talent.grimoire_of_supremacy.enabled&!cooldown.summon_doomguard.remains)|(talent.grimoire_of_service.enabled&!cooldown.service_pet.remains)|(talent.soul_harvest.enabled&!cooldown.soul_harvest.remains))
actions+=/service_pet
actions+=/summon_infernal,if=artifact.lord_of_flames.rank>0&!buff.lord_of_flames.remains
actions+=/summon_doomguard,if=!talent.grimoire_of_supremacy.enabled&spell_targets.infernal_awakening<=2&(target.time_to_die>180|target.health.pct<=20|target.time_to_die<30)
actions+=/summon_infernal,if=!talent.grimoire_of_supremacy.enabled&spell_targets.infernal_awakening>2
actions+=/summon_doomguard,if=talent.grimoire_of_supremacy.enabled&spell_targets.summon_infernal=1&artifact.lord_of_flames.rank>0&buff.lord_of_flames.remains&!pet.doomguard.active
actions+=/summon_doomguard,if=talent.grimoire_of_supremacy.enabled&spell_targets.summon_infernal=1&equipped.132379&!cooldown.sindorei_spite_icd.remains
actions+=/summon_infernal,if=talent.grimoire_of_supremacy.enabled&spell_targets.summon_infernal>1&equipped.132379&!cooldown.sindorei_spite_icd.remains
actions+=/soul_harvest
actions+=/channel_demonfire,if=dot.immolate.remains>cast_time
actions+=/havoc,if=active_enemies=1&talent.wreak_havoc.enabled&equipped.132375&!debuff.havoc.remains
actions+=/rain_of_fire,if=active_enemies>=3&cooldown.havoc.remains<=12&!talent.wreak_havoc.enabled
actions+=/rain_of_fire,if=active_enemies>=6&talent.wreak_havoc.enabled
actions+=/dimensional_rift,if=!equipped.144369|charges>1|((!talent.grimoire_of_service.enabled|recharge_time<cooldown.service_pet.remains)&(!talent.soul_harvest.enabled|recharge_time<cooldown.soul_harvest.remains)&(!talent.grimoire_of_supremacy.enabled|recharge_time<cooldown.summon_doomguard.remains))
actions+=/life_tap,if=talent.empowered_life_tap.enabled&buff.empowered_life_tap.remains<duration*0.3
actions+=/cataclysm
actions+=/chaos_bolt,if=(cooldown.havoc.remains>12&cooldown.havoc.remains|active_enemies<3|talent.wreak_havoc.enabled&active_enemies<6)&(set_bonus.tier19_4pc=0|!talent.eradication.enabled|buff.embrace_chaos.remains<=cast_time|soul_shard>=3)
actions+=/shadowburn
actions+=/conflagrate,if=!talent.roaring_blaze.enabled&buff.backdraft.stack<3
actions+=/immolate,if=!talent.roaring_blaze.enabled&remains<=duration*0.3
actions+=/incinerate
actions+=/life_tap

head=eyes_of_azjaqir,id=138314,bonus_id=3445
neck=radiant_string_of_scorpid_eyes,id=140898,bonus_id=3445,enchant_id=5439
shoulders=pauldrons_of_azjaqir,id=138323,bonus_id=3445
back=astromancers_greatcloak,id=140909,bonus_id=3518,enchant_id=5436
chest=robes_of_fluctuating_energy,id=140848,bonus_id=3445
wrists=woven_lasher_tendril_bracers,id=140886,bonus_id=3445
hands=clutch_of_azjaqir,id=138311,bonus_id=3445
waist=manari_skullbuckled_cinch,id=140887,bonus_id=3445
legs=leggings_of_azjaqir,id=138317,bonus_id=3445
feet=outcast_wanderers_footrags,id=140914,bonus_id=3519
finger1=ring_of_the_scoured_clan,id=140897,bonus_id=3445,enchant=binding_of_haste
finger2=ring_of_braided_stems,id=140896,bonus_id=3518,enchant=binding_of_haste
trinket1=whispers_in_the_dark,id=140809,ilevel=905
trinket2=erratic_metronome,id=140792,ilevel=900
main_hand=scepter_of_sargeras,id=128941,ilevel=929,gem_id=140826/140837/140826,relic_id=3519/3518:3518/3519

# Gear Summary
# gear_ilvl=903.60
# gear_stamina=33365
# gear_intellect=38456
# gear_crit_rating=3577
# gear_haste_rating=10943
# gear_mastery_rating=5618
# gear_versatility_rating=2829
# gear_armor=1954
# set_bonus=tier19_2pc=1
# set_bonus=tier19_4pc=1
default_pet=imp

Feretory : 1414712 dps, 837481 dps to main target

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR
1414712.1 1414712.1 1158.2 / 0.082% 230460.7 / 16.3% 48.8
RPS Out RPS In Primary Resource Waiting APM Active Skill
23533.7 23533.7 Mana 0.00% 50.9 100.0% 100%
Talents
  • 15: Roaring Blaze (Destruction Warlock)
  • 30: Eradication (Destruction Warlock)
  • 60: Soul Harvest
  • 90: Grimoire of Service
  • 100: Wreak Havoc (Destruction Warlock)
  • Talent Calculator
Artifact

Charts

Abilities

Damage Stats DPS DPS% Execute Interval DPE DPET Type Count Hit Crit Avg Crit% Up%
Feretory 1414712
Chaos Bolt 483952 34.3% 74.5 3.92sec 1952660 1396065 Direct 143.0 0 1017467 1017467 100.0%  

Stats details: chaos_bolt

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 74.53 143.03 0.00 0.00 1.3987 0.0000 145531433.51 145531433.51 0.00 1396065.32 1396065.32
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
crit 143.03 100.00% 1017467.45 655600 1545292 1017791.40 957719 1074129 145531434 145531434 0.00
 
 

Action details: chaos_bolt

Static Values
  • id:116858
  • school:chromatic
  • resource:soul_shard
  • range:40.0
  • travel_speed:16.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:2.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:3.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:116858
  • name:Chaos Bolt
  • school:chromatic
  • tooltip:
  • description:Unleashes a devastating blast of chaos, causing {$s1=1} Chaos damage. Chaos Bolt always critically strikes and your critical strike chance increases its damage.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:4.000000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
Conflagrate 167231 11.8% 48.7 6.17sec 1031899 999873 Direct 96.8 308121 692158 518558 54.8%  

Stats details: conflagrate

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 48.67 96.85 0.00 0.00 1.0320 0.0000 50222604.62 50222604.62 0.00 999872.68 999872.68
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 43.78 45.20% 308120.69 200076 471567 308275.98 271876 348025 13488781 13488781 0.00
crit 53.07 54.80% 692157.53 400174 1074681 692406.78 622642 762250 36733824 36733824 0.00
 
 

Action details: conflagrate

Static Values
  • id:17962
  • school:fire
  • resource:chi
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:9.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:talent.roaring_blaze.enabled&(charges=2+set_bonus.tier19_4pc|(charges>=1+set_bonus.tier19_4pc&recharge_time<gcd)|target.time_to_die<24)
Spelldata
  • id:17962
  • name:Conflagrate
  • school:fire
  • tooltip:
  • description:Triggers an explosion on the target, dealing {$s1=1} Fire damage.{$?s196406=false}[ Reduces the cast time of Incinerate and Chaos Bolt by {$117828s1=30}% for {$117828d=10 seconds}.][] |cFFFFFFFFGenerates 1 Soul Shard.|r
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:2.265510
  • base_dd_min:1.00
  • base_dd_max:1.00
 
Cry Havoc 49887 3.5% 65.2 4.43sec 230144 0 Direct 130.4 101010 202066 115072 13.9%  

Stats details: cry_havoc

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 65.18 130.36 0.00 0.00 0.0000 0.0000 15000235.23 15000235.23 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 112.22 86.08% 101009.71 72050 151633 101059.95 95428 107986 11334838 11334838 0.00
crit 18.14 13.92% 202066.07 144101 303266 202190.25 165447 257616 3665397 3665397 0.00
 
 

Action details: cry_havoc

Static Values
  • id:243011
  • school:chromatic
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:243011
  • name:Cry Havoc
  • school:chromatic
  • tooltip:
  • description:Deals {$s2=0} Chaos damage to enemies within $A2 yards.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:1.000000
  • base_dd_min:0.00
  • base_dd_max:0.00
 
Deadly Grace 6106 0.4% 14.5 2.05sec 124378 0 Direct 14.5 109255 218272 124378 13.9%  

Stats details: deadly_grace

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 14.50 14.50 0.00 0.00 0.0000 0.0000 1803193.40 1803193.40 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 12.49 86.13% 109255.39 96891 116269 109268.25 100767 116269 1364225 1364225 0.00
crit 2.01 13.87% 218271.96 193782 232539 192396.63 0 232539 438968 438968 0.00
 
 

Action details: deadly_grace

Static Values
  • id:188091
  • school:arcane
  • resource:none
  • range:40.0
  • travel_speed:25.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:188091
  • name:Deadly Grace
  • school:arcane
  • tooltip:
  • description:Deal {$s1=63339 to 95008} Arcane damage.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:63338.72
  • base_dd_max:95008.08
 
Immolate 303958 21.5% 20.2 15.05sec 4524140 4327002 Direct 38.9 160585 321270 260215 62.0%  
Periodic 295.6 169536 339163 274566 61.9% 196.1%

Stats details: immolate

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 20.18 38.91 295.63 295.63 1.0456 1.9965 91295411.31 91295411.31 0.00 149343.15 4327001.82
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 14.79 38.00% 160585.00 105160 247207 160556.36 132208 188677 2374353 2374353 0.00
crit 24.13 62.00% 321269.84 210337 495534 321219.88 278321 362970 7751064 7751064 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 112.6 38.08% 169536.31 86 586556 169786.40 141869 206227 19086860 19086860 0.00
crit 183.0 61.92% 339163.02 171 1119818 339675.55 293283 387844 62083135 62083135 0.00
 
 

Action details: immolate

Static Values
  • id:348
  • school:fire
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:66000.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:1.50
  • base_crit:0.48
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:remains<=tick_time
Spelldata
  • id:348
  • name:Immolate
  • school:fire
  • tooltip:
  • description:Burns the enemy, causing {$s1=1} Fire damage immediately and an additional $157736o1 Fire damage over {$157736d=18 seconds}. |cFFFFFFFFPeriodic damage has a {$193541s1=15}% chance to generate 1 Soul Shard. Chance doubled on critical strikes.|r
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:1.332000
  • base_dd_min:1.00
  • base_dd_max:1.00
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.721500
  • base_td:0.00
  • dot_duration:18.00
  • base_tick_time:3.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
 
Incinerate 128826 9.1% 67.3 4.26sec 576311 452683 Direct 128.4 265025 530215 301948 13.9%  

Stats details: incinerate

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 67.26 128.38 0.00 0.00 1.2731 0.0000 38762833.03 38762833.03 0.00 452683.47 452683.47
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 110.50 86.08% 265025.34 169991 400678 265075.60 248920 284311 29285915 29285915 0.00
crit 17.87 13.92% 530215.45 339987 801350 530229.65 423663 624038 9476918 9476918 0.00
 
 

Action details: incinerate

Static Values
  • id:29722
  • school:fire
  • resource:mana
  • range:40.0
  • travel_speed:20.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:66000.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:1.88
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:29722
  • name:Incinerate
  • school:fire
  • tooltip:
  • description:Draws fire toward the enemy, dealing {$s2=0} Fire damage.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:2.331000
  • base_dd_min:0.00
  • base_dd_max:0.00
 
Mark of the Hidden Satyr 10329 0.7% 20.2 14.84sec 153907 0 Direct 20.2 135009 270107 153906 14.0%  

Stats details: mark_of_the_hidden_satyr

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 20.16 20.16 0.00 0.00 0.0000 0.0000 3103178.41 3103178.41 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 17.34 86.01% 135009.26 128661 162412 135037.47 128661 147308 2341347 2341347 0.00
crit 2.82 13.99% 270106.80 257323 324824 254209.62 0 324824 761831 761831 0.00
 
 

Action details: mark_of_the_hidden_satyr

Static Values
  • id:191259
  • school:fire
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:191259
  • name:Mark of the Hidden Satyr
  • school:fire
  • tooltip:
  • description:Deals fire damage.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:2.500000
  • spell_power_mod.direct:2.000000
  • base_dd_min:0.00
  • base_dd_max:0.00
 
pet - imp 48927 / 48927
Firebolt 48927 3.5% 109.4 2.75sec 134344 111083 Direct 108.6 118844 237675 135382 13.9%  

Stats details: firebolt

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 109.43 108.59 0.00 0.00 1.2094 0.0000 14701640.24 14701640.24 0.00 111083.21 111083.21
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 93.48 86.08% 118844.05 75912 143737 118876.85 116134 121508 11109398 11109398 0.00
crit 15.11 13.92% 237675.01 151823 287475 237754.35 215707 265722 3592242 3592242 0.00
 
 

Action details: firebolt

Static Values
  • id:3110
  • school:fire
  • resource:energy
  • range:40.0
  • travel_speed:16.0000
  • trigger_gcd:0.5000
  • min_gcd:0.7500
  • base_cost:40.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:1.75
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:3110
  • name:Firebolt
  • school:fire
  • tooltip:
  • description:Deals {$s1=1} Fire damage to a target.$?a231795[ Damage increased by {$231795s1=50}% if you have Immolated the target.][] |cFF777777(Right-Click to toggle)|r
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:1.000000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
pet - service_imp 141663 / 45402
Firebolt 141663 3.2% 49.5 5.49sec 274689 242465 Direct 49.2 242363 484447 276360 14.0%  

Stats details: firebolt

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 49.53 49.23 0.00 0.00 1.1329 0.0000 13604934.76 13604934.76 0.00 242464.66 242464.66
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 42.32 85.96% 242362.74 151823 287475 242598.84 232257 252814 10255755 10255755 0.00
crit 6.91 14.04% 484447.21 303647 574949 484614.58 0 574949 3349179 3349179 0.00
 
 

Action details: firebolt

Static Values
  • id:3110
  • school:fire
  • resource:energy
  • range:40.0
  • travel_speed:16.0000
  • trigger_gcd:0.5000
  • min_gcd:0.7500
  • base_cost:40.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:1.75
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:3110
  • name:Firebolt
  • school:fire
  • tooltip:
  • description:Deals {$s1=1} Fire damage to a target.$?a231795[ Damage increased by {$231795s1=50}% if you have Immolated the target.][] |cFF777777(Right-Click to toggle)|r
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:1.000000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
pet - infernal 134293 / 11372
Immolation 104585 0.6% 1.0 0.00sec 2614729 0 Periodic 46.9 48989 97978 55794 13.9% 8.1%

Stats details: immolation

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 23.43 46.86 0.0000 1.0379 2614728.90 2614728.90 0.00 107509.10 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 40.4 86.11% 48988.78 42295 50754 48995.43 47553 50063 1976906 1976906 0.00
crit 6.5 13.89% 97978.28 84590 101507 97867.45 0 101507 637823 637823 0.00
 
 

Action details: immolation

Static Values
  • id:19483
  • school:fire
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:!ticking
Spelldata
  • id:19483
  • name:Immolation
  • school:fire
  • tooltip:Burns nearby enemies for {$20153s1=0} fire damage every $t1 seconds.
  • description:Burns nearby enemies for {$20153s1=0} fire damage every $t1 seconds.
 

Action details: immolation_tick

Static Values
  • id:20153
  • school:fire
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:20153
  • name:Immolation
  • school:fire
  • tooltip:
  • description:Deals Fire damage to all enemies near the caster.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.650000
  • base_dd_min:0.00
  • base_dd_max:0.00
 
melee 29708 0.2% 22.2 1.10sec 33475 30644 Direct 22.2 29341 58650 33475 14.1%  

Stats details: melee

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 22.19 22.19 0.00 0.00 1.0924 0.0000 742720.73 1091869.82 31.98 30644.09 30644.09
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 19.06 85.89% 29340.57 25292 30351 29341.70 28544 30351 559165 822025 31.98
crit 3.13 14.11% 58649.60 50585 60702 56745.89 0 60702 183556 269845 30.93
 
 

Action details: melee

Static Values
  • id:0
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Weapon
  • normalized:false
  • weapon_power_mod:0.285714
  • weapon_multiplier:1.00
 
pet - doomguard 110659 / 9360
Doom Bolt 110659 0.7% 11.1 2.19sec 250008 116596 Direct 11.1 219618 438914 250016 13.9%  

Stats details: doom_bolt

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 11.07 11.07 0.00 0.00 2.1443 0.0000 2766587.81 2766587.81 0.00 116595.91 116595.91
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 9.53 86.14% 219617.93 212293 254751 219623.62 212293 254751 2093289 2093289 0.00
crit 1.53 13.86% 438913.72 424586 509503 352154.74 0 509503 673299 673299 0.00
 
 

Action details: doom_bolt

Static Values
  • id:85692
  • school:shadow
  • resource:energy
  • range:30.0
  • travel_speed:20.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:35.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:3.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:85692
  • name:Doom Bolt
  • school:shadow
  • tooltip:
  • description:Sends a shadowy bolt at the enemy, causing {$s1=1} Shadow damage. Deals {$s2=20}% additional damage to targets below 20% health.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:2.750000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
pet - lord_of_flames_infernal 134373 / 11379
Immolation 104690 0.6% 1.0 0.00sec 2617360 0 Periodic 46.9 48987 97995 55850 14.0% 8.1%

Stats details: immolation

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 23.43 46.86 0.0000 1.0379 2617359.90 2617359.90 0.00 107617.28 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 40.3 86.00% 48987.40 42295 50754 48993.95 47746 50256 1974275 1974275 0.00
crit 6.6 14.00% 97995.16 84590 101507 97832.77 0 101507 643085 643085 0.00
 
 

Action details: immolation

Static Values
  • id:19483
  • school:fire
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:!ticking
Spelldata
  • id:19483
  • name:Immolation
  • school:fire
  • tooltip:Burns nearby enemies for {$20153s1=0} fire damage every $t1 seconds.
  • description:Burns nearby enemies for {$20153s1=0} fire damage every $t1 seconds.
 

Action details: immolation_tick

Static Values
  • id:20153
  • school:fire
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:20153
  • name:Immolation
  • school:fire
  • tooltip:
  • description:Deals Fire damage to all enemies near the caster.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.650000
  • base_dd_min:0.00
  • base_dd_max:0.00
 
melee 29683 0.2% 22.2 1.10sec 33447 30619 Direct 22.2 29336 58711 33447 14.0%  

Stats details: melee

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 22.19 22.19 0.00 0.00 1.0924 0.0000 742109.09 1090970.66 31.98 30618.85 30618.85
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 19.08 86.00% 29335.59 25292 30351 29336.40 28544 30085 559776 822924 31.98
crit 3.11 14.00% 58710.60 50585 60702 56658.75 0 60702 182333 268047 30.86
 
 

Action details: melee

Static Values
  • id:0
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Weapon
  • normalized:false
  • weapon_power_mod:0.285714
  • weapon_multiplier:1.00
 
pet - lord_of_flames_infernal 134294 / 11373
Immolation 104589 0.6% 1.0 0.00sec 2614830 0 Periodic 46.9 48988 97989 55796 13.9% 8.1%

Stats details: immolation

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 23.43 46.86 0.0000 1.0379 2614830.42 2614830.42 0.00 107513.28 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 40.4 86.11% 48987.92 42295 50754 48994.21 47582 50241 1976804 1976804 0.00
crit 6.5 13.89% 97988.95 84590 101507 97936.17 0 101507 638026 638026 0.00
 
 

Action details: immolation

Static Values
  • id:19483
  • school:fire
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:!ticking
Spelldata
  • id:19483
  • name:Immolation
  • school:fire
  • tooltip:Burns nearby enemies for {$20153s1=0} fire damage every $t1 seconds.
  • description:Burns nearby enemies for {$20153s1=0} fire damage every $t1 seconds.
 

Action details: immolation_tick

Static Values
  • id:20153
  • school:fire
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:20153
  • name:Immolation
  • school:fire
  • tooltip:
  • description:Deals Fire damage to all enemies near the caster.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.650000
  • base_dd_min:0.00
  • base_dd_max:0.00
 
melee 29705 0.2% 22.2 1.10sec 33472 30641 Direct 22.2 29338 58682 33471 14.1%  

Stats details: melee

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 22.19 22.19 0.00 0.00 1.0924 0.0000 742647.37 1091761.98 31.98 30641.06 30641.06
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 19.06 85.91% 29337.93 25292 30351 29338.72 28544 30351 559238 822133 31.98
crit 3.13 14.09% 58681.79 50585 60702 56537.92 0 60702 183409 269629 30.81
 
 

Action details: melee

Static Values
  • id:0
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Weapon
  • normalized:false
  • weapon_power_mod:0.285714
  • weapon_multiplier:1.00
 
pet - lord_of_flames_infernal 134238 / 11367
Immolation 104578 0.6% 1.0 0.00sec 2614559 0 Periodic 46.9 48986 98012 55789 13.9% 8.1%

Stats details: immolation

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 23.43 46.86 0.0000 1.0379 2614558.86 2614558.86 0.00 107502.11 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 40.4 86.12% 48986.02 42295 50754 48992.28 47733 50341 1977076 1977076 0.00
crit 6.5 13.88% 98012.46 84590 101507 97927.52 0 101507 637483 637483 0.00
 
 

Action details: immolation

Static Values
  • id:19483
  • school:fire
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:!ticking
Spelldata
  • id:19483
  • name:Immolation
  • school:fire
  • tooltip:Burns nearby enemies for {$20153s1=0} fire damage every $t1 seconds.
  • description:Burns nearby enemies for {$20153s1=0} fire damage every $t1 seconds.
 

Action details: immolation_tick

Static Values
  • id:20153
  • school:fire
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:20153
  • name:Immolation
  • school:fire
  • tooltip:
  • description:Deals Fire damage to all enemies near the caster.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.650000
  • base_dd_min:0.00
  • base_dd_max:0.00
 
melee 29660 0.2% 22.2 1.10sec 33421 30595 Direct 22.2 29335 58724 33422 13.9%  

Stats details: melee

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 22.19 22.19 0.00 0.00 1.0924 0.0000 741533.38 1090124.31 31.98 30595.10 30595.10
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 19.10 86.09% 29334.53 25292 30351 29335.07 28665 30351 560352 823770 31.98
crit 3.09 13.91% 58723.91 50585 60702 56480.51 0 60702 181181 266354 30.77
 
 

Action details: melee

Static Values
  • id:0
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Weapon
  • normalized:false
  • weapon_power_mod:0.285714
  • weapon_multiplier:1.00
 
pet - shadowy_tear 135756 / 17777
Shadow Bolt 135756 1.3% 3.2 72.26sec 1639823 0 Periodic 36.1 129485 258490 147455 13.9% 14.7%

Stats details: shadow_bolt

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 3.24 0.00 36.27 36.08 0.0000 1.2193 5319839.07 5319839.07 0.00 120293.03 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 31.1 86.07% 129485.02 70 156167 128820.91 0 156167 4020771 4020771 0.00
crit 5.0 13.93% 258490.48 164 312334 249087.86 0 312334 1299068 1299068 0.00
 
 

Action details: shadow_bolt

Static Values
  • id:196657
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:20.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:196657
  • name:Shadow Bolt
  • school:shadow
  • tooltip:
  • description:Sends a shadowy bolt at the enemy, causing {$s1=1} Shadow damage.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • dot_duration:14.00
  • base_tick_time:2.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
 
pet - flame_rift 281310 / 77125
Searing Bolt 281310 5.4% 63.8 2.68sec 361921 1118060 Direct 63.5 66752 0 66752 0.0%  
Periodic 135.3 122335 244852 139406 13.9% 44.5%

Stats details: searing_bolt

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 63.82 63.45 135.31 135.31 0.3237 0.9897 23099115.00 23099115.00 0.00 149425.66 1118059.78
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 63.45 100.00% 66751.75 61858 78084 66773.30 0 78084 4235472 4235472 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 116.5 86.07% 122335.00 124 156195 121760.20 0 139738 14247057 14247057 0.00
crit 18.9 13.93% 244851.66 297 312389 243462.78 0 312389 4616587 4616587 0.00
 
 

Action details: searing_bolt

Static Values
  • id:243050
  • school:fire
  • resource:energy
  • range:100.0
  • travel_speed:20.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:1.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:243050
  • name:Searing Bolt
  • school:fire
  • tooltip:Burning for $w2 Fire damage every $t2 sec.
  • description:Sends a searing bolt at the enemy, causing {$s1=1} Fire damage, and an additional $o2 Fire damage over {$d=30 seconds}, stacking up to {$u=20} times.
Direct Damage
  • may_crit:false
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:1.000000
  • base_dd_min:1.00
  • base_dd_max:1.00
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.100000
  • base_td:1.00
  • dot_duration:30.00
  • base_tick_time:1.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
 
pet - chaos_tear 157435 / 8124
Chaos Bolt 157435 0.6% 3.2 72.02sec 755443 383321 Direct 3.2 0 760978 760978 100.0%  

Stats details: chaos_bolt

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 3.22 3.20 0.00 0.00 1.9711 0.0000 2432936.57 2432936.57 0.00 383320.71 383320.71
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
crit 3.20 100.00% 760978.31 704810 889697 760661.55 0 889697 2432937 2432937 0.00
 
 

Action details: chaos_bolt

Static Values
  • id:215279
  • school:chromatic
  • resource:none
  • range:100.0
  • travel_speed:16.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:5.500
  • base_execute_time:3.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:215279
  • name:Chaos Bolt
  • school:chromatic
  • tooltip:
  • description:Unleashes a devastating blast of chaos, causing {$s1=1} Chaos damage. Chaos Bolt always critically strikes and your critical strike chance increases its damage.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:5.000000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
pet - chaos_portal 286405 / 16104
Chaos Barrage 286405 1.1% 3.2 72.47sec 1487608 0 Periodic 114.8 36803 73626 41930 13.9% 5.8%

Stats details: chaos_barrage

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 3.24 0.00 115.33 114.80 0.0000 0.1524 4813636.23 4813636.23 0.00 273906.69 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 98.8 86.07% 36802.84 153 42947 36628.32 0 42947 3636606 3636606 0.00
crit 16.0 13.93% 73625.95 311 85894 73165.87 0 85894 1177030 1177030 0.00
 
 

Action details: chaos_barrage

Static Values
  • id:187394
  • school:magic
  • resource:none
  • range:100.0
  • travel_speed:24.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:187394
  • name:Chaos Barrage
  • school:magic
  • tooltip:
  • description:Deals {$s1=1} Chaos damage.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • dot_duration:5.50
  • base_tick_time:0.25
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
 
Simple Action Stats Execute Interval
Feretory
augmentation 1.0 0.00sec

Stats details: augmentation

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: augmentation

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Feretory
  • harmful:false
  • if_expr:
 
Berserking 2.1 180.66sec

Stats details: berserking

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.06 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: berserking

Static Values
  • id:26297
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:180.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:26297
  • name:Berserking
  • school:physical
  • tooltip:Haste increased by {$s1=15}%.
  • description:Increases your haste by {$s1=15}% for {$d=10 seconds}.
 
Dimensional Rift 12.5 24.49sec

Stats details: dimensional_rift

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 12.51 0.00 0.00 0.00 1.0037 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: dimensional_rift

Static Values
  • id:196586
  • school:none
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:45.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:charges=3
Spelldata
  • id:196586
  • name:Dimensional Rift
  • school:chaos
  • tooltip:
  • description:Rips a hole in time and space, opening a portal that damages your target.
 
flask 1.0 0.00sec

Stats details: flask

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: flask

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Feretory
  • harmful:false
  • if_expr:
 
food 1.0 0.00sec

Stats details: food

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: food

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Feretory
  • harmful:false
  • if_expr:
 
Havoc 14.9 20.88sec

Stats details: havoc

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 14.92 0.00 0.00 0.00 1.0605 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: havoc

Static Values
  • id:80240
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:88000.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:active_enemies>1&(active_enemies<4|talent.wreak_havoc.enabled&active_enemies<6)&!debuff.havoc.remains
Spelldata
  • id:80240
  • name:Havoc
  • school:shadow
  • tooltip:Spells cast by the Warlock also hit this target.
  • description:Marks a target with Havoc for {$d=8 seconds}, causing your single target spells to also strike the Havoc victim. Limit 1.
 
Life Tap 5.0 40.28sec

Stats details: life_tap

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 5.03 0.00 0.00 0.00 1.0305 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: life_tap

Static Values
  • id:1454
  • school:shadow
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:talent.empowered_life_tap.enabled&!buff.empowered_life_tap.remains
Spelldata
  • id:1454
  • name:Life Tap
  • school:shadow
  • tooltip:
  • description:Restores {$s1=30}% of your maximum mana, at the cost of {$s2=10}% of your maximum health.
 
potion 2.0 0.00sec

Stats details: potion

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: potion

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:60.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
 
Grimoire: Imp (service_imp) 3.7 91.21sec

Stats details: service_imp

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 3.70 0.00 0.00 0.00 0.9638 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: service_imp

Static Values
  • id:111859
  • school:shadow
  • resource:soul_shard
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:1.0
  • secondary_cost:0.0
  • cooldown:90.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:111859
  • name:Grimoire: Imp
  • school:shadow
  • tooltip:
  • description:Summons an Imp who attacks the target for {$108501s1=25} sec. Imps cast ranged Firebolts and cleanse a hostile magic effect from their master.
 
Soul Harvest 2.9 120.83sec

Stats details: soul_harvest

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.90 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: soul_harvest

Static Values
  • id:196098
  • school:shadow
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:120.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:196098
  • name:Soul Harvest
  • school:shadow
  • tooltip:Damage increased by {$s1=20}%.
  • description:Increases your damage and your pets' damage by {$s1=20}%. Lasts {$d=15 seconds}, increased by {$s2=2} sec for each target afflicted by your {$?s137043=false}[Agony][]{$?s137044=false}[Doom][]{$?s137046=false}[Immolate][], up to a maximum of {$s3=35} sec.
 
Summon Doomguard 1.0 0.00sec

Stats details: summon_doomguard

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 1.0713 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: summon_doomguard

Static Values
  • id:18540
  • school:shadow
  • resource:soul_shard
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:1.0
  • secondary_cost:0.0
  • cooldown:180.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:talent.grimoire_of_supremacy.enabled&active_enemies=1&artifact.lord_of_flames.rank=0
Spelldata
  • id:18540
  • name:Summon Doomguard
  • school:shadow
  • tooltip:
  • description:Summons a Doomguard for {$60478d=25 seconds} to assault the target with its Doom Bolts.
 
Summon Imp 1.0 0.00sec

Stats details: summon_imp

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: summon_imp

Static Values
  • id:688
  • school:shadow
  • resource:soul_shard
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:1.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:2.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:!talent.grimoire_of_supremacy.enabled&(!talent.grimoire_of_sacrifice.enabled|buff.demonic_power.down)
Spelldata
  • id:688
  • name:Summon Imp
  • school:shadow
  • tooltip:
  • description:Summons an Imp under your command that casts ranged Firebolts.$?s74434[ |cFFFFFFFFSoulburn:|r |cFF8282FFInstant cast.|r][]
 
Summon Infernal 1.0 0.00sec

Stats details: summon_infernal

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.7562 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: summon_infernal

Static Values
  • id:1122
  • school:shadow
  • resource:soul_shard
  • range:30.0
  • travel_speed:1.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:1.0
  • secondary_cost:0.0
  • cooldown:180.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:talent.grimoire_of_supremacy.enabled&artifact.lord_of_flames.rank>0
Spelldata
  • id:1122
  • name:Summon Infernal
  • school:shadow
  • tooltip:
  • description:Summons an Infernal from the Twisting Nether, impacting for {$22703s1=0} Fire damage and stunning all enemy targets in the area for {$22703d=2 seconds}. The Infernal will serve you for {$111685d=25 seconds}, dealing strong area-of-effect damage.
 

Buffs

Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit Overflow Expiry
Accelerando 20.1 0.0 15.4sec 15.4sec 78.41% 78.41% 1.5(1.5) 19.3

Buff details

  • buff initial source:Feretory
  • cooldown name:buff_accelerando
  • max_stacks:5
  • duration:12.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00

Stat Buff details

  • stat:haste_rating
  • amount:734.41

Stack Uptimes

  • accelerando_1:29.65%
  • accelerando_2:24.46%
  • accelerando_3:14.61%
  • accelerando_4:6.62%
  • accelerando_5:3.06%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:225719
  • name:Accelerando
  • tooltip:Haste increased by $w1.
  • description:{$@spelldesc225125=Your damaging spells have a chance to grant you {$225719s1=528} Haste for {$225719d=12 seconds}, stacking up to 5 times. Stacking does not refresh duration.}
  • max_stacks:5
  • duration:12.00
  • cooldown:0.00
  • default_chance:101.00%
Berserking 2.1 0.0 180.7sec 180.7sec 6.86% 8.55% 0.0(0.0) 2.0

Buff details

  • buff initial source:Feretory
  • cooldown name:buff_berserking
  • max_stacks:1
  • duration:10.00
  • cooldown:180.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • berserking_1:6.86%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:26297
  • name:Berserking
  • tooltip:Haste increased by {$s1=15}%.
  • description:Increases your haste by {$s1=15}% for {$d=10 seconds}.
  • max_stacks:0
  • duration:10.00
  • cooldown:180.00
  • default_chance:0.00%
Bloodlust 1.0 0.0 0.0sec 0.0sec 13.55% 13.55% 0.0(0.0) 1.0

Buff details

  • buff initial source:Feretory
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • duration:40.00
  • cooldown:300.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • bloodlust_1:13.55%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:2825
  • name:Bloodlust
  • tooltip:Haste increased by {$s1=30}%.
  • description:Increases Haste by {$s1=30}% for all party and raid members for {$d=40 seconds}. Allies receiving this effect will become Sated and unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.
  • max_stacks:0
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
Conflagration of Chaos 24.3 0.0 12.2sec 12.2sec 49.25% 47.53% 0.0(0.0) 0.7

Buff details

  • buff initial source:Feretory
  • cooldown name:buff_conflagration_of_chaos
  • max_stacks:1
  • duration:20.00
  • cooldown:0.00
  • default_chance:50.00%
  • default_value:-0.00

Stack Uptimes

  • conflagration_of_chaos_1:49.25%

Trigger Attempt Success

  • trigger_pct:49.92%

Spelldata details

  • id:196546
  • name:Conflagration of Chaos
  • tooltip:Your {$?s17877=false}[Shadowburn][Conflagrate] will always critically strike. Critical strike chance will increase the critical strike damage of {$?s17877=false}[Shadowburn][Conflagrate].
  • description:{$@spelldesc219195={$?s17877=false}[Shadowburn][Conflagrate] has a chance to guarantee your next {$?s17877=false}[Shadowburn][Conflagrate] critically strikes, and to increase its damage by your critical strike chance.}
  • max_stacks:0
  • duration:20.00
  • cooldown:0.00
  • default_chance:100.00%
Devil's Due 3.4 0.0 69.8sec 69.8sec 8.65% 8.65% 0.0(0.0) 3.2

Buff details

  • buff initial source:Feretory
  • cooldown name:buff_devils_due
  • max_stacks:1
  • duration:8.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.18

Stack Uptimes

  • devils_due_1:8.65%

Trigger Attempt Success

  • trigger_pct:99.97%

Spelldata details

  • id:225776
  • name:Devil's Due
  • tooltip:Cast speed slowed by {$s1=7}%.
  • description:{$@spelldesc225142=Your damaging spells have a chance to grant Nefarious Pact, increasing your casting speed by {$225774s1=17}% for {$225774d=12 seconds}. When Nefarious Pact expires, your casting speed is decreased by {$225776s1=7}% for {$225776d=8 seconds}.}
  • max_stacks:0
  • duration:8.00
  • cooldown:0.00
  • default_chance:0.00%
Embrace Chaos 30.7 44.8 9.9sec 3.9sec 74.75% 86.35% 44.8(44.8) 30.0

Buff details

  • buff initial source:Feretory
  • cooldown name:buff_embrace_chaos
  • max_stacks:1
  • duration:4.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • embrace_chaos_1:74.75%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:212019
  • name:Embrace Chaos
  • tooltip:Chaos Bolt has {$s1=40}% reduced cast time.
  • description:{$@spelldesc212018=Casting Chaos Bolt reduces the cast time of your next Chaos Bolt by {$212019s1=40}% for {$212019d=4 seconds}.}
  • max_stacks:0
  • duration:4.00
  • cooldown:0.00
  • default_chance:0.00%
Lord of Flames 1.0 0.0 0.0sec 0.0sec 97.99% 97.99% 0.0(0.0) 0.0

Buff details

  • buff initial source:Feretory
  • cooldown name:buff_lord_of_flames
  • max_stacks:1
  • duration:600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • lord_of_flames_1:97.99%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:226802
  • name:Lord of Flames
  • tooltip:Recently activated Lord of Flames.
  • description:{$@spelldesc224103=Once every {$s2=10} minutes, {$?s152107=false}[your Infernal's Meteor Strike][Summon Infernal] will summon {$s3=3} additional Infernals to serve you for {$226804d=25 seconds}.}
  • max_stacks:0
  • duration:600.00
  • cooldown:0.00
  • default_chance:0.00%
Nefarious Pact 3.4 0.0 70.2sec 69.4sec 13.45% 13.45% 0.0(0.0) 3.3

Buff details

  • buff initial source:Feretory
  • cooldown name:buff_nefarious_pact
  • max_stacks:1
  • duration:12.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.44

Stack Uptimes

  • nefarious_pact_1:13.45%

Trigger Attempt Success

  • trigger_pct:99.97%

Spelldata details

  • id:225774
  • name:Nefarious Pact
  • tooltip:Cast speed increased by {$s1=17}%.
  • description:{$@spelldesc225142=Your damaging spells have a chance to grant Nefarious Pact, increasing your casting speed by {$225774s1=17}% for {$225774d=12 seconds}. When Nefarious Pact expires, your casting speed is decreased by {$225776s1=7}% for {$225776d=8 seconds}.}
  • max_stacks:0
  • duration:12.00
  • cooldown:0.00
  • default_chance:0.00%
Potion of Deadly Grace 1.0 0.0 0.0sec 0.0sec 10.16% 10.16% 0.0(0.0) 1.0

Buff details

  • buff initial source:Feretory
  • cooldown name:buff_potion_of_deadly_grace
  • max_stacks:1
  • duration:30.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • potion_of_deadly_grace_1:10.16%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:188027
  • name:Potion of Deadly Grace
  • tooltip:Your attacks have a chance to unleash a bolt of energy at your target.
  • description:Grants your attacks a chance to unleash a bolt of energy at your target. Staying away from enemies for the entire duration of the effect will extend the effect by an additional 5 seconds.
  • max_stacks:0
  • duration:25.00
  • cooldown:1.00
  • default_chance:101.00%
Potion of Prolonged Power 1.0 0.0 0.0sec 0.0sec 19.64% 19.64% 0.0(0.0) 1.0

Buff details

  • buff initial source:Feretory
  • cooldown name:buff_potion_of_prolonged_power
  • max_stacks:1
  • duration:60.00
  • cooldown:1.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:all
  • amount:2500.00

Stack Uptimes

  • potion_of_prolonged_power_1:19.64%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:229206
  • name:Potion of Prolonged Power
  • tooltip:All stats increased by {$s1=2500}.
  • description:Drink to increase all stats by {$s1=2500} for {$d=60 seconds}.
  • max_stacks:0
  • duration:60.00
  • cooldown:1.00
  • default_chance:0.00%
Soul Harvest 2.9 0.0 120.8sec 120.8sec 17.81% 17.81% 0.0(0.0) 2.7

Buff details

  • buff initial source:Feretory
  • cooldown name:buff_soul_harvest
  • max_stacks:1
  • duration:15.00
  • cooldown:120.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • soul_harvest_1:17.81%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:196098
  • name:Soul Harvest
  • tooltip:Damage increased by {$s1=20}%.
  • description:Increases your damage and your pets' damage by {$s1=20}%. Lasts {$d=15 seconds}, increased by {$s2=2} sec for each target afflicted by your {$?s137043=false}[Agony][]{$?s137044=false}[Doom][]{$?s137046=false}[Immolate][], up to a maximum of {$s3=35} sec.
  • max_stacks:0
  • duration:15.00
  • cooldown:120.00
  • default_chance:0.00%
Constant Buffs
Well Fed (azshari_salad)

Buff details

  • buff initial source:Feretory
  • cooldown name:buff_azshari_salad
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:haste_rating
  • amount:375.00

Stack Uptimes

  • azshari_salad_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:225603
  • name:Well Fed
  • tooltip:Haste increased by $w1.
  • description:Increases haste by {$s1=375} for {$d=3600 seconds}.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Defiled Augmentation

Buff details

  • buff initial source:Feretory
  • cooldown name:buff_defiled_augmentation
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:agility
  • amount:325.00
  • stat:strength
  • amount:325.00
  • stat:intellect
  • amount:325.00

Stack Uptimes

  • defiled_augmentation_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:224001
  • name:Defiled Augmentation
  • tooltip:Agility, Intellect and Strength increased by $w1.
  • description:Increases Agility, Intellect and Strength by {$s1=325} for {$d=3600 seconds}. Augment Rune.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Flask of the Whispered Pact

Buff details

  • buff initial source:Feretory
  • cooldown name:buff_flask_of_the_whispered_pact
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:intellect
  • amount:1300.00

Stack Uptimes

  • flask_of_the_whispered_pact_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:188031
  • name:Flask of the Whispered Pact
  • tooltip:Intellect increased by $w1.
  • description:Increases Intellect by {$s1=1300} for {$d=3600 seconds}. Counts as both a Battle and Guardian elixir. This effect persists through death.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:101.00%
Tormented Souls

Buff details

  • buff initial source:Feretory
  • cooldown name:buff_tormented_souls
  • max_stacks:12
  • duration:0.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00

Stack Uptimes

  • tormented_souls_2:0.37%
  • tormented_souls_3:99.63%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:216695
  • name:Tormented Souls
  • tooltip:Activate Reap Souls to consume all Tormented Souls collected by |cFFFFCC99Ulthalesh|r, increasing your damage by 10% and doubling the effect of all of |cFFFFCC99Ulthalesh|r's other traits for {$216708d=5 seconds} per soul consumed.
  • description:Activate Reap Souls to consume all Tormented Souls collected by |cFFFFCC99Ulthalesh|r, increasing your damage by 10% and doubling the effect of all of |cFFFFCC99Ulthalesh|r's other traits for {$216708d=5 seconds} per soul consumed.
  • max_stacks:12
  • duration:-0.00
  • cooldown:0.00
  • default_chance:101.00%

Procs

Count Interval
shadowy_tear 3.1 72.2sec
flame_rift 3.1 72.7sec
chaos_tear 3.1 72.1sec
chaos_portal 3.1 72.5sec
dimension_ripper 3.4 59.8sec
t19_2pc_chaos_bolt 60.5 4.8sec

Resources

Resource Usage Type Count Total Average RPE APR
Feretory
chaos_bolt Soul Shard 75.5 151.1 2.0 2.0 963423.9
havoc Mana 14.9 1312795.0 88000.0 88000.2 0.0
immolate Mana 20.2 1331850.0 66000.0 65999.8 68.5
incinerate Mana 67.3 4439240.6 66000.0 66000.9 8.7
service_imp Soul Shard 3.7 3.7 1.0 1.0 0.0
summon_doomguard Soul Shard 1.0 1.0 1.0 1.0 0.0
summon_infernal Soul Shard 1.0 1.0 1.0 1.0 0.0
pet - imp
firebolt Energy 109.4 4377.3 40.0 40.0 3358.6
pet - service_imp
firebolt Energy 49.5 1981.2 40.0 40.0 6867.1
pet - doomguard
doom_bolt Energy 11.1 387.3 35.0 35.0 7143.1
pet - flame_rift
searing_bolt Energy 61.8 61.8 1.0 1.0 373953.2
Resource Gains Type Count Total Average Overflow
life_tap Mana 5.03 1661249.63 (26.71%) 330000.00 0.00 0.00%
immolate Soul Shard 71.87 69.38 (44.37%) 0.97 2.49 3.46%
conflagrate Soul Shard 48.67 48.37 (30.93%) 0.99 0.30 0.62%
mp5_regen Mana 540.79 4557419.05 (73.29%) 8427.36 100940.88 2.17%
soulsnatcher Soul Shard 11.29 11.29 (7.22%) 1.00 0.00 0.00%
feretory_of_souls Soul Shard 27.66 27.33 (17.48%) 0.99 0.33 1.21%
pet - imp
energy_regen Energy 1902.47 4210.98 (100.00%) 2.21 21.60 0.51%
pet - service_imp
energy_regen Energy 449.36 1364.31 (100.00%) 3.04 62.17 4.36%
pet - doomguard
energy_regen Energy 15.77 346.54 (100.00%) 21.98 42.96 11.03%
Resource RPS-Gain RPS-Loss
Health 0.00 5526.85
Mana 20659.16 23533.65
Soul Shard 0.52 0.52
Combat End Resource Mean Min Max
Mana 230481.11 3023.00 513573.91
Soul Shard 2.67 0.00 5.00

Benefits & Uptimes

Benefits %
Uptimes %
Mana Cap 1.6%

Statistics & Data Analysis

Fight Length
Sample Data Feretory Fight Length
Count 9999
Mean 301.01
Minimum 217.68
Maximum 385.07
Spread ( max - min ) 167.39
Range [ ( max - min ) / 2 * 100% ] 27.80%
DPS
Sample Data Feretory Damage Per Second
Count 9999
Mean 1414712.13
Minimum 1206680.17
Maximum 1668856.50
Spread ( max - min ) 462176.32
Range [ ( max - min ) / 2 * 100% ] 16.33%
Standard Deviation 59088.1480
5th Percentile 1321275.76
95th Percentile 1517514.82
( 95th Percentile - 5th Percentile ) 196239.06
Mean Distribution
Standard Deviation 590.9110
95.00% Confidence Intervall ( 1413553.96 - 1415870.29 )
Normalized 95.00% Confidence Intervall ( 99.92% - 100.08% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 68
0.1% Error 6702
0.1 Scale Factor Error with Delta=300 29804678
0.05 Scale Factor Error with Delta=300 119218710
0.01 Scale Factor Error with Delta=300 2980467737
Priority Target DPS
Sample Data Feretory Priority Target Damage Per Second
Count 9999
Mean 837480.82
Minimum 704389.93
Maximum 1032443.66
Spread ( max - min ) 328053.73
Range [ ( max - min ) / 2 * 100% ] 19.59%
Standard Deviation 43750.3082
5th Percentile 770192.70
95th Percentile 914241.61
( 95th Percentile - 5th Percentile ) 144048.92
Mean Distribution
Standard Deviation 437.5250
95.00% Confidence Intervall ( 836623.28 - 838338.35 )
Normalized 95.00% Confidence Intervall ( 99.90% - 100.10% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 105
0.1% Error 10484
0.1 Scale Factor Error with Delta=300 16339769
0.05 Scale Factor Error with Delta=300 65359075
0.01 Scale Factor Error with Delta=300 1633976864
DPS(e)
Sample Data Feretory Damage Per Second (Effective)
Count 9999
Mean 1414712.13
Minimum 1206680.17
Maximum 1668856.50
Spread ( max - min ) 462176.32
Range [ ( max - min ) / 2 * 100% ] 16.33%
Damage
Sample Data Feretory Damage
Count 9999
Mean 345718889.51
Minimum 239403524.82
Maximum 458785221.02
Spread ( max - min ) 219381696.19
Range [ ( max - min ) / 2 * 100% ] 31.73%
DTPS
Sample Data Feretory Damage Taken Per Second
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HPS
Sample Data Feretory Healing Per Second
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
HPS(e)
Sample Data Feretory Healing Per Second (Effective)
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
Sample Data Feretory Heal
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
Sample Data Feretory Healing Taken Per Second
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
TMI
Sample Data Feretory Theck-Meloree Index
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
ETMI
Sample Data FeretoryTheck-Meloree Index (Effective)
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
MSD
Sample Data Feretory Max Spike Value
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 flask,type=whispered_pact
1 0.00 food,type=azshari_salad
2 0.00 summon_pet,if=!talent.grimoire_of_supremacy.enabled&(!talent.grimoire_of_sacrifice.enabled|buff.demonic_power.down)
3 0.00 summon_infernal,if=talent.grimoire_of_supremacy.enabled&artifact.lord_of_flames.rank>0
4 0.00 summon_infernal,if=talent.grimoire_of_supremacy.enabled&active_enemies>1
5 0.00 summon_doomguard,if=talent.grimoire_of_supremacy.enabled&active_enemies=1&artifact.lord_of_flames.rank=0
6 0.00 augmentation,type=defiled
7 0.00 snapshot_stats
8 0.00 grimoire_of_sacrifice,if=talent.grimoire_of_sacrifice.enabled
9 0.00 life_tap,if=talent.empowered_life_tap.enabled&!buff.empowered_life_tap.remains
A 0.00 potion,name=prolonged_power
B 0.00 chaos_bolt
Default action list Executed every time the actor is available.
# count action,conditions
C 14.92 havoc,target=2,if=active_enemies>1&(active_enemies<4|talent.wreak_havoc.enabled&active_enemies<6)&!debuff.havoc.remains
D 1.00 dimensional_rift,if=charges=3
E 10.40 immolate,if=remains<=tick_time
F 0.72 immolate,cycle_targets=1,if=active_enemies>1&remains<=tick_time&(!talent.roaring_blaze.enabled|(!debuff.roaring_blaze.remains&action.conflagrate.charges<2+set_bonus.tier19_4pc))
G 9.11 immolate,if=talent.roaring_blaze.enabled&remains<=duration&!debuff.roaring_blaze.remains&target.time_to_die>10&(action.conflagrate.charges=2+set_bonus.tier19_4pc|(action.conflagrate.charges>=1+set_bonus.tier19_4pc&action.conflagrate.recharge_time<cast_time+gcd)|target.time_to_die<24)
H 2.06 berserking
0.00 blood_fury
0.00 arcane_torrent
I 1.00 potion,name=deadly_grace,if=(buff.soul_harvest.remains|trinket.proc.any.react|target.time_to_die<=45)
0.00 shadowburn,if=buff.conflagration_of_chaos.remains<=action.chaos_bolt.cast_time
0.00 shadowburn,if=(charges=1+set_bonus.tier19_4pc&recharge_time<action.chaos_bolt.cast_time|charges=2+set_bonus.tier19_4pc)&soul_shard<5
J 14.46 conflagrate,if=talent.roaring_blaze.enabled&(charges=2+set_bonus.tier19_4pc|(charges>=1+set_bonus.tier19_4pc&recharge_time<gcd)|target.time_to_die<24)
K 34.21 conflagrate,if=talent.roaring_blaze.enabled&debuff.roaring_blaze.stack>0&dot.immolate.remains>dot.immolate.duration*0.3&(active_enemies=1|soul_shard<3)&soul_shard<5
0.00 conflagrate,if=!talent.roaring_blaze.enabled&buff.backdraft.stack<3&buff.conflagration_of_chaos.remains<=action.chaos_bolt.cast_time
0.00 conflagrate,if=!talent.roaring_blaze.enabled&buff.backdraft.stack<3&(charges=1+set_bonus.tier19_4pc&recharge_time<action.chaos_bolt.cast_time|charges=2+set_bonus.tier19_4pc)&soul_shard<5
0.00 life_tap,if=talent.empowered_life_tap.enabled&buff.empowered_life_tap.remains<=gcd
0.00 dimensional_rift,if=equipped.144369&!buff.lessons_of_spacetime.remains&((!talent.grimoire_of_supremacy.enabled&!cooldown.summon_doomguard.remains)|(talent.grimoire_of_service.enabled&!cooldown.service_pet.remains)|(talent.soul_harvest.enabled&!cooldown.soul_harvest.remains))
L 3.70 service_pet
M 1.00 summon_infernal,if=artifact.lord_of_flames.rank>0&!buff.lord_of_flames.remains
N 1.00 summon_doomguard,if=!talent.grimoire_of_supremacy.enabled&spell_targets.infernal_awakening<=2&(target.time_to_die>180|target.health.pct<=20|target.time_to_die<30)
0.00 summon_infernal,if=!talent.grimoire_of_supremacy.enabled&spell_targets.infernal_awakening>2
0.00 summon_doomguard,if=talent.grimoire_of_supremacy.enabled&spell_targets.summon_infernal=1&artifact.lord_of_flames.rank>0&buff.lord_of_flames.remains&!pet.doomguard.active
0.00 summon_doomguard,if=talent.grimoire_of_supremacy.enabled&spell_targets.summon_infernal=1&equipped.132379&!cooldown.sindorei_spite_icd.remains
0.00 summon_infernal,if=talent.grimoire_of_supremacy.enabled&spell_targets.summon_infernal>1&equipped.132379&!cooldown.sindorei_spite_icd.remains
O 2.90 soul_harvest
0.00 channel_demonfire,if=dot.immolate.remains>cast_time
0.00 havoc,if=active_enemies=1&talent.wreak_havoc.enabled&equipped.132375&!debuff.havoc.remains
0.00 rain_of_fire,if=active_enemies>=3&cooldown.havoc.remains<=12&!talent.wreak_havoc.enabled
0.00 rain_of_fire,if=active_enemies>=6&talent.wreak_havoc.enabled
P 11.51 dimensional_rift,if=!equipped.144369|charges>1|((!talent.grimoire_of_service.enabled|recharge_time<cooldown.service_pet.remains)&(!talent.soul_harvest.enabled|recharge_time<cooldown.soul_harvest.remains)&(!talent.grimoire_of_supremacy.enabled|recharge_time<cooldown.summon_doomguard.remains))
0.00 life_tap,if=talent.empowered_life_tap.enabled&buff.empowered_life_tap.remains<duration*0.3
0.00 cataclysm
Q 74.88 chaos_bolt,if=(cooldown.havoc.remains>12&cooldown.havoc.remains|active_enemies<3|talent.wreak_havoc.enabled&active_enemies<6)&(set_bonus.tier19_4pc=0|!talent.eradication.enabled|buff.embrace_chaos.remains<=cast_time|soul_shard>=3)
0.00 shadowburn
0.00 conflagrate,if=!talent.roaring_blaze.enabled&buff.backdraft.stack<3
0.00 immolate,if=!talent.roaring_blaze.enabled&remains<=duration*0.3
R 67.56 incinerate
S 5.03 life_tap

Sample Sequence

0126ABCDEGHJLMKOPPQKQKRKQRRRKPQCRRRERRRRRRQGJKQKRPQQQKCQKPQQRRQERRQRCGJKQKRRQKRQRRSQKQRCREPQRPRQLGJKQKCQQKRQRKQRRQERSQCROIRQRGJKQPQQKKQCRQQKQRERQRRRRSGCJQKKQKFQRRKPQHQCLERQRRRQGJQQKKQQKCQRQQKQQREQRRQQPCNSGJQQKKQQKQRQRRQKCOQRQQERQRRQRSRQGJQKCJPJQQLJRQRRJEQCRJQQR

Sample Sequence Table

time list # name target resources buffs
Pre precombat 0 flask Feretory 1100000.0/1100000: 100% mana | 3.0/5: 60% soul_shard
Pre precombat 1 food Feretory 1100000.0/1100000: 100% mana | 3.0/5: 60% soul_shard
Pre precombat 2 summon_imp Fluffy_Pillow 1100000.0/1100000: 100% mana | 3.0/5: 60% soul_shard
Pre precombat 6 augmentation Feretory 1100000.0/1100000: 100% mana | 3.0/5: 60% soul_shard
Pre precombat A potion Fluffy_Pillow 1100000.0/1100000: 100% mana | 3.0/5: 60% soul_shard potion_of_prolonged_power
0:00.000 precombat B chaos_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 1.0/5: 20% soul_shard embrace_chaos, accelerando, potion_of_prolonged_power
0:00.000 default C havoc enemy2 1100000.0/1100000: 100% mana | 1.0/5: 20% soul_shard embrace_chaos, accelerando, potion_of_prolonged_power
0:01.136 default D dimensional_rift Fluffy_Pillow 1033518.9/1100000: 94% mana | 1.0/5: 20% soul_shard bloodlust, embrace_chaos, accelerando, potion_of_prolonged_power
0:02.013 default E immolate Fluffy_Pillow 1050131.7/1100000: 95% mana | 1.0/5: 20% soul_shard bloodlust, embrace_chaos, accelerando, potion_of_prolonged_power
0:02.888 default G immolate Fluffy_Pillow 1000706.6/1100000: 91% mana | 1.0/5: 20% soul_shard bloodlust, embrace_chaos, accelerando, potion_of_prolonged_power
0:03.764 default H berserking Fluffy_Pillow 951300.4/1100000: 86% mana | 1.0/5: 20% soul_shard bloodlust, embrace_chaos, accelerando, potion_of_prolonged_power
0:03.764 default J conflagrate Fluffy_Pillow 951300.4/1100000: 86% mana | 1.0/5: 20% soul_shard bloodlust, berserking, embrace_chaos, accelerando, potion_of_prolonged_power
0:04.526 default L service_imp Fluffy_Pillow 967900.0/1100000: 88% mana | 3.0/5: 60% soul_shard bloodlust, berserking, conflagration_of_chaos, accelerando, potion_of_prolonged_power
0:05.287 default M summon_infernal Fluffy_Pillow 984477.7/1100000: 89% mana | 3.0/5: 60% soul_shard bloodlust, berserking, conflagration_of_chaos, accelerando, potion_of_prolonged_power
0:06.048 default K conflagrate Fluffy_Pillow 1001300.7/1100000: 91% mana | 2.0/5: 40% soul_shard bloodlust, berserking, lord_of_flames, conflagration_of_chaos, accelerando(2), potion_of_prolonged_power
0:06.804 default O soul_harvest Fluffy_Pillow 1018013.2/1100000: 93% mana | 3.0/5: 60% soul_shard bloodlust, berserking, lord_of_flames, accelerando(2), potion_of_prolonged_power
0:06.804 default P dimensional_rift Fluffy_Pillow 1018013.2/1100000: 93% mana | 3.0/5: 60% soul_shard bloodlust, berserking, soul_harvest, lord_of_flames, accelerando(2), potion_of_prolonged_power
0:07.558 default P dimensional_rift Fluffy_Pillow 1034681.5/1100000: 94% mana | 3.0/5: 60% soul_shard bloodlust, berserking, soul_harvest, lord_of_flames, accelerando(2), potion_of_prolonged_power
0:08.312 default Q chaos_bolt Fluffy_Pillow 1051592.5/1100000: 96% mana | 4.0/5: 80% soul_shard bloodlust, berserking, soul_harvest, lord_of_flames, accelerando(3), potion_of_prolonged_power
0:09.786 default K conflagrate Fluffy_Pillow 1084651.8/1100000: 99% mana | 2.0/5: 40% soul_shard bloodlust, berserking, soul_harvest, lord_of_flames, embrace_chaos, accelerando(3), potion_of_prolonged_power
0:10.540 default Q chaos_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 3.0/5: 60% soul_shard bloodlust, berserking, soul_harvest, lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(3), potion_of_prolonged_power
0:11.425 default K conflagrate Fluffy_Pillow 1100000.0/1100000: 100% mana | 1.0/5: 20% soul_shard bloodlust, berserking, soul_harvest, lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(4), potion_of_prolonged_power
0:12.178 default R incinerate Fluffy_Pillow 1100000.0/1100000: 100% mana | 2.0/5: 40% soul_shard bloodlust, berserking, soul_harvest, lord_of_flames, conflagration_of_chaos, embrace_chaos, potion_of_prolonged_power
0:13.146 default K conflagrate Fluffy_Pillow 1034107.3/1100000: 94% mana | 2.0/5: 40% soul_shard bloodlust, berserking, soul_harvest, lord_of_flames, conflagration_of_chaos, embrace_chaos, potion_of_prolonged_power
0:13.920 default Q chaos_bolt Fluffy_Pillow 1050282.4/1100000: 95% mana | 3.0/5: 60% soul_shard bloodlust, soul_harvest, lord_of_flames, conflagration_of_chaos, embrace_chaos, potion_of_prolonged_power
0:14.986 default R incinerate Fluffy_Pillow 1070476.5/1100000: 97% mana | 1.0/5: 20% soul_shard bloodlust, soul_harvest, lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(2), potion_of_prolonged_power
0:16.065 default R incinerate Fluffy_Pillow 1025219.2/1100000: 93% mana | 1.0/5: 20% soul_shard bloodlust, soul_harvest, lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(3), potion_of_prolonged_power
0:17.131 default R incinerate Fluffy_Pillow 980009.3/1100000: 89% mana | 1.0/5: 20% soul_shard bloodlust, soul_harvest, lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(3), potion_of_prolonged_power
0:18.195 default K conflagrate Fluffy_Pillow 934760.4/1100000: 85% mana | 1.0/5: 20% soul_shard bloodlust, soul_harvest, lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(3), potion_of_prolonged_power
0:19.048 default P dimensional_rift Fluffy_Pillow 951396.4/1100000: 86% mana | 2.0/5: 40% soul_shard bloodlust, soul_harvest, lord_of_flames, accelerando(3), potion_of_prolonged_power
0:19.899 default Q chaos_bolt Fluffy_Pillow 967993.4/1100000: 88% mana | 2.0/5: 40% soul_shard bloodlust, soul_harvest, lord_of_flames, accelerando(3), potion_of_prolonged_power
0:21.597 default C havoc enemy2 1001109.3/1100000: 91% mana | 0.0/5: 0% soul_shard bloodlust, soul_harvest, lord_of_flames, embrace_chaos, accelerando(3), potion_of_prolonged_power
0:22.446 default R incinerate Fluffy_Pillow 929667.3/1100000: 85% mana | 0.0/5: 0% soul_shard bloodlust, soul_harvest, lord_of_flames, embrace_chaos, accelerando(3), potion_of_prolonged_power
0:23.509 default R incinerate Fluffy_Pillow 884398.9/1100000: 80% mana | 0.0/5: 0% soul_shard bloodlust, soul_harvest, lord_of_flames, embrace_chaos, accelerando(3), potion_of_prolonged_power
0:24.574 default R incinerate Fluffy_Pillow 839169.5/1100000: 76% mana | 0.0/5: 0% soul_shard bloodlust, soul_harvest, lord_of_flames, embrace_chaos, accelerando(3), potion_of_prolonged_power
0:25.639 default E immolate Fluffy_Pillow 793940.1/1100000: 72% mana | 0.0/5: 0% soul_shard bloodlust, soul_harvest, lord_of_flames, accelerando(3), potion_of_prolonged_power
0:26.490 default R incinerate Fluffy_Pillow 744061.3/1100000: 68% mana | 0.0/5: 0% soul_shard bloodlust, lord_of_flames, accelerando, potion_of_prolonged_power
0:27.584 default R incinerate Fluffy_Pillow 698784.7/1100000: 64% mana | 0.0/5: 0% soul_shard bloodlust, lord_of_flames, nefarious_pact, accelerando, potion_of_prolonged_power
0:28.346 default R incinerate Fluffy_Pillow 647219.0/1100000: 59% mana | 0.0/5: 0% soul_shard bloodlust, lord_of_flames, nefarious_pact, accelerando, potion_of_prolonged_power
0:29.107 default R incinerate Fluffy_Pillow 595634.4/1100000: 54% mana | 0.0/5: 0% soul_shard bloodlust, lord_of_flames, nefarious_pact, accelerando, potion_of_prolonged_power
0:29.867 default R incinerate Fluffy_Pillow 544030.9/1100000: 49% mana | 0.0/5: 0% soul_shard bloodlust, lord_of_flames, nefarious_pact, accelerando, potion_of_prolonged_power
0:30.627 default R incinerate Fluffy_Pillow 492427.4/1100000: 45% mana | 1.0/5: 20% soul_shard bloodlust, lord_of_flames, nefarious_pact, accelerando, potion_of_prolonged_power
0:31.386 default Q chaos_bolt Fluffy_Pillow 440804.9/1100000: 40% mana | 2.0/5: 40% soul_shard bloodlust, lord_of_flames, nefarious_pact, accelerando, potion_of_prolonged_power
0:32.597 default G immolate Fluffy_Pillow 463744.6/1100000: 42% mana | 0.0/5: 0% soul_shard bloodlust, lord_of_flames, embrace_chaos, nefarious_pact, accelerando, potion_of_prolonged_power
0:33.350 default J conflagrate Fluffy_Pillow 412008.5/1100000: 37% mana | 0.0/5: 0% soul_shard bloodlust, lord_of_flames, embrace_chaos, nefarious_pact, accelerando, potion_of_prolonged_power
0:34.104 default K conflagrate Fluffy_Pillow 426291.3/1100000: 39% mana | 2.0/5: 40% soul_shard bloodlust, lord_of_flames, embrace_chaos, nefarious_pact, accelerando, potion_of_prolonged_power
0:34.858 default Q chaos_bolt Fluffy_Pillow 440574.1/1100000: 40% mana | 3.0/5: 60% soul_shard bloodlust, lord_of_flames, embrace_chaos, nefarious_pact, accelerando, potion_of_prolonged_power
0:35.612 default K conflagrate Fluffy_Pillow 454856.9/1100000: 41% mana | 1.0/5: 20% soul_shard bloodlust, lord_of_flames, embrace_chaos, nefarious_pact, accelerando, potion_of_prolonged_power
0:36.367 default R incinerate Fluffy_Pillow 469158.7/1100000: 43% mana | 2.0/5: 40% soul_shard bloodlust, lord_of_flames, conflagration_of_chaos, embrace_chaos, nefarious_pact, accelerando, potion_of_prolonged_power
0:37.127 default P dimensional_rift Fluffy_Pillow 417690.8/1100000: 38% mana | 3.0/5: 60% soul_shard bloodlust, lord_of_flames, conflagration_of_chaos, embrace_chaos, nefarious_pact, accelerando(2), potion_of_prolonged_power
0:37.880 default Q chaos_bolt Fluffy_Pillow 432165.7/1100000: 39% mana | 5.0/5: 100% soul_shard bloodlust, lord_of_flames, conflagration_of_chaos, embrace_chaos, nefarious_pact, accelerando(2), potion_of_prolonged_power
0:38.635 default Q chaos_bolt Fluffy_Pillow 446595.1/1100000: 41% mana | 3.0/5: 60% soul_shard bloodlust, lord_of_flames, conflagration_of_chaos, embrace_chaos, nefarious_pact, potion_of_prolonged_power
0:39.388 default Q chaos_bolt Fluffy_Pillow 460653.2/1100000: 42% mana | 3.0/5: 60% soul_shard bloodlust, lord_of_flames, conflagration_of_chaos, embrace_chaos, devils_due, accelerando, potion_of_prolonged_power
0:40.625 default K conflagrate Fluffy_Pillow 484085.4/1100000: 44% mana | 1.0/5: 20% soul_shard bloodlust, lord_of_flames, conflagration_of_chaos, embrace_chaos, devils_due, accelerando, potion_of_prolonged_power
0:41.656 default C havoc enemy2 499108.5/1100000: 45% mana | 3.0/5: 60% soul_shard lord_of_flames, embrace_chaos, devils_due, accelerando, potion_of_prolonged_power
0:42.995 default Q chaos_bolt Fluffy_Pillow 430619.5/1100000: 39% mana | 3.0/5: 60% soul_shard lord_of_flames, embrace_chaos, devils_due, accelerando, potion_of_prolonged_power
0:44.600 default K conflagrate Fluffy_Pillow 454006.5/1100000: 41% mana | 1.0/5: 20% soul_shard lord_of_flames, embrace_chaos, devils_due, accelerando, potion_of_prolonged_power
0:46.044 default P dimensional_rift Fluffy_Pillow 475047.5/1100000: 43% mana | 3.0/5: 60% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, devils_due, accelerando, potion_of_prolonged_power
0:47.475 default Q chaos_bolt Fluffy_Pillow 495899.0/1100000: 45% mana | 4.0/5: 80% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando, potion_of_prolonged_power
0:48.838 default Q chaos_bolt Fluffy_Pillow 515759.8/1100000: 47% mana | 3.0/5: 60% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando, potion_of_prolonged_power
0:50.200 default R incinerate Fluffy_Pillow 535737.2/1100000: 49% mana | 2.0/5: 40% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(2), potion_of_prolonged_power
0:51.603 default R incinerate Fluffy_Pillow 490382.9/1100000: 45% mana | 2.0/5: 40% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, potion_of_prolonged_power
0:53.045 default Q chaos_bolt Fluffy_Pillow 445084.3/1100000: 40% mana | 2.0/5: 40% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, potion_of_prolonged_power
0:54.427 default E immolate Fluffy_Pillow 464924.3/1100000: 42% mana | 1.0/5: 20% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, potion_of_prolonged_power
0:55.581 default R incinerate Fluffy_Pillow 415491.2/1100000: 38% mana | 1.0/5: 20% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, potion_of_prolonged_power
0:57.026 default R incinerate Fluffy_Pillow 370235.6/1100000: 34% mana | 1.0/5: 20% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, potion_of_prolonged_power
0:58.471 default Q chaos_bolt Fluffy_Pillow 324980.1/1100000: 30% mana | 2.0/5: 40% soul_shard lord_of_flames, conflagration_of_chaos
1:00.774 default R incinerate Fluffy_Pillow 358083.4/1100000: 33% mana | 0.0/5: 0% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando
1:02.197 default C havoc enemy2 312819.2/1100000: 28% mana | 0.0/5: 0% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(2)
1:03.317 default G immolate Fluffy_Pillow 241380.6/1100000: 22% mana | 1.0/5: 20% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(2)
1:04.436 default J conflagrate Fluffy_Pillow 191927.2/1100000: 17% mana | 1.0/5: 20% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(2)
1:05.557 default K conflagrate Fluffy_Pillow 208503.3/1100000: 19% mana | 2.0/5: 40% soul_shard lord_of_flames, accelerando(2)
1:06.676 default Q chaos_bolt Fluffy_Pillow 225049.9/1100000: 20% mana | 3.0/5: 60% soul_shard lord_of_flames, conflagration_of_chaos, accelerando(2)
1:08.912 default K conflagrate Fluffy_Pillow 258452.6/1100000: 23% mana | 1.0/5: 20% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, nefarious_pact, accelerando(4)
1:09.667 default R incinerate Fluffy_Pillow 269942.1/1100000: 25% mana | 2.0/5: 40% soul_shard lord_of_flames, embrace_chaos, nefarious_pact, accelerando(4)
1:10.613 default R incinerate Fluffy_Pillow 218338.1/1100000: 20% mana | 2.0/5: 40% soul_shard lord_of_flames, embrace_chaos, nefarious_pact, accelerando(4)
1:11.558 default Q chaos_bolt Fluffy_Pillow 166823.0/1100000: 15% mana | 3.0/5: 60% soul_shard lord_of_flames, embrace_chaos, nefarious_pact, accelerando(5)
1:12.450 default K conflagrate Fluffy_Pillow 180589.4/1100000: 16% mana | 1.0/5: 20% soul_shard lord_of_flames, embrace_chaos, nefarious_pact, accelerando(5)
1:13.204 default R incinerate Fluffy_Pillow 191556.0/1100000: 17% mana | 2.0/5: 40% soul_shard lord_of_flames, embrace_chaos, nefarious_pact
1:14.205 default Q chaos_bolt Fluffy_Pillow 139926.4/1100000: 13% mana | 3.0/5: 60% soul_shard lord_of_flames, embrace_chaos, nefarious_pact
1:15.164 default R incinerate Fluffy_Pillow 153693.8/1100000: 14% mana | 2.0/5: 40% soul_shard lord_of_flames, embrace_chaos, nefarious_pact
1:16.169 default R incinerate Fluffy_Pillow 102121.6/1100000: 9% mana | 2.0/5: 40% soul_shard lord_of_flames, embrace_chaos, nefarious_pact
1:17.171 default S life_tap Fluffy_Pillow 50506.3/1100000: 5% mana | 2.0/5: 40% soul_shard lord_of_flames, embrace_chaos, nefarious_pact
1:17.970 default Q chaos_bolt Fluffy_Pillow 392043.5/1100000: 36% mana | 3.0/5: 60% soul_shard lord_of_flames, embrace_chaos, nefarious_pact, accelerando
1:18.915 default K conflagrate Fluffy_Pillow 405813.5/1100000: 37% mana | 1.0/5: 20% soul_shard lord_of_flames, embrace_chaos, nefarious_pact, accelerando
1:19.703 default Q chaos_bolt Fluffy_Pillow 417295.7/1100000: 38% mana | 3.0/5: 60% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, nefarious_pact, accelerando
1:20.649 default R incinerate Fluffy_Pillow 431080.1/1100000: 39% mana | 1.0/5: 20% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, devils_due, accelerando
1:22.326 default C havoc enemy2 389516.3/1100000: 35% mana | 1.0/5: 20% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, devils_due, accelerando
1:23.665 default R incinerate Fluffy_Pillow 321155.4/1100000: 29% mana | 1.0/5: 20% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, devils_due, accelerando(2)
1:25.317 default E immolate Fluffy_Pillow 279584.4/1100000: 25% mana | 1.0/5: 20% soul_shard lord_of_flames, conflagration_of_chaos, devils_due, accelerando(3)
1:26.614 default P dimensional_rift Fluffy_Pillow 233231.4/1100000: 21% mana | 1.0/5: 20% soul_shard lord_of_flames, conflagration_of_chaos, devils_due, accelerando(5)
1:27.878 default Q chaos_bolt Fluffy_Pillow 252738.9/1100000: 23% mana | 2.0/5: 40% soul_shard lord_of_flames, conflagration_of_chaos, accelerando(5)
1:30.020 default R incinerate Fluffy_Pillow 285419.7/1100000: 26% mana | 1.0/5: 20% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando
1:31.444 default P dimensional_rift Fluffy_Pillow 240169.3/1100000: 22% mana | 1.0/5: 20% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando
1:32.580 default R incinerate Fluffy_Pillow 256722.3/1100000: 23% mana | 2.0/5: 40% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando
1:34.002 default Q chaos_bolt Fluffy_Pillow 211442.8/1100000: 19% mana | 2.0/5: 40% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando
1:35.365 default L service_imp Fluffy_Pillow 231303.5/1100000: 21% mana | 1.0/5: 20% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando
1:36.501 default G immolate Fluffy_Pillow 247856.5/1100000: 23% mana | 0.0/5: 0% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando
1:37.636 default J conflagrate Fluffy_Pillow 198395.7/1100000: 18% mana | 1.0/5: 20% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(2)
1:38.755 default K conflagrate Fluffy_Pillow 214942.2/1100000: 20% mana | 2.0/5: 40% soul_shard lord_of_flames, embrace_chaos, accelerando(2)
1:39.876 default Q chaos_bolt Fluffy_Pillow 231518.4/1100000: 21% mana | 3.0/5: 60% soul_shard lord_of_flames, conflagration_of_chaos, accelerando(2)
1:42.113 default K conflagrate Fluffy_Pillow 264688.6/1100000: 24% mana | 2.0/5: 40% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos
1:43.267 default C havoc enemy2 281255.5/1100000: 26% mana | 3.0/5: 60% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos
1:44.420 default Q chaos_bolt Fluffy_Pillow 209808.0/1100000: 19% mana | 4.0/5: 80% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos
1:45.801 default Q chaos_bolt Fluffy_Pillow 229636.9/1100000: 21% mana | 3.0/5: 60% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando
1:47.165 default K conflagrate Fluffy_Pillow 249512.2/1100000: 23% mana | 1.0/5: 20% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando
1:48.300 default R incinerate Fluffy_Pillow 266050.7/1100000: 24% mana | 2.0/5: 40% soul_shard lord_of_flames, embrace_chaos, accelerando
1:49.725 default Q chaos_bolt Fluffy_Pillow 220829.0/1100000: 20% mana | 3.0/5: 60% soul_shard lord_of_flames, embrace_chaos, accelerando(2)
1:51.067 default R incinerate Fluffy_Pillow 240673.1/1100000: 22% mana | 1.0/5: 20% soul_shard lord_of_flames, embrace_chaos, accelerando(2)
1:52.469 default K conflagrate Fluffy_Pillow 195404.4/1100000: 18% mana | 1.0/5: 20% soul_shard lord_of_flames, embrace_chaos, accelerando(2)
1:53.590 default Q chaos_bolt Fluffy_Pillow 211980.5/1100000: 19% mana | 4.0/5: 80% soul_shard lord_of_flames, embrace_chaos, accelerando(2)
1:54.933 default R incinerate Fluffy_Pillow 231839.4/1100000: 21% mana | 2.0/5: 40% soul_shard lord_of_flames, embrace_chaos, accelerando(2)
1:56.337 default R incinerate Fluffy_Pillow 186600.2/1100000: 17% mana | 2.0/5: 40% soul_shard lord_of_flames, embrace_chaos, accelerando(2)
1:57.738 default Q chaos_bolt Fluffy_Pillow 141473.7/1100000: 13% mana | 3.0/5: 60% soul_shard lord_of_flames, embrace_chaos, accelerando(3)
1:59.061 default E immolate Fluffy_Pillow 160498.6/1100000: 15% mana | 1.0/5: 20% soul_shard lord_of_flames, embrace_chaos, accelerando
2:00.197 default R incinerate Fluffy_Pillow 111051.6/1100000: 10% mana | 1.0/5: 20% soul_shard lord_of_flames, embrace_chaos, accelerando
2:01.620 default S life_tap Fluffy_Pillow 65786.6/1100000: 6% mana | 2.0/5: 40% soul_shard lord_of_flames, embrace_chaos, accelerando
2:02.758 default Q chaos_bolt Fluffy_Pillow 412368.8/1100000: 37% mana | 2.0/5: 40% soul_shard lord_of_flames, embrace_chaos, accelerando
2:04.120 default C havoc enemy2 432215.0/1100000: 39% mana | 0.0/5: 0% soul_shard lord_of_flames, embrace_chaos, accelerando
2:05.257 default R incinerate Fluffy_Pillow 360782.6/1100000: 33% mana | 0.0/5: 0% soul_shard lord_of_flames, embrace_chaos, accelerando
2:06.681 default O soul_harvest Fluffy_Pillow 315532.2/1100000: 29% mana | 1.0/5: 20% soul_shard lord_of_flames, embrace_chaos, accelerando
2:06.804 default I potion Fluffy_Pillow 317324.4/1100000: 29% mana | 1.0/5: 20% soul_shard soul_harvest, lord_of_flames, embrace_chaos, accelerando
2:06.804 default R incinerate Fluffy_Pillow 317324.4/1100000: 29% mana | 1.0/5: 20% soul_shard soul_harvest, lord_of_flames, embrace_chaos, accelerando, potion_of_deadly_grace
2:08.226 default Q chaos_bolt Fluffy_Pillow 272044.9/1100000: 25% mana | 2.0/5: 40% soul_shard soul_harvest, lord_of_flames, accelerando, potion_of_deadly_grace
2:10.493 default R incinerate Fluffy_Pillow 305165.2/1100000: 28% mana | 0.0/5: 0% soul_shard soul_harvest, lord_of_flames, embrace_chaos, accelerando(2), potion_of_deadly_grace
2:11.896 default G immolate Fluffy_Pillow 259549.7/1100000: 24% mana | 0.0/5: 0% soul_shard soul_harvest, lord_of_flames, embrace_chaos, potion_of_deadly_grace
2:13.049 default J conflagrate Fluffy_Pillow 210102.2/1100000: 19% mana | 0.0/5: 0% soul_shard soul_harvest, lord_of_flames, embrace_chaos, potion_of_deadly_grace
2:14.202 default K conflagrate Fluffy_Pillow 226654.7/1100000: 21% mana | 1.0/5: 20% soul_shard soul_harvest, lord_of_flames, conflagration_of_chaos, embrace_chaos, potion_of_deadly_grace
2:15.354 default Q chaos_bolt Fluffy_Pillow 243192.9/1100000: 22% mana | 3.0/5: 60% soul_shard soul_harvest, lord_of_flames, conflagration_of_chaos, potion_of_deadly_grace
2:17.657 default P dimensional_rift Fluffy_Pillow 276414.3/1100000: 25% mana | 4.0/5: 80% soul_shard soul_harvest, lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando, potion_of_deadly_grace
2:18.794 default Q chaos_bolt Fluffy_Pillow 292981.9/1100000: 27% mana | 4.0/5: 80% soul_shard soul_harvest, lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando, potion_of_deadly_grace
2:20.157 default Q chaos_bolt Fluffy_Pillow 313046.2/1100000: 28% mana | 3.0/5: 60% soul_shard soul_harvest, lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(2), potion_of_deadly_grace
2:21.501 default K conflagrate Fluffy_Pillow 332919.8/1100000: 30% mana | 1.0/5: 20% soul_shard soul_harvest, lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(2), potion_of_deadly_grace
2:22.620 default K conflagrate Fluffy_Pillow 349466.4/1100000: 32% mana | 2.0/5: 40% soul_shard soul_harvest, lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(2), potion_of_deadly_grace
2:23.739 default Q chaos_bolt Fluffy_Pillow 366013.0/1100000: 33% mana | 4.0/5: 80% soul_shard soul_harvest, lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(2), potion_of_deadly_grace
2:25.082 default C havoc enemy2 385871.8/1100000: 35% mana | 2.0/5: 40% soul_shard soul_harvest, lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(2), potion_of_deadly_grace
2:26.201 default R incinerate Fluffy_Pillow 314418.4/1100000: 29% mana | 2.0/5: 40% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(2), potion_of_deadly_grace
2:27.603 default Q chaos_bolt Fluffy_Pillow 269150.6/1100000: 24% mana | 3.0/5: 60% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(3), potion_of_deadly_grace
2:28.928 default Q chaos_bolt Fluffy_Pillow 289020.8/1100000: 26% mana | 3.0/5: 60% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, potion_of_deadly_grace
2:30.309 default K conflagrate Fluffy_Pillow 308846.5/1100000: 28% mana | 2.0/5: 40% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, potion_of_deadly_grace
2:31.463 default Q chaos_bolt Fluffy_Pillow 325422.1/1100000: 30% mana | 3.0/5: 60% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando, potion_of_deadly_grace
2:32.825 default R incinerate Fluffy_Pillow 345268.3/1100000: 31% mana | 1.0/5: 20% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando, potion_of_deadly_grace
2:34.247 default E immolate Fluffy_Pillow 299988.7/1100000: 27% mana | 1.0/5: 20% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando, potion_of_deadly_grace
2:35.384 default R incinerate Fluffy_Pillow 250557.4/1100000: 23% mana | 1.0/5: 20% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(2), potion_of_deadly_grace
2:36.787 default Q chaos_bolt Fluffy_Pillow 205303.5/1100000: 19% mana | 2.0/5: 40% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(2), potion_of_deadly_grace
2:38.130 default R incinerate Fluffy_Pillow 225162.3/1100000: 20% mana | 0.0/5: 0% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(2)
2:39.534 default R incinerate Fluffy_Pillow 179923.2/1100000: 16% mana | 0.0/5: 0% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(2)
2:40.936 default R incinerate Fluffy_Pillow 134654.5/1100000: 12% mana | 1.0/5: 20% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(2)
2:42.337 default R incinerate Fluffy_Pillow 89371.0/1100000: 8% mana | 1.0/5: 20% soul_shard lord_of_flames, conflagration_of_chaos, accelerando(2)
2:43.739 default S life_tap Fluffy_Pillow 43965.6/1100000: 4% mana | 1.0/5: 20% soul_shard lord_of_flames, conflagration_of_chaos
2:44.894 default G immolate Fluffy_Pillow 390546.9/1100000: 36% mana | 1.0/5: 20% soul_shard lord_of_flames, conflagration_of_chaos
2:46.048 default C havoc enemy2 341259.9/1100000: 31% mana | 2.0/5: 40% soul_shard lord_of_flames, conflagration_of_chaos, accelerando
2:47.185 default J conflagrate Fluffy_Pillow 269827.5/1100000: 25% mana | 2.0/5: 40% soul_shard lord_of_flames, conflagration_of_chaos, accelerando
2:48.320 default Q chaos_bolt Fluffy_Pillow 286610.7/1100000: 26% mana | 3.0/5: 60% soul_shard lord_of_flames, conflagration_of_chaos, accelerando(2)
2:50.556 default K conflagrate Fluffy_Pillow 319674.3/1100000: 29% mana | 1.0/5: 20% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(2)
2:51.677 default K conflagrate Fluffy_Pillow 336250.4/1100000: 31% mana | 2.0/5: 40% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(2)
2:52.797 default Q chaos_bolt Fluffy_Pillow 353052.9/1100000: 32% mana | 4.0/5: 80% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(3)
2:54.121 default K conflagrate Fluffy_Pillow 372915.9/1100000: 34% mana | 2.0/5: 40% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(3)
2:55.223 default F immolate enemy2 389448.4/1100000: 35% mana | 3.0/5: 60% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(3)
2:56.326 default Q chaos_bolt Fluffy_Pillow 339995.8/1100000: 31% mana | 3.0/5: 60% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(3)
2:57.649 default R incinerate Fluffy_Pillow 359662.8/1100000: 33% mana | 1.0/5: 20% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos
2:59.094 default R incinerate Fluffy_Pillow 314408.4/1100000: 29% mana | 1.0/5: 20% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando
3:00.519 default K conflagrate Fluffy_Pillow 269254.5/1100000: 24% mana | 2.0/5: 40% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(3)
3:01.756 default P dimensional_rift Fluffy_Pillow 287812.2/1100000: 26% mana | 5.0/5: 100% soul_shard lord_of_flames, accelerando(3)
3:02.861 default Q chaos_bolt Fluffy_Pillow 304627.9/1100000: 28% mana | 5.0/5: 100% soul_shard lord_of_flames, accelerando(4)
3:05.034 default H berserking Fluffy_Pillow 338130.4/1100000: 31% mana | 3.0/5: 60% soul_shard lord_of_flames, embrace_chaos, accelerando(5)
3:05.034 default Q chaos_bolt Fluffy_Pillow 338130.4/1100000: 31% mana | 3.0/5: 60% soul_shard berserking, lord_of_flames, embrace_chaos, accelerando(5)
3:06.154 default C havoc enemy2 358008.3/1100000: 33% mana | 2.0/5: 40% soul_shard berserking, lord_of_flames, embrace_chaos, accelerando(5)
3:07.087 default L service_imp Fluffy_Pillow 286567.3/1100000: 26% mana | 2.0/5: 40% soul_shard berserking, lord_of_flames, embrace_chaos, accelerando(5)
3:08.020 default E immolate Fluffy_Pillow 303126.2/1100000: 28% mana | 1.0/5: 20% soul_shard berserking, lord_of_flames, embrace_chaos, accelerando(5)
3:08.954 default R incinerate Fluffy_Pillow 253703.0/1100000: 23% mana | 2.0/5: 40% soul_shard berserking, lord_of_flames, embrace_chaos, accelerando(5)
3:10.123 default Q chaos_bolt Fluffy_Pillow 208450.5/1100000: 19% mana | 2.0/5: 40% soul_shard berserking, lord_of_flames, embrace_chaos, accelerando(5)
3:11.242 default R incinerate Fluffy_Pillow 228121.2/1100000: 21% mana | 2.0/5: 40% soul_shard berserking, lord_of_flames, embrace_chaos
3:12.500 default R incinerate Fluffy_Pillow 182890.0/1100000: 17% mana | 2.0/5: 40% soul_shard berserking, lord_of_flames, embrace_chaos
3:13.756 default R incinerate Fluffy_Pillow 137625.9/1100000: 13% mana | 2.0/5: 40% soul_shard berserking, lord_of_flames, embrace_chaos
3:15.011 default Q chaos_bolt Fluffy_Pillow 92442.0/1100000: 8% mana | 2.0/5: 40% soul_shard berserking, lord_of_flames, embrace_chaos, accelerando
3:16.195 default G immolate Fluffy_Pillow 109744.8/1100000: 10% mana | 0.0/5: 0% soul_shard lord_of_flames, embrace_chaos, accelerando
3:17.330 default J conflagrate Fluffy_Pillow 60283.2/1100000: 5% mana | 1.0/5: 20% soul_shard lord_of_flames, embrace_chaos, accelerando
3:18.467 default Q chaos_bolt Fluffy_Pillow 76850.8/1100000: 7% mana | 3.0/5: 60% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando
3:19.828 default Q chaos_bolt Fluffy_Pillow 96682.4/1100000: 9% mana | 3.0/5: 60% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando
3:21.190 default K conflagrate Fluffy_Pillow 116528.6/1100000: 11% mana | 1.0/5: 20% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando
3:22.327 default K conflagrate Fluffy_Pillow 133096.2/1100000: 12% mana | 2.0/5: 40% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando
3:23.464 default Q chaos_bolt Fluffy_Pillow 149675.4/1100000: 14% mana | 5.0/5: 100% soul_shard lord_of_flames, embrace_chaos, accelerando(2)
3:24.805 default Q chaos_bolt Fluffy_Pillow 169504.7/1100000: 15% mana | 3.0/5: 60% soul_shard lord_of_flames, embrace_chaos, accelerando(2)
3:26.148 default K conflagrate Fluffy_Pillow 189363.5/1100000: 17% mana | 1.0/5: 20% soul_shard lord_of_flames, embrace_chaos, accelerando(2)
3:27.266 default C havoc enemy2 205617.0/1100000: 19% mana | 2.0/5: 40% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos
3:28.420 default Q chaos_bolt Fluffy_Pillow 134183.8/1100000: 12% mana | 4.0/5: 80% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos
3:29.803 default R incinerate Fluffy_Pillow 154038.2/1100000: 14% mana | 2.0/5: 40% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos
3:31.246 default Q chaos_bolt Fluffy_Pillow 108754.6/1100000: 10% mana | 3.0/5: 60% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando
3:32.608 default Q chaos_bolt Fluffy_Pillow 128667.6/1100000: 12% mana | 3.0/5: 60% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(2)
3:33.952 default K conflagrate Fluffy_Pillow 148541.2/1100000: 14% mana | 1.0/5: 20% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(2)
3:35.071 default Q chaos_bolt Fluffy_Pillow 165160.8/1100000: 15% mana | 3.0/5: 60% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(3)
3:36.395 default Q chaos_bolt Fluffy_Pillow 185023.8/1100000: 17% mana | 3.0/5: 60% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(3)
3:37.719 default R incinerate Fluffy_Pillow 204886.7/1100000: 19% mana | 2.0/5: 40% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(3)
3:39.102 default E immolate Fluffy_Pillow 159634.8/1100000: 15% mana | 2.0/5: 40% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(3)
3:40.207 default Q chaos_bolt Fluffy_Pillow 110212.3/1100000: 10% mana | 3.0/5: 60% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(3)
3:41.532 default R incinerate Fluffy_Pillow 130090.3/1100000: 12% mana | 2.0/5: 40% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(3)
3:42.913 default R incinerate Fluffy_Pillow 84808.4/1100000: 8% mana | 2.0/5: 40% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(3)
3:44.295 default Q chaos_bolt Fluffy_Pillow 38919.6/1100000: 4% mana | 4.0/5: 80% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando
3:45.658 default Q chaos_bolt Fluffy_Pillow 58780.3/1100000: 5% mana | 3.0/5: 60% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando
3:47.022 default P dimensional_rift Fluffy_Pillow 78656.9/1100000: 7% mana | 2.0/5: 40% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(2)
3:48.141 default C havoc enemy2 95203.5/1100000: 9% mana | 2.0/5: 40% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(2)
3:49.260 default N summon_doomguard Fluffy_Pillow 23750.0/1100000: 2% mana | 2.0/5: 40% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, nefarious_pact, accelerando(2)
3:50.038 default S life_tap Fluffy_Pillow 35254.3/1100000: 3% mana | 2.0/5: 40% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, nefarious_pact, accelerando(2)
3:50.814 default G immolate Fluffy_Pillow 376728.9/1100000: 34% mana | 2.0/5: 40% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, nefarious_pact, accelerando(2)
3:51.591 default J conflagrate Fluffy_Pillow 322218.4/1100000: 29% mana | 2.0/5: 40% soul_shard lord_of_flames, conflagration_of_chaos, nefarious_pact, accelerando(2)
3:52.368 default Q chaos_bolt Fluffy_Pillow 333707.8/1100000: 30% mana | 3.0/5: 60% soul_shard lord_of_flames, nefarious_pact, accelerando(2)
3:53.920 default Q chaos_bolt Fluffy_Pillow 356657.2/1100000: 32% mana | 3.0/5: 60% soul_shard lord_of_flames, embrace_chaos, nefarious_pact, accelerando(2)
3:54.852 default K conflagrate Fluffy_Pillow 370438.6/1100000: 34% mana | 1.0/5: 20% soul_shard lord_of_flames, embrace_chaos, nefarious_pact, accelerando(2)
3:55.630 default K conflagrate Fluffy_Pillow 381942.8/1100000: 35% mana | 2.0/5: 40% soul_shard lord_of_flames, embrace_chaos, nefarious_pact, accelerando(2)
3:56.407 default Q chaos_bolt Fluffy_Pillow 393268.1/1100000: 36% mana | 4.0/5: 80% soul_shard lord_of_flames, embrace_chaos, nefarious_pact
3:57.367 default Q chaos_bolt Fluffy_Pillow 407255.1/1100000: 37% mana | 4.0/5: 80% soul_shard lord_of_flames, embrace_chaos, nefarious_pact, accelerando
3:58.313 default K conflagrate Fluffy_Pillow 421039.5/1100000: 38% mana | 2.0/5: 40% soul_shard lord_of_flames, embrace_chaos, nefarious_pact, accelerando
3:59.114 default Q chaos_bolt Fluffy_Pillow 432711.2/1100000: 39% mana | 4.0/5: 80% soul_shard lord_of_flames, embrace_chaos, nefarious_pact, accelerando
4:00.060 default R incinerate Fluffy_Pillow 446495.7/1100000: 41% mana | 2.0/5: 40% soul_shard lord_of_flames, embrace_chaos, nefarious_pact, accelerando
4:01.045 default Q chaos_bolt Fluffy_Pillow 394848.4/1100000: 36% mana | 3.0/5: 60% soul_shard lord_of_flames, embrace_chaos, devils_due, accelerando
4:02.648 default R incinerate Fluffy_Pillow 418206.3/1100000: 38% mana | 1.0/5: 20% soul_shard lord_of_flames, embrace_chaos, devils_due, accelerando
4:04.324 default R incinerate Fluffy_Pillow 376627.8/1100000: 34% mana | 2.0/5: 40% soul_shard lord_of_flames, embrace_chaos, devils_due, accelerando
4:06.000 default Q chaos_bolt Fluffy_Pillow 335233.7/1100000: 30% mana | 3.0/5: 60% soul_shard lord_of_flames, embrace_chaos, devils_due, accelerando(2)
4:07.581 default K conflagrate Fluffy_Pillow 358611.9/1100000: 33% mana | 1.0/5: 20% soul_shard lord_of_flames, embrace_chaos, devils_due, accelerando(2)
4:08.899 default C havoc enemy2 377988.1/1100000: 34% mana | 3.0/5: 60% soul_shard lord_of_flames, embrace_chaos, nefarious_pact, accelerando
4:09.688 default O soul_harvest Fluffy_Pillow 301484.9/1100000: 27% mana | 3.0/5: 60% soul_shard lord_of_flames, embrace_chaos, nefarious_pact, accelerando
4:09.688 default Q chaos_bolt Fluffy_Pillow 301484.9/1100000: 27% mana | 3.0/5: 60% soul_shard soul_harvest, lord_of_flames, embrace_chaos, nefarious_pact, accelerando
4:10.632 default R incinerate Fluffy_Pillow 315240.2/1100000: 29% mana | 2.0/5: 40% soul_shard soul_harvest, lord_of_flames, embrace_chaos, nefarious_pact, accelerando
4:11.620 default Q chaos_bolt Fluffy_Pillow 263636.7/1100000: 24% mana | 3.0/5: 60% soul_shard soul_harvest, lord_of_flames, embrace_chaos, nefarious_pact, accelerando
4:12.566 default Q chaos_bolt Fluffy_Pillow 277474.2/1100000: 25% mana | 3.0/5: 60% soul_shard soul_harvest, lord_of_flames, embrace_chaos, nefarious_pact, accelerando(2)
4:13.499 default E immolate Fluffy_Pillow 291271.7/1100000: 26% mana | 2.0/5: 40% soul_shard soul_harvest, lord_of_flames, embrace_chaos, nefarious_pact, accelerando(3)
4:14.266 default R incinerate Fluffy_Pillow 236778.4/1100000: 22% mana | 2.0/5: 40% soul_shard soul_harvest, lord_of_flames, embrace_chaos, nefarious_pact, accelerando(3)
4:15.226 default Q chaos_bolt Fluffy_Pillow 185180.6/1100000: 17% mana | 3.0/5: 60% soul_shard soul_harvest, lord_of_flames, embrace_chaos, nefarious_pact, accelerando(3)
4:16.144 default R incinerate Fluffy_Pillow 198952.6/1100000: 18% mana | 2.0/5: 40% soul_shard soul_harvest, lord_of_flames, embrace_chaos, nefarious_pact, accelerando(3)
4:17.103 default R incinerate Fluffy_Pillow 147339.8/1100000: 13% mana | 2.0/5: 40% soul_shard soul_harvest, lord_of_flames, embrace_chaos, nefarious_pact, accelerando(3)
4:18.062 default Q chaos_bolt Fluffy_Pillow 95726.9/1100000: 9% mana | 3.0/5: 60% soul_shard soul_harvest, lord_of_flames, embrace_chaos, nefarious_pact, accelerando(3)
4:18.981 default R incinerate Fluffy_Pillow 109514.0/1100000: 10% mana | 2.0/5: 40% soul_shard soul_harvest, lord_of_flames, embrace_chaos, nefarious_pact, accelerando(3)
4:19.942 default S life_tap Fluffy_Pillow 57931.1/1100000: 5% mana | 2.0/5: 40% soul_shard soul_harvest, lord_of_flames, embrace_chaos, nefarious_pact, accelerando(3)
4:20.707 default R incinerate Fluffy_Pillow 399243.7/1100000: 36% mana | 2.0/5: 40% soul_shard soul_harvest, lord_of_flames, embrace_chaos, devils_due
4:22.409 default Q chaos_bolt Fluffy_Pillow 357677.7/1100000: 33% mana | 2.0/5: 40% soul_shard soul_harvest, lord_of_flames, embrace_chaos, devils_due
4:24.037 default G immolate Fluffy_Pillow 381102.2/1100000: 35% mana | 0.0/5: 0% soul_shard soul_harvest, lord_of_flames, embrace_chaos, devils_due, accelerando
4:25.375 default J conflagrate Fluffy_Pillow 334598.7/1100000: 30% mana | 0.0/5: 0% soul_shard soul_harvest, lord_of_flames, embrace_chaos, devils_due, accelerando
4:26.713 default Q chaos_bolt Fluffy_Pillow 354095.1/1100000: 32% mana | 3.0/5: 60% soul_shard soul_harvest, lord_of_flames, conflagration_of_chaos, embrace_chaos, devils_due, accelerando
4:28.317 default K conflagrate Fluffy_Pillow 377468.4/1100000: 34% mana | 1.0/5: 20% soul_shard soul_harvest, lord_of_flames, conflagration_of_chaos, embrace_chaos, devils_due, accelerando(2)
4:29.635 default C havoc enemy2 396957.6/1100000: 36% mana | 2.0/5: 40% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(2)
4:30.754 default J conflagrate Fluffy_Pillow 325504.2/1100000: 30% mana | 2.0/5: 40% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(2)
4:31.874 default P dimensional_rift Fluffy_Pillow 342306.7/1100000: 31% mana | 3.0/5: 60% soul_shard lord_of_flames, embrace_chaos, accelerando(3)
4:32.978 default J conflagrate Fluffy_Pillow 358869.1/1100000: 33% mana | 3.0/5: 60% soul_shard lord_of_flames, accelerando(3)
4:34.082 default Q chaos_bolt Fluffy_Pillow 375431.6/1100000: 34% mana | 4.0/5: 80% soul_shard lord_of_flames, accelerando(3)
4:36.286 default Q chaos_bolt Fluffy_Pillow 408176.7/1100000: 37% mana | 3.0/5: 60% soul_shard lord_of_flames, embrace_chaos
4:37.667 default L service_imp Fluffy_Pillow 428002.3/1100000: 39% mana | 1.0/5: 20% soul_shard lord_of_flames, embrace_chaos
4:38.821 default J conflagrate Fluffy_Pillow 444569.2/1100000: 40% mana | 1.0/5: 20% soul_shard lord_of_flames, embrace_chaos
4:40.213 default R incinerate Fluffy_Pillow 464800.8/1100000: 42% mana | 2.0/5: 40% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando
4:41.637 default Q chaos_bolt Fluffy_Pillow 419551.5/1100000: 38% mana | 2.0/5: 40% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(2)
4:42.980 default R incinerate Fluffy_Pillow 439480.1/1100000: 40% mana | 1.0/5: 20% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(3)
4:44.362 default R incinerate Fluffy_Pillow 394213.2/1100000: 36% mana | 1.0/5: 20% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(3)
4:45.745 default J conflagrate Fluffy_Pillow 349146.3/1100000: 32% mana | 1.0/5: 20% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(4)
4:46.834 default E immolate Fluffy_Pillow 365746.1/1100000: 33% mana | 3.0/5: 60% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(5)
4:47.910 default Q chaos_bolt Fluffy_Pillow 316352.1/1100000: 29% mana | 4.0/5: 80% soul_shard lord_of_flames, conflagration_of_chaos, accelerando(5)
4:50.052 default C havoc enemy2 349409.9/1100000: 32% mana | 2.0/5: 40% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(5)
4:51.126 default R incinerate Fluffy_Pillow 277915.1/1100000: 25% mana | 2.0/5: 40% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos
4:52.570 default J conflagrate Fluffy_Pillow 232646.1/1100000: 21% mana | 2.0/5: 40% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando
4:53.708 default Q chaos_bolt Fluffy_Pillow 249228.2/1100000: 23% mana | 5.0/5: 100% soul_shard lord_of_flames, embrace_chaos, accelerando
4:55.070 default Q chaos_bolt Fluffy_Pillow 269075.3/1100000: 24% mana | 3.0/5: 60% soul_shard lord_of_flames, embrace_chaos, accelerando(2)
4:56.413 default R incinerate Fluffy_Pillow 288934.1/1100000: 26% mana | 2.0/5: 40% soul_shard lord_of_flames, embrace_chaos, accelerando(2)

Stats

Raid-Buffed Unbuffed Gear Amount
Strength 4201 3876 0
Agility 7254 6929 0
Stamina 55081 55081 34467
Intellect 50545 48839 39190 (1278)
Spirit 1 1 0
Health 3304860 3304860 0
Mana 1100000 1100000 0
Soul Shard 5 5 0
Spell Power 50545 48839 0
Crit 13.94% 13.94% 3577
Haste 30.51% 29.51% 11066
Damage / Heal Versatility 5.96% 5.96% 2829
ManaReg per Second 14356 14246 0
Mastery 66.72% 66.72% 5695
Armor 1981 1981 1981
Run Speed 7 0 0

Gear

Source Slot Average Item Level: 906.00
Local Head Eyes of Azj'Aqir
ilevel: 900, stats: { 253 Armor, +3255 Sta, +2170 Int, +1074 Haste, +578 Vers }
Local Neck Radiant String of Scorpid Eyes
ilevel: 900, stats: { +1831 Sta, +2011 Haste, +922 Crit }, enchant: mark_of_the_hidden_satyr
Local Shoulders Pauldrons of Azj'Aqir
ilevel: 900, stats: { 233 Armor, +2442 Sta, +1628 Int, +752 Mastery, +487 Vers }
Local Chest Robes of Fluctuating Energy
ilevel: 900, stats: { 311 Armor, +3255 Sta, +2170 Int, +1145 Haste, +507 Mastery }
Local Waist Feretory of Souls
ilevel: 940, stats: { 202 Armor, +3544 Sta, +2362 Int, +822 Haste, +617 Mastery }
Local Legs Leggings of Azj'Aqir
ilevel: 900, stats: { 272 Armor, +3255 Sta, +2170 Int, +932 Crit, +720 Haste }
Local Feet Outcast Wanderer's Footrags
ilevel: 910, stats: { 222 Armor, +2680 Sta, +1786 Int, +864 Crit, +422 Mastery }
Local Wrists Woven Lasher Tendril Bracers
ilevel: 900, stats: { 136 Armor, +1831 Sta, +1221 Int, +644 Haste, +285 Vers }
Local Hands Clutch of Azj'Aqir
ilevel: 900, stats: { 194 Armor, +2442 Sta, +1628 Int, +859 Crit, +380 Mastery }
Local Finger1 Ring of the Scoured Clan
ilevel: 900, stats: { +1831 Sta, +2095 Mastery, +838 Haste }, enchant: { +200 Haste }
Local Finger2 Ring of Braided Stems
ilevel: 905, stats: { +1918 Sta, +1814 Haste, +1209 Vers }, enchant: { +200 Haste }
Local Trinket1 Whispers in the Dark
ilevel: 905, stats: { +2162 Int }
Local Trinket2 Erratic Metronome
ilevel: 900, stats: { +2063 Int }
Local Back Astromancer's Greatcloak
ilevel: 905, stats: { 158 Armor, +1918 Sta, +1278 StrAgiInt, +676 Haste, +270 Vers }, enchant: { +200 Int }
Local Main Hand Scepter of Sargeras
ilevel: 929, weapon: { 7005 - 10509, 3.6 }, stats: { +2843 Int, +4265 Sta, +922 Haste, +922 Mastery, +15509 Int }, relics: { +61 ilevels, +59 ilevels, +61 ilevels }

Talents

Level
15 Backdraft (Destruction Warlock) Roaring Blaze (Destruction Warlock) Shadowburn (Destruction Warlock)
30 Reverse Entropy (Destruction Warlock) Eradication (Destruction Warlock) Empowered Life Tap
45 Demonic Circle Mortal Coil Shadowfury
60 Cataclysm (Destruction Warlock) Fire and Brimstone (Destruction Warlock) Soul Harvest
75 Demon Skin Burning Rush Dark Pact
90 Grimoire of Supremacy Grimoire of Service Grimoire of Sacrifice
100 Wreak Havoc (Destruction Warlock) Channel Demonfire (Destruction Warlock) Soul Conduit

Profile

warlock="Feretory"
level=110
race=troll
role=spell
position=back
talents=2203021
artifact=38:0:0:0:0:803:1:804:3:805:3:806:3:807:3:808:3:809:3:810:3:811:3:812:3:813:1:814:1:815:1:816:1:817:1:818:1:1355:1:1392:1:1609:4:1610:1:1611:1:1713:1
spec=destruction

# This default action priority list is automatically created based on your character.
# It is a attempt to provide you with a action list that is both simple and practicable,
# while resulting in a meaningful and good simulation. It may not result in the absolutely highest possible dps.
# Feel free to edit, adapt and improve it to your own needs.
# SimulationCraft is always looking for updates and improvements to the default action lists.

# Executed before combat begins. Accepts non-harmful actions only.
actions.precombat=flask,type=whispered_pact
actions.precombat+=/food,type=azshari_salad
actions.precombat+=/summon_pet,if=!talent.grimoire_of_supremacy.enabled&(!talent.grimoire_of_sacrifice.enabled|buff.demonic_power.down)
actions.precombat+=/summon_infernal,if=talent.grimoire_of_supremacy.enabled&artifact.lord_of_flames.rank>0
actions.precombat+=/summon_infernal,if=talent.grimoire_of_supremacy.enabled&active_enemies>1
actions.precombat+=/summon_doomguard,if=talent.grimoire_of_supremacy.enabled&active_enemies=1&artifact.lord_of_flames.rank=0
actions.precombat+=/augmentation,type=defiled
actions.precombat+=/snapshot_stats
actions.precombat+=/grimoire_of_sacrifice,if=talent.grimoire_of_sacrifice.enabled
actions.precombat+=/life_tap,if=talent.empowered_life_tap.enabled&!buff.empowered_life_tap.remains
actions.precombat+=/potion,name=prolonged_power
actions.precombat+=/chaos_bolt

# Executed every time the actor is available.
actions=havoc,target=2,if=active_enemies>1&(active_enemies<4|talent.wreak_havoc.enabled&active_enemies<6)&!debuff.havoc.remains
actions+=/dimensional_rift,if=charges=3
actions+=/immolate,if=remains<=tick_time
actions+=/immolate,cycle_targets=1,if=active_enemies>1&remains<=tick_time&(!talent.roaring_blaze.enabled|(!debuff.roaring_blaze.remains&action.conflagrate.charges<2+set_bonus.tier19_4pc))
actions+=/immolate,if=talent.roaring_blaze.enabled&remains<=duration&!debuff.roaring_blaze.remains&target.time_to_die>10&(action.conflagrate.charges=2+set_bonus.tier19_4pc|(action.conflagrate.charges>=1+set_bonus.tier19_4pc&action.conflagrate.recharge_time<cast_time+gcd)|target.time_to_die<24)
actions+=/berserking
actions+=/blood_fury
actions+=/arcane_torrent
actions+=/potion,name=deadly_grace,if=(buff.soul_harvest.remains|trinket.proc.any.react|target.time_to_die<=45)
actions+=/shadowburn,if=buff.conflagration_of_chaos.remains<=action.chaos_bolt.cast_time
actions+=/shadowburn,if=(charges=1+set_bonus.tier19_4pc&recharge_time<action.chaos_bolt.cast_time|charges=2+set_bonus.tier19_4pc)&soul_shard<5
actions+=/conflagrate,if=talent.roaring_blaze.enabled&(charges=2+set_bonus.tier19_4pc|(charges>=1+set_bonus.tier19_4pc&recharge_time<gcd)|target.time_to_die<24)
actions+=/conflagrate,if=talent.roaring_blaze.enabled&debuff.roaring_blaze.stack>0&dot.immolate.remains>dot.immolate.duration*0.3&(active_enemies=1|soul_shard<3)&soul_shard<5
actions+=/conflagrate,if=!talent.roaring_blaze.enabled&buff.backdraft.stack<3&buff.conflagration_of_chaos.remains<=action.chaos_bolt.cast_time
actions+=/conflagrate,if=!talent.roaring_blaze.enabled&buff.backdraft.stack<3&(charges=1+set_bonus.tier19_4pc&recharge_time<action.chaos_bolt.cast_time|charges=2+set_bonus.tier19_4pc)&soul_shard<5
actions+=/life_tap,if=talent.empowered_life_tap.enabled&buff.empowered_life_tap.remains<=gcd
actions+=/dimensional_rift,if=equipped.144369&!buff.lessons_of_spacetime.remains&((!talent.grimoire_of_supremacy.enabled&!cooldown.summon_doomguard.remains)|(talent.grimoire_of_service.enabled&!cooldown.service_pet.remains)|(talent.soul_harvest.enabled&!cooldown.soul_harvest.remains))
actions+=/service_pet
actions+=/summon_infernal,if=artifact.lord_of_flames.rank>0&!buff.lord_of_flames.remains
actions+=/summon_doomguard,if=!talent.grimoire_of_supremacy.enabled&spell_targets.infernal_awakening<=2&(target.time_to_die>180|target.health.pct<=20|target.time_to_die<30)
actions+=/summon_infernal,if=!talent.grimoire_of_supremacy.enabled&spell_targets.infernal_awakening>2
actions+=/summon_doomguard,if=talent.grimoire_of_supremacy.enabled&spell_targets.summon_infernal=1&artifact.lord_of_flames.rank>0&buff.lord_of_flames.remains&!pet.doomguard.active
actions+=/summon_doomguard,if=talent.grimoire_of_supremacy.enabled&spell_targets.summon_infernal=1&equipped.132379&!cooldown.sindorei_spite_icd.remains
actions+=/summon_infernal,if=talent.grimoire_of_supremacy.enabled&spell_targets.summon_infernal>1&equipped.132379&!cooldown.sindorei_spite_icd.remains
actions+=/soul_harvest
actions+=/channel_demonfire,if=dot.immolate.remains>cast_time
actions+=/havoc,if=active_enemies=1&talent.wreak_havoc.enabled&equipped.132375&!debuff.havoc.remains
actions+=/rain_of_fire,if=active_enemies>=3&cooldown.havoc.remains<=12&!talent.wreak_havoc.enabled
actions+=/rain_of_fire,if=active_enemies>=6&talent.wreak_havoc.enabled
actions+=/dimensional_rift,if=!equipped.144369|charges>1|((!talent.grimoire_of_service.enabled|recharge_time<cooldown.service_pet.remains)&(!talent.soul_harvest.enabled|recharge_time<cooldown.soul_harvest.remains)&(!talent.grimoire_of_supremacy.enabled|recharge_time<cooldown.summon_doomguard.remains))
actions+=/life_tap,if=talent.empowered_life_tap.enabled&buff.empowered_life_tap.remains<duration*0.3
actions+=/cataclysm
actions+=/chaos_bolt,if=(cooldown.havoc.remains>12&cooldown.havoc.remains|active_enemies<3|talent.wreak_havoc.enabled&active_enemies<6)&(set_bonus.tier19_4pc=0|!talent.eradication.enabled|buff.embrace_chaos.remains<=cast_time|soul_shard>=3)
actions+=/shadowburn
actions+=/conflagrate,if=!talent.roaring_blaze.enabled&buff.backdraft.stack<3
actions+=/immolate,if=!talent.roaring_blaze.enabled&remains<=duration*0.3
actions+=/incinerate
actions+=/life_tap

head=eyes_of_azjaqir,id=138314,bonus_id=3445
neck=radiant_string_of_scorpid_eyes,id=140898,bonus_id=3445,enchant_id=5439
shoulders=pauldrons_of_azjaqir,id=138323,bonus_id=3445
back=astromancers_greatcloak,id=140909,bonus_id=3518,enchant_id=5436
chest=robes_of_fluctuating_energy,id=140848,bonus_id=3445
wrists=woven_lasher_tendril_bracers,id=140886,bonus_id=3445
hands=clutch_of_azjaqir,id=138311,bonus_id=3445
waist=feretory_of_souls,id=132456,ilevel=940
legs=leggings_of_azjaqir,id=138317,bonus_id=3445
feet=outcast_wanderers_footrags,id=140914,bonus_id=3519
finger1=ring_of_the_scoured_clan,id=140897,bonus_id=3445,enchant=binding_of_haste
finger2=ring_of_braided_stems,id=140896,bonus_id=3518,enchant=binding_of_haste
trinket1=whispers_in_the_dark,id=140809,ilevel=905
trinket2=erratic_metronome,id=140792,ilevel=900
main_hand=scepter_of_sargeras,id=128941,ilevel=929,gem_id=140826/140837/140826,relic_id=3519/3518:3518/3519

# Gear Summary
# gear_ilvl=906.27
# gear_stamina=34467
# gear_intellect=39190
# gear_crit_rating=3577
# gear_haste_rating=11066
# gear_mastery_rating=5695
# gear_versatility_rating=2829
# gear_armor=1981
# set_bonus=tier19_2pc=1
# set_bonus=tier19_4pc=1
default_pet=imp

KJ_Trinket : 1357524 dps, 811806 dps to main target

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR
1357523.9 1357523.9 1152.1 / 0.085% 230463.2 / 17.0% 43.8
RPS Out RPS In Primary Resource Waiting APM Active Skill
24833.7 24833.7 Mana 0.00% 50.2 100.0% 100%
Talents
  • 15: Roaring Blaze (Destruction Warlock)
  • 30: Eradication (Destruction Warlock)
  • 60: Soul Harvest
  • 90: Grimoire of Service
  • 100: Wreak Havoc (Destruction Warlock)
  • Talent Calculator
Artifact

Charts

Abilities

Damage Stats DPS DPS% Execute Interval DPE DPET Type Count Hit Crit Avg Crit% Up%
KJ_Trinket 1357524
Chaos Bolt 393302 29.0% 59.8 4.87sec 1976635 1284109 Direct 114.1 0 1037059 1037059 100.0%  

Stats details: chaos_bolt

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 59.84 114.05 0.00 0.00 1.5393 0.0000 118279237.46 118279237.46 0.00 1284108.54 1284108.54
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
crit 114.05 100.00% 1037059.30 664870 1593612 1037333.23 958659 1105835 118279237 118279237 0.00
 
 

Action details: chaos_bolt

Static Values
  • id:116858
  • school:chromatic
  • resource:soul_shard
  • range:40.0
  • travel_speed:16.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:2.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:3.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:116858
  • name:Chaos Bolt
  • school:chromatic
  • tooltip:
  • description:Unleashes a devastating blast of chaos, causing {$s1=1} Chaos damage. Chaos Bolt always critically strikes and your critical strike chance increases its damage.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:4.000000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
Conflagrate 165987 12.2% 47.9 6.27sec 1041264 992601 Direct 95.2 309520 700584 523348 54.7%  

Stats details: conflagrate

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 47.87 95.24 0.00 0.00 1.0490 0.0000 49842466.72 49842466.72 0.00 992601.00 992601.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 43.16 45.32% 309519.94 200896 481524 309675.51 274239 344955 13358623 13358623 0.00
crit 52.08 54.68% 700583.71 401795 1108295 700838.29 636181 770841 36483844 36483844 0.00
 
 

Action details: conflagrate

Static Values
  • id:17962
  • school:fire
  • resource:chi
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:9.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:talent.roaring_blaze.enabled&(charges=2+set_bonus.tier19_4pc|(charges>=1+set_bonus.tier19_4pc&recharge_time<gcd)|target.time_to_die<24)
Spelldata
  • id:17962
  • name:Conflagrate
  • school:fire
  • tooltip:
  • description:Triggers an explosion on the target, dealing {$s1=1} Fire damage.{$?s196406=false}[ Reduces the cast time of Incinerate and Chaos Bolt by {$117828s1=30}% for {$117828d=10 seconds}.][] |cFFFFFFFFGenerates 1 Soul Shard.|r
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:2.265510
  • base_dd_min:1.00
  • base_dd_max:1.00
 
Cry Havoc 40078 3.0% 51.1 5.65sec 236036 0 Direct 102.1 102530 205222 118018 15.1%  

Stats details: cry_havoc

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 51.07 102.13 0.00 0.00 0.0000 0.0000 12053217.63 12053217.63 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 86.73 84.92% 102530.36 72345 154825 102575.23 95515 110470 8892144 8892144 0.00
crit 15.40 15.08% 205222.12 144692 309648 205328.36 172475 245892 3161074 3161074 0.00
 
 

Action details: cry_havoc

Static Values
  • id:243011
  • school:chromatic
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:243011
  • name:Cry Havoc
  • school:chromatic
  • tooltip:
  • description:Deals {$s2=0} Chaos damage to enemies within $A2 yards.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:1.000000
  • base_dd_min:0.00
  • base_dd_max:0.00
 
Deadly Grace 6055 0.4% 14.2 2.09sec 125758 0 Direct 14.2 109231 218382 125759 15.1%  

Stats details: deadly_grace

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 14.22 14.22 0.00 0.00 0.0000 0.0000 1787755.17 1787755.17 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 12.06 84.86% 109230.89 96891 116269 109241.91 99659 116269 1317686 1317686 0.00
crit 2.15 15.14% 218382.01 193782 232539 196215.11 0 232539 470069 470069 0.00
 
 

Action details: deadly_grace

Static Values
  • id:188091
  • school:arcane
  • resource:none
  • range:40.0
  • travel_speed:25.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:188091
  • name:Deadly Grace
  • school:arcane
  • tooltip:
  • description:Deal {$s1=63339 to 95008} Arcane damage.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:63338.72
  • base_dd_max:95008.08
 
Immolate 304757 22.5% 19.8 15.40sec 4623419 4348223 Direct 38.3 161966 323825 264103 63.1%  
Periodic 290.0 172030 344138 280674 63.1% 195.9%

Stats details: immolate

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 19.80 38.33 290.01 290.01 1.0633 2.0330 91521404.28 91521404.28 0.00 149875.14 4348223.31
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 14.14 36.89% 161966.17 105591 253015 161998.08 128920 197480 2290409 2290409 0.00
crit 24.19 63.11% 323825.15 211194 505911 323857.25 275738 362374 7832593 7832593 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 106.9 36.87% 172030.24 36 502817 172323.16 143888 207953 18396823 18396823 0.00
crit 183.1 63.13% 344137.95 56 1005657 344695.12 301597 395393 63001579 63001579 0.00
 
 

Action details: immolate

Static Values
  • id:348
  • school:fire
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:66000.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:1.50
  • base_crit:0.48
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:remains<=tick_time
Spelldata
  • id:348
  • name:Immolate
  • school:fire
  • tooltip:
  • description:Burns the enemy, causing {$s1=1} Fire damage immediately and an additional $157736o1 Fire damage over {$157736d=18 seconds}. |cFFFFFFFFPeriodic damage has a {$193541s1=15}% chance to generate 1 Soul Shard. Chance doubled on critical strikes.|r
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:1.332000
  • base_dd_min:1.00
  • base_dd_max:1.00
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.721500
  • base_td:0.00
  • dot_duration:18.00
  • base_tick_time:3.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
 
Incinerate 144843 10.7% 73.6 3.91sec 591737 457153 Direct 141.1 268425 536639 308845 15.1%  

Stats details: incinerate

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 73.63 141.07 0.00 0.00 1.2944 0.0000 43567560.41 43567560.41 0.00 457152.63 457152.63
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 119.81 84.93% 268425.31 170686 409109 268494.70 251391 287009 32159334 32159334 0.00
crit 21.26 15.07% 536639.20 341400 818220 536780.11 444884 623913 11408226 11408226 0.00
 
 

Action details: incinerate

Static Values
  • id:29722
  • school:fire
  • resource:mana
  • range:40.0
  • travel_speed:20.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:66000.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:1.88
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:29722
  • name:Incinerate
  • school:fire
  • tooltip:
  • description:Draws fire toward the enemy, dealing {$s2=0} Fire damage.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:2.331000
  • base_dd_min:0.00
  • base_dd_max:0.00
 
Kil'jaeden's Burning Wish 24869 1.8% 4.5 75.49sec 1660853 0 Direct 8.9 0 838600 838600 100.0%  

Stats details: kiljaedens_burning_wish

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 4.48 8.88 0.00 0.00 0.0000 0.0000 7447512.75 7447512.75 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
crit 8.88 100.00% 838600.00 838600 838600 838600.00 838600 838600 7447513 7447513 0.00
 
 

Action details: kiljaedens_burning_wish

Static Values
  • id:235999
  • school:fire
  • resource:none
  • range:100.0
  • travel_speed:10.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:235999
  • name:Kil'jaeden's Burning Wish
  • school:fire
  • tooltip:
  • description:{$@spelldesc235991=Launch a vortex of destruction that seeks your current enemy. When it reaches the target, it explodes, dealing a critical strike to all enemies within $235999A1 yds for ${{$235999s1=112984 to 124877}*{$s2=200}/100} Fire damage.}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:419300.00
  • base_dd_max:419300.00
 
Mark of the Hidden Satyr 10304 0.8% 19.9 15.09sec 155907 0 Direct 19.9 135529 271173 155908 15.0%  

Stats details: mark_of_the_hidden_satyr

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 19.87 19.87 0.00 0.00 0.0000 0.0000 3097123.66 3097123.66 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 16.88 84.98% 135529.44 129188 163044 135555.89 129188 146253 2287856 2287856 0.00
crit 2.98 15.02% 271172.72 258377 326088 258389.93 0 326088 809268 809268 0.00
 
 

Action details: mark_of_the_hidden_satyr

Static Values
  • id:191259
  • school:fire
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:191259
  • name:Mark of the Hidden Satyr
  • school:fire
  • tooltip:
  • description:Deals fire damage.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:2.500000
  • spell_power_mod.direct:2.000000
  • base_dd_min:0.00
  • base_dd_max:0.00
 
pet - imp 48748 / 48748
Firebolt 48748 3.6% 107.6 2.80sec 136164 110709 Direct 106.8 119233 238496 137212 15.1%  

Stats details: firebolt

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 107.57 106.75 0.00 0.00 1.2299 0.0000 14647743.55 14647743.55 0.00 110708.60 110708.60
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 90.66 84.92% 119232.65 76223 144297 119264.76 116413 121816 10809169 10809169 0.00
crit 16.10 15.08% 238495.51 152445 288594 238594.32 214562 265859 3838575 3838575 0.00
 
 

Action details: firebolt

Static Values
  • id:3110
  • school:fire
  • resource:energy
  • range:40.0
  • travel_speed:16.0000
  • trigger_gcd:0.5000
  • min_gcd:0.7500
  • base_cost:40.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:1.75
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:3110
  • name:Firebolt
  • school:fire
  • tooltip:
  • description:Deals {$s1=1} Fire damage to a target.$?a231795[ Damage increased by {$231795s1=50}% if you have Immolated the target.][] |cFF777777(Right-Click to toggle)|r
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:1.000000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
pet - service_imp 140304 / 44909
Firebolt 140304 3.3% 48.4 5.61sec 278147 241901 Direct 48.1 243081 486155 279786 15.1%  

Stats details: firebolt

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 48.36 48.08 0.00 0.00 1.1499 0.0000 13450918.45 13450918.45 0.00 241901.24 241901.24
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 40.82 84.90% 243081.49 152445 288594 243312.12 232072 252177 9921426 9921426 0.00
crit 7.26 15.10% 486154.59 304890 577187 486226.68 0 577187 3529492 3529492 0.00
 
 

Action details: firebolt

Static Values
  • id:3110
  • school:fire
  • resource:energy
  • range:40.0
  • travel_speed:16.0000
  • trigger_gcd:0.5000
  • min_gcd:0.7500
  • base_cost:40.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:1.75
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:3110
  • name:Firebolt
  • school:fire
  • tooltip:
  • description:Deals {$s1=1} Fire damage to a target.$?a231795[ Damage increased by {$231795s1=50}% if you have Immolated the target.][] |cFF777777(Right-Click to toggle)|r
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:1.000000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
pet - infernal 133997 / 11348
Immolation 104320 0.6% 1.0 0.00sec 2608095 0 Periodic 46.3 49033 98065 56388 15.0% 8.2%

Stats details: immolation

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 23.13 46.25 0.0000 1.0616 2608095.43 2608095.43 0.00 106231.74 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 39.3 85.00% 49032.76 42459 50951 49030.14 47738 50345 1927708 1927708 0.00
crit 6.9 15.00% 98064.98 84919 101903 97996.50 0 101903 680387 680387 0.00
 
 

Action details: immolation

Static Values
  • id:19483
  • school:fire
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:!ticking
Spelldata
  • id:19483
  • name:Immolation
  • school:fire
  • tooltip:Burns nearby enemies for {$20153s1=0} fire damage every $t1 seconds.
  • description:Burns nearby enemies for {$20153s1=0} fire damage every $t1 seconds.
 

Action details: immolation_tick

Static Values
  • id:20153
  • school:fire
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:20153
  • name:Immolation
  • school:fire
  • tooltip:
  • description:Deals Fire damage to all enemies near the caster.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.650000
  • base_dd_min:0.00
  • base_dd_max:0.00
 
melee 29678 0.2% 22.0 1.12sec 33726 30187 Direct 22.0 29319 58648 33726 15.0%  

Stats details: melee

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 22.00 22.00 0.00 0.00 1.1173 0.0000 741972.38 1090769.67 31.98 30187.25 30187.25
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 18.69 84.97% 29318.71 25391 30469 29318.60 28353 30469 548085 805736 31.98
crit 3.31 15.03% 58647.63 50782 60938 56913.99 0 60938 193888 285033 31.02
 
 

Action details: melee

Static Values
  • id:0
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Weapon
  • normalized:false
  • weapon_power_mod:0.285714
  • weapon_multiplier:1.00
 
pet - doomguard 106916 / 9057
Doom Bolt 106916 0.7% 10.5 2.22sec 253482 116420 Direct 10.5 220565 440878 253495 14.9%  

Stats details: doom_bolt

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 10.55 10.55 0.00 0.00 2.1774 0.0000 2673006.02 2673006.02 0.00 116420.12 116420.12
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 8.97 85.05% 220565.25 213162 255795 220612.57 213162 255795 1978147 1978147 0.00
crit 1.58 14.95% 440877.76 426324 511589 357128.33 0 511589 694859 694859 0.00
 
 

Action details: doom_bolt

Static Values
  • id:85692
  • school:shadow
  • resource:energy
  • range:30.0
  • travel_speed:20.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:35.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:3.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:85692
  • name:Doom Bolt
  • school:shadow
  • tooltip:
  • description:Sends a shadowy bolt at the enemy, causing {$s1=1} Shadow damage. Deals {$s2=20}% additional damage to targets below 20% health.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:2.750000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
pet - lord_of_flames_infernal 134002 / 11348
Immolation 104321 0.6% 1.0 0.00sec 2608123 0 Periodic 46.3 49031 98089 56388 15.0% 8.2%

Stats details: immolation

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 23.13 46.25 0.0000 1.0616 2608122.60 2608122.60 0.00 106232.85 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 39.3 85.00% 49030.66 42459 50951 49028.57 47823 50728 1927681 1927681 0.00
crit 6.9 15.00% 98088.79 84919 101903 98027.74 0 101903 680441 680441 0.00
 
 

Action details: immolation

Static Values
  • id:19483
  • school:fire
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:!ticking
Spelldata
  • id:19483
  • name:Immolation
  • school:fire
  • tooltip:Burns nearby enemies for {$20153s1=0} fire damage every $t1 seconds.
  • description:Burns nearby enemies for {$20153s1=0} fire damage every $t1 seconds.
 

Action details: immolation_tick

Static Values
  • id:20153
  • school:fire
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:20153
  • name:Immolation
  • school:fire
  • tooltip:
  • description:Deals Fire damage to all enemies near the caster.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.650000
  • base_dd_min:0.00
  • base_dd_max:0.00
 
melee 29682 0.2% 22.0 1.12sec 33730 30191 Direct 22.0 29317 58672 33730 15.0%  

Stats details: melee

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 22.00 22.00 0.00 0.00 1.1173 0.0000 742070.39 1090913.77 31.98 30191.24 30191.24
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 18.69 84.96% 29316.52 25391 30469 29316.02 28516 30187 547987 805592 31.98
crit 3.31 15.04% 58672.34 50782 60938 57082.63 0 60938 194084 285322 31.12
 
 

Action details: melee

Static Values
  • id:0
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Weapon
  • normalized:false
  • weapon_power_mod:0.285714
  • weapon_multiplier:1.00
 
pet - lord_of_flames_infernal 134088 / 11356
Immolation 104367 0.6% 1.0 0.00sec 2609277 0 Periodic 46.3 49030 98096 56413 15.0% 8.2%

Stats details: immolation

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 23.13 46.25 0.0000 1.0616 2609276.77 2609276.77 0.00 106279.86 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 39.3 84.95% 49030.02 42459 50951 49027.48 47606 50372 1926527 1926527 0.00
crit 7.0 15.05% 98095.86 84919 101903 98053.53 0 101903 682750 682750 0.00
 
 

Action details: immolation

Static Values
  • id:19483
  • school:fire
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:!ticking
Spelldata
  • id:19483
  • name:Immolation
  • school:fire
  • tooltip:Burns nearby enemies for {$20153s1=0} fire damage every $t1 seconds.
  • description:Burns nearby enemies for {$20153s1=0} fire damage every $t1 seconds.
 

Action details: immolation_tick

Static Values
  • id:20153
  • school:fire
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:20153
  • name:Immolation
  • school:fire
  • tooltip:
  • description:Deals Fire damage to all enemies near the caster.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.650000
  • base_dd_min:0.00
  • base_dd_max:0.00
 
melee 29721 0.2% 22.0 1.12sec 33776 30232 Direct 22.0 29320 58637 33775 15.2%  

Stats details: melee

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 22.00 22.00 0.00 0.00 1.1173 0.0000 743062.77 1092372.65 31.98 30231.61 30231.61
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 18.66 84.80% 29319.61 25391 30469 29319.90 28516 30170 546994 804133 31.98
crit 3.34 15.20% 58637.45 50782 60938 57072.06 0 60938 196069 288239 31.11
 
 

Action details: melee

Static Values
  • id:0
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Weapon
  • normalized:false
  • weapon_power_mod:0.285714
  • weapon_multiplier:1.00
 
pet - lord_of_flames_infernal 134165 / 11361
Immolation 104465 0.6% 1.0 0.00sec 2611741 0 Periodic 46.3 49034 98054 56467 15.2% 8.2%

Stats details: immolation

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 23.13 46.25 0.0000 1.0616 2611741.36 2611741.36 0.00 106380.24 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 39.2 84.84% 49033.70 42459 50951 49031.74 47767 50492 1924062 1924062 0.00
crit 7.0 15.16% 98054.41 84919 101903 98015.56 0 101903 687679 687679 0.00
 
 

Action details: immolation

Static Values
  • id:19483
  • school:fire
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:!ticking
Spelldata
  • id:19483
  • name:Immolation
  • school:fire
  • tooltip:Burns nearby enemies for {$20153s1=0} fire damage every $t1 seconds.
  • description:Burns nearby enemies for {$20153s1=0} fire damage every $t1 seconds.
 

Action details: immolation_tick

Static Values
  • id:20153
  • school:fire
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:20153
  • name:Immolation
  • school:fire
  • tooltip:
  • description:Deals Fire damage to all enemies near the caster.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.650000
  • base_dd_min:0.00
  • base_dd_max:0.00
 
melee 29699 0.2% 22.0 1.12sec 33751 30209 Direct 22.0 29320 58630 33750 15.1%  

Stats details: melee

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 22.00 22.00 0.00 0.00 1.1173 0.0000 742516.81 1091570.04 31.98 30209.40 30209.40
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 18.67 84.88% 29320.25 25391 30469 29320.08 28516 30469 547540 804936 31.98
crit 3.33 15.12% 58630.28 50782 60938 56823.37 0 60938 194977 286634 31.00
 
 

Action details: melee

Static Values
  • id:0
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Weapon
  • normalized:false
  • weapon_power_mod:0.285714
  • weapon_multiplier:1.00
 
pet - shadowy_tear 135282 / 18006
Shadow Bolt 135282 1.3% 3.3 71.50sec 1631432 0 Periodic 36.4 128773 258117 148271 15.1% 15.0%

Stats details: shadow_bolt

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 3.30 0.00 36.55 36.36 0.0000 1.2314 5390532.21 5390532.21 0.00 119781.62 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 30.9 84.93% 128772.73 82 156775 128072.72 0 156775 3976076 3976076 0.00
crit 5.5 15.07% 258116.82 1247 313550 249649.46 0 313550 1414456 1414456 0.00
 
 

Action details: shadow_bolt

Static Values
  • id:196657
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:20.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:196657
  • name:Shadow Bolt
  • school:shadow
  • tooltip:
  • description:Sends a shadowy bolt at the enemy, causing {$s1=1} Shadow damage.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • dot_duration:14.00
  • base_tick_time:2.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
 
pet - flame_rift 287778 / 80036
Searing Bolt 287778 5.9% 65.5 2.66sec 365619 1108305 Direct 65.1 66956 0 66956 0.0%  
Periodic 138.8 122617 245175 141105 15.1% 45.6%

Stats details: searing_bolt

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 65.47 65.08 138.75 138.75 0.3299 0.9903 23936068.05 23936068.05 0.00 150541.31 1108305.23
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 65.08 100.00% 66956.37 62111 78388 67024.74 0 78388 4357747 4357747 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 117.8 84.92% 122617.39 248 156803 122019.10 0 138934 14446909 14446909 0.00
crit 20.9 15.08% 245175.12 248 313605 243594.43 0 313605 5131412 5131412 0.00
 
 

Action details: searing_bolt

Static Values
  • id:243050
  • school:fire
  • resource:energy
  • range:100.0
  • travel_speed:20.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:1.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:243050
  • name:Searing Bolt
  • school:fire
  • tooltip:Burning for $w2 Fire damage every $t2 sec.
  • description:Sends a searing bolt at the enemy, causing {$s1=1} Fire damage, and an additional $o2 Fire damage over {$d=30 seconds}, stacking up to {$u=20} times.
Direct Damage
  • may_crit:false
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:1.000000
  • base_dd_min:1.00
  • base_dd_max:1.00
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.100000
  • base_td:1.00
  • dot_duration:30.00
  • base_tick_time:1.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
 
pet - chaos_tear 159540 / 8430
Chaos Bolt 159540 0.6% 3.3 69.79sec 766991 382947 Direct 3.3 0 771549 771549 100.0%  

Stats details: chaos_bolt

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 3.30 3.28 0.00 0.00 2.0029 0.0000 2527451.31 2527451.31 0.00 382947.17 382947.17
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
crit 3.28 100.00% 771548.70 714777 902097 771014.94 0 902097 2527451 2527451 0.00
 
 

Action details: chaos_bolt

Static Values
  • id:215279
  • school:chromatic
  • resource:none
  • range:100.0
  • travel_speed:16.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:5.500
  • base_execute_time:3.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:215279
  • name:Chaos Bolt
  • school:chromatic
  • tooltip:
  • description:Unleashes a devastating blast of chaos, causing {$s1=1} Chaos damage. Chaos Bolt always critically strikes and your critical strike chance increases its damage.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:5.000000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
pet - chaos_portal 283024 / 16350
Chaos Barrage 283024 1.2% 3.3 70.83sec 1471919 0 Periodic 114.7 37064 74133 42664 15.1% 6.0%

Stats details: chaos_barrage

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 3.32 0.00 115.16 114.67 0.0000 0.1570 4892112.86 4892112.86 0.00 270671.29 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 97.3 84.89% 37064.47 176 43114 36931.04 0 43114 3608066 3608066 0.00
crit 17.3 15.11% 74132.98 522 86228 73778.42 0 86228 1284047 1284047 0.00
 
 

Action details: chaos_barrage

Static Values
  • id:187394
  • school:magic
  • resource:none
  • range:100.0
  • travel_speed:24.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:187394
  • name:Chaos Barrage
  • school:magic
  • tooltip:
  • description:Deals {$s1=1} Chaos damage.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • dot_duration:5.50
  • base_tick_time:0.25
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
 
Simple Action Stats Execute Interval
KJ_Trinket
augmentation 1.0 0.00sec

Stats details: augmentation

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: augmentation

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:KJ_Trinket
  • harmful:false
  • if_expr:
 
Berserking 2.1 180.53sec

Stats details: berserking

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.06 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: berserking

Static Values
  • id:26297
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:180.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:26297
  • name:Berserking
  • school:physical
  • tooltip:Haste increased by {$s1=15}%.
  • description:Increases your haste by {$s1=15}% for {$d=10 seconds}.
 
Dimensional Rift 12.8 23.74sec

Stats details: dimensional_rift

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 12.84 0.00 0.00 0.00 1.0186 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: dimensional_rift

Static Values
  • id:196586
  • school:none
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:45.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:charges=3
Spelldata
  • id:196586
  • name:Dimensional Rift
  • school:chaos
  • tooltip:
  • description:Rips a hole in time and space, opening a portal that damages your target.
 
flask 1.0 0.00sec

Stats details: flask

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: flask

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:KJ_Trinket
  • harmful:false
  • if_expr:
 
food 1.0 0.00sec

Stats details: food

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: food

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:KJ_Trinket
  • harmful:false
  • if_expr:
 
Havoc 14.9 20.93sec

Stats details: havoc

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 14.88 0.00 0.00 0.00 1.0806 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: havoc

Static Values
  • id:80240
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:88000.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:active_enemies>1&(active_enemies<4|talent.wreak_havoc.enabled&active_enemies<6)&!debuff.havoc.remains
Spelldata
  • id:80240
  • name:Havoc
  • school:shadow
  • tooltip:Spells cast by the Warlock also hit this target.
  • description:Marks a target with Havoc for {$d=8 seconds}, causing your single target spells to also strike the Havoc victim. Limit 1.
 
Life Tap 6.4 34.77sec

Stats details: life_tap

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 6.38 0.00 0.00 0.00 1.0535 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: life_tap

Static Values
  • id:1454
  • school:shadow
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:talent.empowered_life_tap.enabled&!buff.empowered_life_tap.remains
Spelldata
  • id:1454
  • name:Life Tap
  • school:shadow
  • tooltip:
  • description:Restores {$s1=30}% of your maximum mana, at the cost of {$s2=10}% of your maximum health.
 
potion 2.0 0.00sec

Stats details: potion

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: potion

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:60.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
 
Grimoire: Imp (service_imp) 3.7 91.30sec

Stats details: service_imp

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 3.69 0.00 0.00 0.00 0.9803 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: service_imp

Static Values
  • id:111859
  • school:shadow
  • resource:soul_shard
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:1.0
  • secondary_cost:0.0
  • cooldown:90.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:111859
  • name:Grimoire: Imp
  • school:shadow
  • tooltip:
  • description:Summons an Imp who attacks the target for {$108501s1=25} sec. Imps cast ranged Firebolts and cleanse a hostile magic effect from their master.
 
Soul Harvest 2.9 120.95sec

Stats details: soul_harvest

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.90 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: soul_harvest

Static Values
  • id:196098
  • school:shadow
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:120.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:196098
  • name:Soul Harvest
  • school:shadow
  • tooltip:Damage increased by {$s1=20}%.
  • description:Increases your damage and your pets' damage by {$s1=20}%. Lasts {$d=15 seconds}, increased by {$s2=2} sec for each target afflicted by your {$?s137043=false}[Agony][]{$?s137044=false}[Doom][]{$?s137046=false}[Immolate][], up to a maximum of {$s3=35} sec.
 
Summon Doomguard 1.0 0.00sec

Stats details: summon_doomguard

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 1.0937 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: summon_doomguard

Static Values
  • id:18540
  • school:shadow
  • resource:soul_shard
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:1.0
  • secondary_cost:0.0
  • cooldown:180.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:talent.grimoire_of_supremacy.enabled&active_enemies=1&artifact.lord_of_flames.rank=0
Spelldata
  • id:18540
  • name:Summon Doomguard
  • school:shadow
  • tooltip:
  • description:Summons a Doomguard for {$60478d=25 seconds} to assault the target with its Doom Bolts.
 
Summon Imp 1.0 0.00sec

Stats details: summon_imp

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: summon_imp

Static Values
  • id:688
  • school:shadow
  • resource:soul_shard
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:1.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:2.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:!talent.grimoire_of_supremacy.enabled&(!talent.grimoire_of_sacrifice.enabled|buff.demonic_power.down)
Spelldata
  • id:688
  • name:Summon Imp
  • school:shadow
  • tooltip:
  • description:Summons an Imp under your command that casts ranged Firebolts.$?s74434[ |cFFFFFFFFSoulburn:|r |cFF8282FFInstant cast.|r][]
 
Summon Infernal 1.0 0.00sec

Stats details: summon_infernal

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.7653 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: summon_infernal

Static Values
  • id:1122
  • school:shadow
  • resource:soul_shard
  • range:30.0
  • travel_speed:1.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:1.0
  • secondary_cost:0.0
  • cooldown:180.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:talent.grimoire_of_supremacy.enabled&artifact.lord_of_flames.rank>0
Spelldata
  • id:1122
  • name:Summon Infernal
  • school:shadow
  • tooltip:
  • description:Summons an Infernal from the Twisting Nether, impacting for {$22703s1=0} Fire damage and stunning all enemy targets in the area for {$22703d=2 seconds}. The Infernal will serve you for {$111685d=25 seconds}, dealing strong area-of-effect damage.
 

Buffs

Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit Overflow Expiry
Berserking 2.1 0.0 180.5sec 180.5sec 6.86% 21.11% 0.0(0.0) 2.0

Buff details

  • buff initial source:KJ_Trinket
  • cooldown name:buff_berserking
  • max_stacks:1
  • duration:10.00
  • cooldown:180.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • berserking_1:6.86%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:26297
  • name:Berserking
  • tooltip:Haste increased by {$s1=15}%.
  • description:Increases your haste by {$s1=15}% for {$d=10 seconds}.
  • max_stacks:0
  • duration:10.00
  • cooldown:180.00
  • default_chance:0.00%
Bloodlust 1.0 0.0 0.0sec 0.0sec 13.55% 13.55% 0.0(0.0) 1.0

Buff details

  • buff initial source:KJ_Trinket
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • duration:40.00
  • cooldown:300.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • bloodlust_1:13.55%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:2825
  • name:Bloodlust
  • tooltip:Haste increased by {$s1=30}%.
  • description:Increases Haste by {$s1=30}% for all party and raid members for {$d=40 seconds}. Allies receiving this effect will become Sated and unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.
  • max_stacks:0
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
Conflagration of Chaos 23.9 0.0 12.5sec 12.5sec 49.10% 46.70% 0.0(0.0) 1.1

Buff details

  • buff initial source:KJ_Trinket
  • cooldown name:buff_conflagration_of_chaos
  • max_stacks:1
  • duration:20.00
  • cooldown:0.00
  • default_chance:50.00%
  • default_value:-0.00

Stack Uptimes

  • conflagration_of_chaos_1:49.10%

Trigger Attempt Success

  • trigger_pct:49.97%

Spelldata details

  • id:196546
  • name:Conflagration of Chaos
  • tooltip:Your {$?s17877=false}[Shadowburn][Conflagrate] will always critically strike. Critical strike chance will increase the critical strike damage of {$?s17877=false}[Shadowburn][Conflagrate].
  • description:{$@spelldesc219195={$?s17877=false}[Shadowburn][Conflagrate] has a chance to guarantee your next {$?s17877=false}[Shadowburn][Conflagrate] critically strikes, and to increase its damage by your critical strike chance.}
  • max_stacks:0
  • duration:20.00
  • cooldown:0.00
  • default_chance:100.00%
Devil's Due 3.5 0.0 69.5sec 69.5sec 8.74% 8.74% 0.0(0.0) 3.2

Buff details

  • buff initial source:KJ_Trinket
  • cooldown name:buff_devils_due
  • max_stacks:1
  • duration:8.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.18

Stack Uptimes

  • devils_due_1:8.74%

Trigger Attempt Success

  • trigger_pct:99.93%

Spelldata details

  • id:225776
  • name:Devil's Due
  • tooltip:Cast speed slowed by {$s1=7}%.
  • description:{$@spelldesc225142=Your damaging spells have a chance to grant Nefarious Pact, increasing your casting speed by {$225774s1=17}% for {$225774d=12 seconds}. When Nefarious Pact expires, your casting speed is decreased by {$225776s1=7}% for {$225776d=8 seconds}.}
  • max_stacks:0
  • duration:8.00
  • cooldown:0.00
  • default_chance:0.00%
Embrace Chaos 32.8 28.1 9.3sec 4.9sec 66.23% 77.66% 28.1(28.1) 32.1

Buff details

  • buff initial source:KJ_Trinket
  • cooldown name:buff_embrace_chaos
  • max_stacks:1
  • duration:4.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • embrace_chaos_1:66.23%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:212019
  • name:Embrace Chaos
  • tooltip:Chaos Bolt has {$s1=40}% reduced cast time.
  • description:{$@spelldesc212018=Casting Chaos Bolt reduces the cast time of your next Chaos Bolt by {$212019s1=40}% for {$212019d=4 seconds}.}
  • max_stacks:0
  • duration:4.00
  • cooldown:0.00
  • default_chance:0.00%
Lord of Flames 1.0 0.0 0.0sec 0.0sec 97.87% 97.87% 0.0(0.0) 0.0

Buff details

  • buff initial source:KJ_Trinket
  • cooldown name:buff_lord_of_flames
  • max_stacks:1
  • duration:600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • lord_of_flames_1:97.87%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:226802
  • name:Lord of Flames
  • tooltip:Recently activated Lord of Flames.
  • description:{$@spelldesc224103=Once every {$s2=10} minutes, {$?s152107=false}[your Infernal's Meteor Strike][Summon Infernal] will summon {$s3=3} additional Infernals to serve you for {$226804d=25 seconds}.}
  • max_stacks:0
  • duration:600.00
  • cooldown:0.00
  • default_chance:0.00%
Nefarious Pact 3.5 0.0 69.8sec 69.1sec 13.59% 13.59% 0.0(0.0) 3.3

Buff details

  • buff initial source:KJ_Trinket
  • cooldown name:buff_nefarious_pact
  • max_stacks:1
  • duration:12.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.44

Stack Uptimes

  • nefarious_pact_1:13.59%

Trigger Attempt Success

  • trigger_pct:99.93%

Spelldata details

  • id:225774
  • name:Nefarious Pact
  • tooltip:Cast speed increased by {$s1=17}%.
  • description:{$@spelldesc225142=Your damaging spells have a chance to grant Nefarious Pact, increasing your casting speed by {$225774s1=17}% for {$225774d=12 seconds}. When Nefarious Pact expires, your casting speed is decreased by {$225776s1=7}% for {$225776d=8 seconds}.}
  • max_stacks:0
  • duration:12.00
  • cooldown:0.00
  • default_chance:0.00%
Potion of Deadly Grace 1.0 0.0 0.0sec 0.0sec 10.16% 10.16% 0.0(0.0) 1.0

Buff details

  • buff initial source:KJ_Trinket
  • cooldown name:buff_potion_of_deadly_grace
  • max_stacks:1
  • duration:30.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • potion_of_deadly_grace_1:10.16%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:188027
  • name:Potion of Deadly Grace
  • tooltip:Your attacks have a chance to unleash a bolt of energy at your target.
  • description:Grants your attacks a chance to unleash a bolt of energy at your target. Staying away from enemies for the entire duration of the effect will extend the effect by an additional 5 seconds.
  • max_stacks:0
  • duration:25.00
  • cooldown:1.00
  • default_chance:101.00%
Potion of Prolonged Power 1.0 0.0 0.0sec 0.0sec 19.64% 19.64% 0.0(0.0) 1.0

Buff details

  • buff initial source:KJ_Trinket
  • cooldown name:buff_potion_of_prolonged_power
  • max_stacks:1
  • duration:60.00
  • cooldown:1.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:all
  • amount:2500.00

Stack Uptimes

  • potion_of_prolonged_power_1:19.64%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:229206
  • name:Potion of Prolonged Power
  • tooltip:All stats increased by {$s1=2500}.
  • description:Drink to increase all stats by {$s1=2500} for {$d=60 seconds}.
  • max_stacks:0
  • duration:60.00
  • cooldown:1.00
  • default_chance:0.00%
Soul Harvest 2.9 0.0 121.0sec 121.0sec 17.78% 17.78% 0.0(0.0) 2.7

Buff details

  • buff initial source:KJ_Trinket
  • cooldown name:buff_soul_harvest
  • max_stacks:1
  • duration:15.00
  • cooldown:120.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • soul_harvest_1:17.78%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:196098
  • name:Soul Harvest
  • tooltip:Damage increased by {$s1=20}%.
  • description:Increases your damage and your pets' damage by {$s1=20}%. Lasts {$d=15 seconds}, increased by {$s2=2} sec for each target afflicted by your {$?s137043=false}[Agony][]{$?s137044=false}[Doom][]{$?s137046=false}[Immolate][], up to a maximum of {$s3=35} sec.
  • max_stacks:0
  • duration:15.00
  • cooldown:120.00
  • default_chance:0.00%
Constant Buffs
Well Fed (azshari_salad)

Buff details

  • buff initial source:KJ_Trinket
  • cooldown name:buff_azshari_salad
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:haste_rating
  • amount:375.00

Stack Uptimes

  • azshari_salad_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:225603
  • name:Well Fed
  • tooltip:Haste increased by $w1.
  • description:Increases haste by {$s1=375} for {$d=3600 seconds}.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Defiled Augmentation

Buff details

  • buff initial source:KJ_Trinket
  • cooldown name:buff_defiled_augmentation
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:agility
  • amount:325.00
  • stat:strength
  • amount:325.00
  • stat:intellect
  • amount:325.00

Stack Uptimes

  • defiled_augmentation_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:224001
  • name:Defiled Augmentation
  • tooltip:Agility, Intellect and Strength increased by $w1.
  • description:Increases Agility, Intellect and Strength by {$s1=325} for {$d=3600 seconds}. Augment Rune.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Flask of the Whispered Pact

Buff details

  • buff initial source:KJ_Trinket
  • cooldown name:buff_flask_of_the_whispered_pact
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:intellect
  • amount:1300.00

Stack Uptimes

  • flask_of_the_whispered_pact_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:188031
  • name:Flask of the Whispered Pact
  • tooltip:Intellect increased by $w1.
  • description:Increases Intellect by {$s1=1300} for {$d=3600 seconds}. Counts as both a Battle and Guardian elixir. This effect persists through death.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:101.00%
Tormented Souls

Buff details

  • buff initial source:KJ_Trinket
  • cooldown name:buff_tormented_souls
  • max_stacks:12
  • duration:0.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00

Stack Uptimes

  • tormented_souls_2:0.37%
  • tormented_souls_3:99.63%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:216695
  • name:Tormented Souls
  • tooltip:Activate Reap Souls to consume all Tormented Souls collected by |cFFFFCC99Ulthalesh|r, increasing your damage by 10% and doubling the effect of all of |cFFFFCC99Ulthalesh|r's other traits for {$216708d=5 seconds} per soul consumed.
  • description:Activate Reap Souls to consume all Tormented Souls collected by |cFFFFCC99Ulthalesh|r, increasing your damage by 10% and doubling the effect of all of |cFFFFCC99Ulthalesh|r's other traits for {$216708d=5 seconds} per soul consumed.
  • max_stacks:12
  • duration:-0.00
  • cooldown:0.00
  • default_chance:101.00%

Procs

Count Interval
shadowy_tear 3.2 71.0sec
flame_rift 3.2 71.2sec
chaos_tear 3.2 70.2sec
chaos_portal 3.2 71.0sec
dimension_ripper 3.7 56.7sec
t19_2pc_chaos_bolt 40.5 7.1sec

Resources

Resource Usage Type Count Total Average RPE APR
KJ_Trinket
chaos_bolt Soul Shard 60.8 121.7 2.0 2.0 972066.8
havoc Mana 14.9 1309328.8 88000.0 88000.3 0.0
immolate Mana 19.8 1306467.5 66000.0 65999.3 70.1
incinerate Mana 73.6 4859270.6 66000.0 65998.9 9.0
service_imp Soul Shard 3.7 3.7 1.0 1.0 0.0
summon_doomguard Soul Shard 1.0 1.0 1.0 1.0 0.0
summon_infernal Soul Shard 1.0 1.0 1.0 1.0 0.0
pet - imp
firebolt Energy 107.6 4303.0 40.0 40.0 3404.1
pet - service_imp
firebolt Energy 48.4 1934.4 40.0 40.0 6953.5
pet - doomguard
doom_bolt Energy 10.5 369.1 35.0 35.0 7242.4
pet - flame_rift
searing_bolt Energy 63.6 63.6 1.0 1.0 376385.1
Resource Gains Type Count Total Average Overflow
life_tap Mana 6.38 2106022.19 (31.87%) 330000.00 0.00 0.00%
immolate Soul Shard 70.88 69.80 (55.10%) 0.98 1.08 1.53%
conflagrate Soul Shard 47.87 47.76 (37.71%) 1.00 0.11 0.22%
mp5_regen Mana 467.59 4502871.12 (68.13%) 9630.04 73517.93 1.61%
soulsnatcher Soul Shard 9.11 9.11 (7.19%) 1.00 0.00 0.00%
pet - imp
energy_regen Energy 1899.00 4136.75 (100.00%) 2.18 21.45 0.52%
pet - service_imp
energy_regen Energy 440.06 1320.56 (100.00%) 3.00 61.86 4.47%
pet - doomguard
energy_regen Energy 15.24 328.00 (100.00%) 21.53 42.50 11.47%
Resource RPS-Gain RPS-Loss
Health 0.00 6818.40
Mana 21956.15 24833.72
Soul Shard 0.42 0.42
Combat End Resource Mean Min Max
Mana 233243.76 9450.46 491601.36
Soul Shard 2.30 0.00 5.00

Benefits & Uptimes

Benefits %
Uptimes %
Mana Cap 1.1%

Statistics & Data Analysis

Fight Length
Sample Data KJ_Trinket Fight Length
Count 9999
Mean 301.01
Minimum 217.68
Maximum 385.07
Spread ( max - min ) 167.39
Range [ ( max - min ) / 2 * 100% ] 27.80%
DPS
Sample Data KJ_Trinket Damage Per Second
Count 9999
Mean 1357523.91
Minimum 1161785.14
Maximum 1629721.26
Spread ( max - min ) 467936.13
Range [ ( max - min ) / 2 * 100% ] 17.23%
Standard Deviation 58779.5069
5th Percentile 1265032.85
95th Percentile 1459872.47
( 95th Percentile - 5th Percentile ) 194839.62
Mean Distribution
Standard Deviation 587.8245
95.00% Confidence Intervall ( 1356371.79 - 1358676.02 )
Normalized 95.00% Confidence Intervall ( 99.92% - 100.08% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 73
0.1% Error 7202
0.1 Scale Factor Error with Delta=300 29494127
0.05 Scale Factor Error with Delta=300 117976508
0.01 Scale Factor Error with Delta=300 2949412694
Priority Target DPS
Sample Data KJ_Trinket Priority Target Damage Per Second
Count 9999
Mean 811806.07
Minimum 669477.70
Maximum 1031700.88
Spread ( max - min ) 362223.18
Range [ ( max - min ) / 2 * 100% ] 22.31%
Standard Deviation 45082.2820
5th Percentile 742950.70
95th Percentile 890379.95
( 95th Percentile - 5th Percentile ) 147429.25
Mean Distribution
Standard Deviation 450.8454
95.00% Confidence Intervall ( 810922.42 - 812689.71 )
Normalized 95.00% Confidence Intervall ( 99.89% - 100.11% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 119
0.1% Error 11847
0.1 Scale Factor Error with Delta=300 17349840
0.05 Scale Factor Error with Delta=300 69399357
0.01 Scale Factor Error with Delta=300 1734983906
DPS(e)
Sample Data KJ_Trinket Damage Per Second (Effective)
Count 9999
Mean 1357523.91
Minimum 1161785.14
Maximum 1629721.26
Spread ( max - min ) 467936.13
Range [ ( max - min ) / 2 * 100% ] 17.23%
Damage
Sample Data KJ_Trinket Damage
Count 9999
Mean 327596278.09
Minimum 232190324.82
Maximum 432918612.05
Spread ( max - min ) 200728287.23
Range [ ( max - min ) / 2 * 100% ] 30.64%
DTPS
Sample Data KJ_Trinket Damage Taken Per Second
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HPS
Sample Data KJ_Trinket Healing Per Second
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
HPS(e)
Sample Data KJ_Trinket Healing Per Second (Effective)
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
Sample Data KJ_Trinket Heal
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
Sample Data KJ_Trinket Healing Taken Per Second
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
TMI
Sample Data KJ_Trinket Theck-Meloree Index
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
ETMI
Sample Data KJ_TrinketTheck-Meloree Index (Effective)
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
MSD
Sample Data KJ_Trinket Max Spike Value
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 flask,type=whispered_pact
1 0.00 food,type=azshari_salad
2 0.00 summon_pet,if=!talent.grimoire_of_supremacy.enabled&(!talent.grimoire_of_sacrifice.enabled|buff.demonic_power.down)
3 0.00 summon_infernal,if=talent.grimoire_of_supremacy.enabled&artifact.lord_of_flames.rank>0
4 0.00 summon_infernal,if=talent.grimoire_of_supremacy.enabled&active_enemies>1
5 0.00 summon_doomguard,if=talent.grimoire_of_supremacy.enabled&active_enemies=1&artifact.lord_of_flames.rank=0
6 0.00 augmentation,type=defiled
7 0.00 snapshot_stats
8 0.00 grimoire_of_sacrifice,if=talent.grimoire_of_sacrifice.enabled
9 0.00 life_tap,if=talent.empowered_life_tap.enabled&!buff.empowered_life_tap.remains
A 0.00 potion,name=prolonged_power
B 0.00 chaos_bolt
Default action list Executed every time the actor is available.
# count action,conditions
C 4.48 use_item,name=kiljaedens_burning_wish
D 14.88 havoc,target=2,if=active_enemies>1&(active_enemies<4|talent.wreak_havoc.enabled&active_enemies<6)&!debuff.havoc.remains
E 1.00 dimensional_rift,if=charges=3
F 10.28 immolate,if=remains<=tick_time
G 0.63 immolate,cycle_targets=1,if=active_enemies>1&remains<=tick_time&(!talent.roaring_blaze.enabled|(!debuff.roaring_blaze.remains&action.conflagrate.charges<2+set_bonus.tier19_4pc))
H 8.94 immolate,if=talent.roaring_blaze.enabled&remains<=duration&!debuff.roaring_blaze.remains&target.time_to_die>10&(action.conflagrate.charges=2+set_bonus.tier19_4pc|(action.conflagrate.charges>=1+set_bonus.tier19_4pc&action.conflagrate.recharge_time<cast_time+gcd)|target.time_to_die<24)
I 2.06 berserking
0.00 blood_fury
0.00 arcane_torrent
J 1.00 potion,name=deadly_grace,if=(buff.soul_harvest.remains|trinket.proc.any.react|target.time_to_die<=45)
0.00 shadowburn,if=buff.conflagration_of_chaos.remains<=action.chaos_bolt.cast_time
0.00 shadowburn,if=(charges=1+set_bonus.tier19_4pc&recharge_time<action.chaos_bolt.cast_time|charges=2+set_bonus.tier19_4pc)&soul_shard<5
K 13.93 conflagrate,if=talent.roaring_blaze.enabled&(charges=2+set_bonus.tier19_4pc|(charges>=1+set_bonus.tier19_4pc&recharge_time<gcd)|target.time_to_die<24)
L 33.95 conflagrate,if=talent.roaring_blaze.enabled&debuff.roaring_blaze.stack>0&dot.immolate.remains>dot.immolate.duration*0.3&(active_enemies=1|soul_shard<3)&soul_shard<5
0.00 conflagrate,if=!talent.roaring_blaze.enabled&buff.backdraft.stack<3&buff.conflagration_of_chaos.remains<=action.chaos_bolt.cast_time
0.00 conflagrate,if=!talent.roaring_blaze.enabled&buff.backdraft.stack<3&(charges=1+set_bonus.tier19_4pc&recharge_time<action.chaos_bolt.cast_time|charges=2+set_bonus.tier19_4pc)&soul_shard<5
0.00 life_tap,if=talent.empowered_life_tap.enabled&buff.empowered_life_tap.remains<=gcd
0.00 dimensional_rift,if=equipped.144369&!buff.lessons_of_spacetime.remains&((!talent.grimoire_of_supremacy.enabled&!cooldown.summon_doomguard.remains)|(talent.grimoire_of_service.enabled&!cooldown.service_pet.remains)|(talent.soul_harvest.enabled&!cooldown.soul_harvest.remains))
M 3.69 service_pet
N 1.00 summon_infernal,if=artifact.lord_of_flames.rank>0&!buff.lord_of_flames.remains
O 1.00 summon_doomguard,if=!talent.grimoire_of_supremacy.enabled&spell_targets.infernal_awakening<=2&(target.time_to_die>180|target.health.pct<=20|target.time_to_die<30)
0.00 summon_infernal,if=!talent.grimoire_of_supremacy.enabled&spell_targets.infernal_awakening>2
0.00 summon_doomguard,if=talent.grimoire_of_supremacy.enabled&spell_targets.summon_infernal=1&artifact.lord_of_flames.rank>0&buff.lord_of_flames.remains&!pet.doomguard.active
0.00 summon_doomguard,if=talent.grimoire_of_supremacy.enabled&spell_targets.summon_infernal=1&equipped.132379&!cooldown.sindorei_spite_icd.remains
0.00 summon_infernal,if=talent.grimoire_of_supremacy.enabled&spell_targets.summon_infernal>1&equipped.132379&!cooldown.sindorei_spite_icd.remains
P 2.90 soul_harvest
0.00 channel_demonfire,if=dot.immolate.remains>cast_time
0.00 havoc,if=active_enemies=1&talent.wreak_havoc.enabled&equipped.132375&!debuff.havoc.remains
0.00 rain_of_fire,if=active_enemies>=3&cooldown.havoc.remains<=12&!talent.wreak_havoc.enabled
0.00 rain_of_fire,if=active_enemies>=6&talent.wreak_havoc.enabled
Q 11.84 dimensional_rift,if=!equipped.144369|charges>1|((!talent.grimoire_of_service.enabled|recharge_time<cooldown.service_pet.remains)&(!talent.soul_harvest.enabled|recharge_time<cooldown.soul_harvest.remains)&(!talent.grimoire_of_supremacy.enabled|recharge_time<cooldown.summon_doomguard.remains))
0.00 life_tap,if=talent.empowered_life_tap.enabled&buff.empowered_life_tap.remains<duration*0.3
0.00 cataclysm
R 60.16 chaos_bolt,if=(cooldown.havoc.remains>12&cooldown.havoc.remains|active_enemies<3|talent.wreak_havoc.enabled&active_enemies<6)&(set_bonus.tier19_4pc=0|!talent.eradication.enabled|buff.embrace_chaos.remains<=cast_time|soul_shard>=3)
0.00 shadowburn
0.00 conflagrate,if=!talent.roaring_blaze.enabled&buff.backdraft.stack<3
0.00 immolate,if=!talent.roaring_blaze.enabled&remains<=duration*0.3
S 73.95 incinerate
T 6.38 life_tap

Sample Sequence

0126ABCDEFHIKLMLNPQQRLRRLSSSRSLQRDRSSSSRSFRSSSHKLRRLRDLSRLQSSSSRSSSFRSSTDHKLRLRRLRCSSRLSDRFSSSRSQTSSRSHKLMLDRRLRSRLSSRFSSDTRPJSSHKRLQRRLLRDRLRSCSRFSSRSSRSDHKLRLRLRSSQLIRRDRSFMTSSSQHKRLRLSDQRLRLRSSSFRSCQODSTHKLRLSSRRRLSLDPRSSSSSTFSSSSSRHDKKKQRGKRMRRKRSSDTFKRSS

Sample Sequence Table

time list # name target resources buffs
Pre precombat 0 flask KJ_Trinket 1100000.0/1100000: 100% mana | 3.0/5: 60% soul_shard
Pre precombat 1 food KJ_Trinket 1100000.0/1100000: 100% mana | 3.0/5: 60% soul_shard
Pre precombat 2 summon_imp Fluffy_Pillow 1100000.0/1100000: 100% mana | 3.0/5: 60% soul_shard
Pre precombat 6 augmentation KJ_Trinket 1100000.0/1100000: 100% mana | 3.0/5: 60% soul_shard
Pre precombat A potion Fluffy_Pillow 1100000.0/1100000: 100% mana | 3.0/5: 60% soul_shard potion_of_prolonged_power
0:00.000 precombat B chaos_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 1.0/5: 20% soul_shard embrace_chaos, potion_of_prolonged_power
0:00.000 default C use_item_kiljaedens_burning_wish Fluffy_Pillow 1100000.0/1100000: 100% mana | 1.0/5: 20% soul_shard embrace_chaos, potion_of_prolonged_power
0:00.000 default D havoc enemy2 1100000.0/1100000: 100% mana | 1.0/5: 20% soul_shard embrace_chaos, potion_of_prolonged_power
0:01.145 default E dimensional_rift Fluffy_Pillow 1033514.3/1100000: 94% mana | 1.0/5: 20% soul_shard bloodlust, embrace_chaos, potion_of_prolonged_power
0:02.029 default F immolate Fluffy_Pillow 1050124.5/1100000: 95% mana | 1.0/5: 20% soul_shard bloodlust, embrace_chaos, potion_of_prolonged_power
0:02.912 default H immolate Fluffy_Pillow 1000716.0/1100000: 91% mana | 1.0/5: 20% soul_shard bloodlust, embrace_chaos, potion_of_prolonged_power
0:03.795 default I berserking Fluffy_Pillow 951307.4/1100000: 86% mana | 1.0/5: 20% soul_shard bloodlust, embrace_chaos, potion_of_prolonged_power
0:03.795 default K conflagrate Fluffy_Pillow 951307.4/1100000: 86% mana | 1.0/5: 20% soul_shard bloodlust, berserking, embrace_chaos, potion_of_prolonged_power
0:04.563 default L conflagrate Fluffy_Pillow 967902.5/1100000: 88% mana | 2.0/5: 40% soul_shard bloodlust, berserking, conflagration_of_chaos, potion_of_prolonged_power
0:05.331 default M service_imp Fluffy_Pillow 984497.7/1100000: 89% mana | 3.0/5: 60% soul_shard bloodlust, berserking, conflagration_of_chaos, potion_of_prolonged_power
0:06.102 default L conflagrate Fluffy_Pillow 1001157.7/1100000: 91% mana | 2.0/5: 40% soul_shard bloodlust, berserking, conflagration_of_chaos, potion_of_prolonged_power
0:06.870 default N summon_infernal Fluffy_Pillow 1017752.9/1100000: 93% mana | 3.0/5: 60% soul_shard bloodlust, berserking, potion_of_prolonged_power
0:07.639 default P soul_harvest Fluffy_Pillow 1034369.6/1100000: 94% mana | 2.0/5: 40% soul_shard bloodlust, berserking, lord_of_flames, potion_of_prolonged_power
0:07.639 default Q dimensional_rift Fluffy_Pillow 1034369.6/1100000: 94% mana | 2.0/5: 40% soul_shard bloodlust, berserking, soul_harvest, lord_of_flames, potion_of_prolonged_power
0:08.408 default Q dimensional_rift Fluffy_Pillow 1050986.4/1100000: 96% mana | 3.0/5: 60% soul_shard bloodlust, berserking, soul_harvest, lord_of_flames, potion_of_prolonged_power
0:09.176 default R chaos_bolt Fluffy_Pillow 1067581.6/1100000: 97% mana | 3.0/5: 60% soul_shard bloodlust, berserking, soul_harvest, lord_of_flames, potion_of_prolonged_power
0:10.709 default L conflagrate Fluffy_Pillow 1100000.0/1100000: 100% mana | 1.0/5: 20% soul_shard bloodlust, berserking, soul_harvest, lord_of_flames, embrace_chaos, potion_of_prolonged_power
0:11.477 default R chaos_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 4.0/5: 80% soul_shard bloodlust, berserking, soul_harvest, lord_of_flames, embrace_chaos, potion_of_prolonged_power
0:12.396 default R chaos_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 3.0/5: 60% soul_shard bloodlust, berserking, soul_harvest, lord_of_flames, embrace_chaos, potion_of_prolonged_power
0:13.316 default L conflagrate Fluffy_Pillow 1100000.0/1100000: 100% mana | 1.0/5: 20% soul_shard bloodlust, berserking, soul_harvest, lord_of_flames, embrace_chaos, potion_of_prolonged_power
0:14.084 default S incinerate Fluffy_Pillow 1100000.0/1100000: 100% mana | 2.0/5: 40% soul_shard bloodlust, soul_harvest, lord_of_flames, conflagration_of_chaos, embrace_chaos, nefarious_pact, potion_of_prolonged_power
0:14.849 default S incinerate Fluffy_Pillow 1034056.4/1100000: 94% mana | 2.0/5: 40% soul_shard bloodlust, soul_harvest, lord_of_flames, conflagration_of_chaos, embrace_chaos, nefarious_pact, potion_of_prolonged_power
0:15.616 default S incinerate Fluffy_Pillow 982468.2/1100000: 89% mana | 2.0/5: 40% soul_shard bloodlust, soul_harvest, lord_of_flames, conflagration_of_chaos, embrace_chaos, nefarious_pact, potion_of_prolonged_power
0:16.383 default R chaos_bolt Fluffy_Pillow 930880.0/1100000: 85% mana | 3.0/5: 60% soul_shard bloodlust, soul_harvest, lord_of_flames, conflagration_of_chaos, embrace_chaos, nefarious_pact, potion_of_prolonged_power
0:17.137 default S incinerate Fluffy_Pillow 945047.5/1100000: 86% mana | 2.0/5: 40% soul_shard bloodlust, soul_harvest, lord_of_flames, conflagration_of_chaos, embrace_chaos, nefarious_pact, potion_of_prolonged_power
0:17.901 default L conflagrate Fluffy_Pillow 893402.9/1100000: 81% mana | 2.0/5: 40% soul_shard bloodlust, soul_harvest, lord_of_flames, conflagration_of_chaos, embrace_chaos, nefarious_pact, potion_of_prolonged_power
0:18.852 default Q dimensional_rift Fluffy_Pillow 911272.0/1100000: 83% mana | 4.0/5: 80% soul_shard bloodlust, soul_harvest, lord_of_flames, embrace_chaos, nefarious_pact, potion_of_prolonged_power
0:19.605 default R chaos_bolt Fluffy_Pillow 925420.7/1100000: 84% mana | 5.0/5: 100% soul_shard bloodlust, soul_harvest, lord_of_flames, embrace_chaos, nefarious_pact, potion_of_prolonged_power
0:20.360 default D havoc enemy2 939607.1/1100000: 85% mana | 4.0/5: 80% soul_shard bloodlust, soul_harvest, lord_of_flames, embrace_chaos, nefarious_pact, potion_of_prolonged_power
0:21.115 default R chaos_bolt Fluffy_Pillow 865793.4/1100000: 79% mana | 4.0/5: 80% soul_shard bloodlust, soul_harvest, lord_of_flames, embrace_chaos, nefarious_pact, potion_of_prolonged_power
0:21.869 default S incinerate Fluffy_Pillow 879960.9/1100000: 80% mana | 2.0/5: 40% soul_shard bloodlust, soul_harvest, lord_of_flames, embrace_chaos, nefarious_pact, potion_of_prolonged_power
0:22.637 default S incinerate Fluffy_Pillow 828391.5/1100000: 75% mana | 2.0/5: 40% soul_shard bloodlust, soul_harvest, lord_of_flames, embrace_chaos, nefarious_pact, potion_of_prolonged_power
0:23.402 default S incinerate Fluffy_Pillow 776765.7/1100000: 71% mana | 2.0/5: 40% soul_shard bloodlust, soul_harvest, lord_of_flames, embrace_chaos, nefarious_pact, potion_of_prolonged_power
0:24.169 default S incinerate Fluffy_Pillow 725177.5/1100000: 66% mana | 2.0/5: 40% soul_shard bloodlust, soul_harvest, lord_of_flames, embrace_chaos, nefarious_pact, potion_of_prolonged_power
0:24.936 default R chaos_bolt Fluffy_Pillow 673589.3/1100000: 61% mana | 3.0/5: 60% soul_shard bloodlust, soul_harvest, lord_of_flames, embrace_chaos, nefarious_pact, potion_of_prolonged_power
0:25.692 default S incinerate Fluffy_Pillow 687794.4/1100000: 63% mana | 2.0/5: 40% soul_shard bloodlust, soul_harvest, lord_of_flames, embrace_chaos, nefarious_pact, potion_of_prolonged_power
0:26.459 default F immolate Fluffy_Pillow 636206.2/1100000: 58% mana | 2.0/5: 40% soul_shard bloodlust, soul_harvest, lord_of_flames, embrace_chaos, devils_due, potion_of_prolonged_power
0:27.498 default R chaos_bolt Fluffy_Pillow 589728.8/1100000: 54% mana | 3.0/5: 60% soul_shard bloodlust, lord_of_flames, embrace_chaos, devils_due, potion_of_prolonged_power
0:28.745 default S incinerate Fluffy_Pillow 613159.7/1100000: 56% mana | 1.0/5: 20% soul_shard bloodlust, lord_of_flames, embrace_chaos, devils_due, potion_of_prolonged_power
0:30.044 default S incinerate Fluffy_Pillow 571567.7/1100000: 52% mana | 1.0/5: 20% soul_shard bloodlust, lord_of_flames, embrace_chaos, devils_due, potion_of_prolonged_power
0:31.345 default S incinerate Fluffy_Pillow 530013.2/1100000: 48% mana | 1.0/5: 20% soul_shard bloodlust, lord_of_flames, embrace_chaos, devils_due, potion_of_prolonged_power
0:32.648 default H immolate Fluffy_Pillow 488496.4/1100000: 44% mana | 1.0/5: 20% soul_shard bloodlust, lord_of_flames, embrace_chaos, devils_due, potion_of_prolonged_power
0:33.686 default K conflagrate Fluffy_Pillow 442000.2/1100000: 40% mana | 1.0/5: 20% soul_shard bloodlust, lord_of_flames, devils_due, potion_of_prolonged_power
0:34.726 default L conflagrate Fluffy_Pillow 461541.6/1100000: 42% mana | 2.0/5: 40% soul_shard bloodlust, lord_of_flames, conflagration_of_chaos, potion_of_prolonged_power
0:35.609 default R chaos_bolt Fluffy_Pillow 478133.0/1100000: 43% mana | 3.0/5: 60% soul_shard bloodlust, lord_of_flames, conflagration_of_chaos, potion_of_prolonged_power
0:37.370 default R chaos_bolt Fluffy_Pillow 511221.9/1100000: 46% mana | 4.0/5: 80% soul_shard bloodlust, lord_of_flames, conflagration_of_chaos, embrace_chaos, potion_of_prolonged_power
0:38.429 default L conflagrate Fluffy_Pillow 531120.3/1100000: 48% mana | 2.0/5: 40% soul_shard bloodlust, lord_of_flames, conflagration_of_chaos, embrace_chaos, potion_of_prolonged_power
0:39.311 default R chaos_bolt Fluffy_Pillow 547692.9/1100000: 50% mana | 3.0/5: 60% soul_shard bloodlust, lord_of_flames, embrace_chaos, potion_of_prolonged_power
0:40.370 default D havoc enemy2 567591.3/1100000: 52% mana | 1.0/5: 20% soul_shard bloodlust, lord_of_flames, embrace_chaos, potion_of_prolonged_power
0:41.252 default L conflagrate Fluffy_Pillow 494737.4/1100000: 45% mana | 1.0/5: 20% soul_shard lord_of_flames, embrace_chaos, potion_of_prolonged_power
0:42.398 default S incinerate Fluffy_Pillow 511301.3/1100000: 46% mana | 2.0/5: 40% soul_shard lord_of_flames, embrace_chaos, potion_of_prolonged_power
0:43.832 default R chaos_bolt Fluffy_Pillow 466027.9/1100000: 42% mana | 2.0/5: 40% soul_shard lord_of_flames, embrace_chaos, potion_of_prolonged_power
0:45.205 default L conflagrate Fluffy_Pillow 485872.9/1100000: 44% mana | 0.0/5: 0% soul_shard lord_of_flames, embrace_chaos, potion_of_prolonged_power
0:46.353 default Q dimensional_rift Fluffy_Pillow 502465.7/1100000: 46% mana | 1.0/5: 20% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, potion_of_prolonged_power
0:47.499 default S incinerate Fluffy_Pillow 519029.7/1100000: 47% mana | 1.0/5: 20% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, potion_of_prolonged_power
0:48.933 default S incinerate Fluffy_Pillow 473756.3/1100000: 43% mana | 1.0/5: 20% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, nefarious_pact, potion_of_prolonged_power
0:49.929 default S incinerate Fluffy_Pillow 422152.2/1100000: 38% mana | 1.0/5: 20% soul_shard lord_of_flames, conflagration_of_chaos, nefarious_pact, potion_of_prolonged_power
0:50.924 default S incinerate Fluffy_Pillow 370533.6/1100000: 34% mana | 1.0/5: 20% soul_shard lord_of_flames, conflagration_of_chaos, nefarious_pact, potion_of_prolonged_power
0:51.918 default R chaos_bolt Fluffy_Pillow 318900.6/1100000: 29% mana | 2.0/5: 40% soul_shard lord_of_flames, conflagration_of_chaos, nefarious_pact, potion_of_prolonged_power
0:53.504 default S incinerate Fluffy_Pillow 341824.2/1100000: 31% mana | 0.0/5: 0% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, nefarious_pact, potion_of_prolonged_power
0:54.500 default S incinerate Fluffy_Pillow 290220.1/1100000: 26% mana | 0.0/5: 0% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, nefarious_pact, potion_of_prolonged_power
0:55.495 default S incinerate Fluffy_Pillow 238601.5/1100000: 22% mana | 0.0/5: 0% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, nefarious_pact, potion_of_prolonged_power
0:56.491 default F immolate Fluffy_Pillow 186997.4/1100000: 17% mana | 1.0/5: 20% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, nefarious_pact, potion_of_prolonged_power
0:57.285 default R chaos_bolt Fluffy_Pillow 132473.6/1100000: 12% mana | 2.0/5: 40% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, nefarious_pact, potion_of_prolonged_power
0:58.236 default S incinerate Fluffy_Pillow 146219.1/1100000: 13% mana | 0.0/5: 0% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, nefarious_pact
0:59.231 default S incinerate Fluffy_Pillow 94600.6/1100000: 9% mana | 0.0/5: 0% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, nefarious_pact
1:00.226 default T life_tap Fluffy_Pillow 42982.0/1100000: 4% mana | 0.0/5: 0% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, devils_due
1:01.573 default D havoc enemy2 392451.1/1100000: 36% mana | 1.0/5: 20% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, devils_due
1:02.923 default H immolate Fluffy_Pillow 323963.6/1100000: 29% mana | 1.0/5: 20% soul_shard lord_of_flames, conflagration_of_chaos, devils_due
1:04.273 default K conflagrate Fluffy_Pillow 277476.2/1100000: 25% mana | 1.0/5: 20% soul_shard lord_of_flames, conflagration_of_chaos, devils_due
1:05.621 default L conflagrate Fluffy_Pillow 296959.7/1100000: 27% mana | 2.0/5: 40% soul_shard lord_of_flames, devils_due
1:06.970 default R chaos_bolt Fluffy_Pillow 316457.8/1100000: 29% mana | 4.0/5: 80% soul_shard lord_of_flames, devils_due
1:09.665 default L conflagrate Fluffy_Pillow 355410.5/1100000: 32% mana | 2.0/5: 40% soul_shard lord_of_flames, embrace_chaos
1:10.811 default R chaos_bolt Fluffy_Pillow 371974.5/1100000: 34% mana | 5.0/5: 100% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos
1:12.185 default R chaos_bolt Fluffy_Pillow 391833.9/1100000: 36% mana | 3.0/5: 60% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos
1:13.558 default L conflagrate Fluffy_Pillow 411678.8/1100000: 37% mana | 2.0/5: 40% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos
1:14.704 default R chaos_bolt Fluffy_Pillow 428242.8/1100000: 39% mana | 3.0/5: 60% soul_shard lord_of_flames, embrace_chaos
1:16.076 default C use_item_kiljaedens_burning_wish Fluffy_Pillow 448073.3/1100000: 41% mana | 2.0/5: 40% soul_shard lord_of_flames, embrace_chaos
1:16.076 default S incinerate Fluffy_Pillow 448073.3/1100000: 41% mana | 2.0/5: 40% soul_shard lord_of_flames, embrace_chaos
1:17.511 default S incinerate Fluffy_Pillow 402814.3/1100000: 37% mana | 2.0/5: 40% soul_shard lord_of_flames, embrace_chaos
1:18.945 default R chaos_bolt Fluffy_Pillow 357540.9/1100000: 33% mana | 3.0/5: 60% soul_shard lord_of_flames, embrace_chaos
1:20.320 default L conflagrate Fluffy_Pillow 377414.8/1100000: 34% mana | 1.0/5: 20% soul_shard lord_of_flames, embrace_chaos
1:21.466 default S incinerate Fluffy_Pillow 393978.7/1100000: 36% mana | 2.0/5: 40% soul_shard lord_of_flames, embrace_chaos
1:22.901 default D havoc enemy2 348719.8/1100000: 32% mana | 3.0/5: 60% soul_shard lord_of_flames, embrace_chaos
1:24.048 default R chaos_bolt Fluffy_Pillow 277298.2/1100000: 25% mana | 3.0/5: 60% soul_shard lord_of_flames, embrace_chaos
1:25.423 default F immolate Fluffy_Pillow 297172.0/1100000: 27% mana | 2.0/5: 40% soul_shard lord_of_flames, embrace_chaos, nefarious_pact
1:26.218 default S incinerate Fluffy_Pillow 242662.7/1100000: 22% mana | 2.0/5: 40% soul_shard lord_of_flames, embrace_chaos, nefarious_pact
1:27.214 default S incinerate Fluffy_Pillow 191058.6/1100000: 17% mana | 2.0/5: 40% soul_shard lord_of_flames, embrace_chaos, nefarious_pact
1:28.210 default S incinerate Fluffy_Pillow 139454.5/1100000: 13% mana | 2.0/5: 40% soul_shard lord_of_flames, embrace_chaos, nefarious_pact
1:29.206 default R chaos_bolt Fluffy_Pillow 87850.4/1100000: 8% mana | 2.0/5: 40% soul_shard lord_of_flames, embrace_chaos, nefarious_pact
1:30.159 default S incinerate Fluffy_Pillow 101624.8/1100000: 9% mana | 1.0/5: 20% soul_shard lord_of_flames, embrace_chaos, nefarious_pact
1:31.154 default Q dimensional_rift Fluffy_Pillow 50006.2/1100000: 5% mana | 1.0/5: 20% soul_shard lord_of_flames, embrace_chaos, nefarious_pact
1:31.947 default T life_tap Fluffy_Pillow 61468.0/1100000: 6% mana | 1.0/5: 20% soul_shard lord_of_flames, embrace_chaos, nefarious_pact
1:32.741 default S incinerate Fluffy_Pillow 402944.3/1100000: 37% mana | 1.0/5: 20% soul_shard lord_of_flames, embrace_chaos, nefarious_pact
1:33.738 default S incinerate Fluffy_Pillow 351354.6/1100000: 32% mana | 1.0/5: 20% soul_shard lord_of_flames, embrace_chaos, nefarious_pact
1:34.732 default R chaos_bolt Fluffy_Pillow 299721.6/1100000: 27% mana | 2.0/5: 40% soul_shard lord_of_flames, nefarious_pact
1:36.317 default S incinerate Fluffy_Pillow 322630.7/1100000: 29% mana | 0.0/5: 0% soul_shard lord_of_flames, embrace_chaos, nefarious_pact
1:37.313 default H immolate Fluffy_Pillow 271026.6/1100000: 25% mana | 0.0/5: 0% soul_shard lord_of_flames, embrace_chaos, devils_due
1:38.662 default K conflagrate Fluffy_Pillow 224524.7/1100000: 20% mana | 1.0/5: 20% soul_shard lord_of_flames, embrace_chaos, devils_due
1:40.012 default L conflagrate Fluffy_Pillow 244037.2/1100000: 22% mana | 2.0/5: 40% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, devils_due
1:41.361 default M service_imp Fluffy_Pillow 263535.2/1100000: 24% mana | 3.0/5: 60% soul_shard lord_of_flames, devils_due
1:42.710 default L conflagrate Fluffy_Pillow 283033.3/1100000: 26% mana | 2.0/5: 40% soul_shard lord_of_flames, devils_due
1:44.058 default D havoc enemy2 302516.9/1100000: 28% mana | 4.0/5: 80% soul_shard lord_of_flames, conflagration_of_chaos, devils_due
1:45.407 default R chaos_bolt Fluffy_Pillow 234014.9/1100000: 21% mana | 4.0/5: 80% soul_shard lord_of_flames, conflagration_of_chaos
1:47.694 default R chaos_bolt Fluffy_Pillow 267070.5/1100000: 24% mana | 3.0/5: 60% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos
1:49.067 default L conflagrate Fluffy_Pillow 286915.5/1100000: 26% mana | 1.0/5: 20% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos
1:50.214 default R chaos_bolt Fluffy_Pillow 303493.9/1100000: 28% mana | 3.0/5: 60% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos
1:51.589 default S incinerate Fluffy_Pillow 323367.7/1100000: 29% mana | 1.0/5: 20% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos
1:53.024 default R chaos_bolt Fluffy_Pillow 278108.8/1100000: 25% mana | 3.0/5: 60% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos
1:54.396 default L conflagrate Fluffy_Pillow 297939.3/1100000: 27% mana | 1.0/5: 20% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos
1:55.542 default S incinerate Fluffy_Pillow 314503.2/1100000: 29% mana | 2.0/5: 40% soul_shard lord_of_flames, embrace_chaos
1:56.977 default S incinerate Fluffy_Pillow 269244.3/1100000: 24% mana | 2.0/5: 40% soul_shard lord_of_flames, embrace_chaos
1:58.414 default R chaos_bolt Fluffy_Pillow 224014.3/1100000: 20% mana | 3.0/5: 60% soul_shard lord_of_flames
2:00.702 default F immolate Fluffy_Pillow 257084.4/1100000: 23% mana | 1.0/5: 20% soul_shard lord_of_flames, embrace_chaos
2:01.848 default S incinerate Fluffy_Pillow 207648.3/1100000: 19% mana | 1.0/5: 20% soul_shard lord_of_flames, embrace_chaos
2:03.280 default S incinerate Fluffy_Pillow 162346.0/1100000: 15% mana | 1.0/5: 20% soul_shard lord_of_flames, embrace_chaos
2:04.715 default D havoc enemy2 117087.1/1100000: 11% mana | 1.0/5: 20% soul_shard lord_of_flames
2:05.858 default T life_tap Fluffy_Pillow 45607.7/1100000: 4% mana | 1.0/5: 20% soul_shard lord_of_flames
2:07.004 default R chaos_bolt Fluffy_Pillow 392171.6/1100000: 36% mana | 2.0/5: 40% soul_shard lord_of_flames
2:09.290 default P soul_harvest Fluffy_Pillow 425212.8/1100000: 39% mana | 1.0/5: 20% soul_shard lord_of_flames, embrace_chaos
2:09.290 default J potion Fluffy_Pillow 425212.8/1100000: 39% mana | 1.0/5: 20% soul_shard soul_harvest, lord_of_flames, embrace_chaos
2:09.290 default S incinerate Fluffy_Pillow 425212.8/1100000: 39% mana | 1.0/5: 20% soul_shard soul_harvest, lord_of_flames, embrace_chaos, potion_of_deadly_grace
2:10.726 default S incinerate Fluffy_Pillow 379968.3/1100000: 35% mana | 1.0/5: 20% soul_shard soul_harvest, lord_of_flames, embrace_chaos, potion_of_deadly_grace
2:12.162 default H immolate Fluffy_Pillow 334723.8/1100000: 30% mana | 1.0/5: 20% soul_shard soul_harvest, lord_of_flames, embrace_chaos, potion_of_deadly_grace
2:13.308 default K conflagrate Fluffy_Pillow 285287.8/1100000: 26% mana | 1.0/5: 20% soul_shard soul_harvest, lord_of_flames, potion_of_deadly_grace
2:14.454 default R chaos_bolt Fluffy_Pillow 301851.7/1100000: 27% mana | 4.0/5: 80% soul_shard soul_harvest, lord_of_flames, potion_of_deadly_grace
2:16.741 default L conflagrate Fluffy_Pillow 334907.4/1100000: 30% mana | 2.0/5: 40% soul_shard soul_harvest, lord_of_flames, embrace_chaos, potion_of_deadly_grace
2:17.885 default Q dimensional_rift Fluffy_Pillow 351442.4/1100000: 32% mana | 4.0/5: 80% soul_shard soul_harvest, lord_of_flames, embrace_chaos, potion_of_deadly_grace
2:19.030 default R chaos_bolt Fluffy_Pillow 367991.9/1100000: 33% mana | 4.0/5: 80% soul_shard soul_harvest, lord_of_flames, embrace_chaos, potion_of_deadly_grace
2:20.404 default R chaos_bolt Fluffy_Pillow 387851.3/1100000: 35% mana | 3.0/5: 60% soul_shard soul_harvest, lord_of_flames, embrace_chaos, potion_of_deadly_grace
2:21.778 default L conflagrate Fluffy_Pillow 407710.7/1100000: 37% mana | 1.0/5: 20% soul_shard soul_harvest, lord_of_flames, embrace_chaos, potion_of_deadly_grace
2:22.923 default L conflagrate Fluffy_Pillow 424260.2/1100000: 39% mana | 2.0/5: 40% soul_shard soul_harvest, lord_of_flames, embrace_chaos, potion_of_deadly_grace
2:24.068 default R chaos_bolt Fluffy_Pillow 440809.7/1100000: 40% mana | 3.0/5: 60% soul_shard soul_harvest, lord_of_flames, conflagration_of_chaos, embrace_chaos, potion_of_deadly_grace
2:25.440 default D havoc enemy2 460640.2/1100000: 42% mana | 3.0/5: 60% soul_shard soul_harvest, lord_of_flames, conflagration_of_chaos, embrace_chaos, potion_of_deadly_grace
2:26.585 default R chaos_bolt Fluffy_Pillow 389189.7/1100000: 35% mana | 3.0/5: 60% soul_shard soul_harvest, lord_of_flames, conflagration_of_chaos, embrace_chaos, potion_of_deadly_grace
2:27.959 default L conflagrate Fluffy_Pillow 409049.0/1100000: 37% mana | 2.0/5: 40% soul_shard soul_harvest, lord_of_flames, conflagration_of_chaos, embrace_chaos, potion_of_deadly_grace
2:29.103 default R chaos_bolt Fluffy_Pillow 425584.1/1100000: 39% mana | 3.0/5: 60% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, potion_of_deadly_grace
2:30.476 default S incinerate Fluffy_Pillow 445429.0/1100000: 40% mana | 1.0/5: 20% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, potion_of_deadly_grace
2:31.911 default C use_item_kiljaedens_burning_wish Fluffy_Pillow 400170.1/1100000: 36% mana | 2.0/5: 40% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, potion_of_deadly_grace
2:31.911 default S incinerate Fluffy_Pillow 400170.1/1100000: 36% mana | 2.0/5: 40% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, potion_of_deadly_grace
2:33.347 default R chaos_bolt Fluffy_Pillow 354925.6/1100000: 32% mana | 2.0/5: 40% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, potion_of_deadly_grace
2:34.721 default F immolate Fluffy_Pillow 374785.0/1100000: 34% mana | 1.0/5: 20% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, potion_of_deadly_grace
2:35.866 default S incinerate Fluffy_Pillow 325334.5/1100000: 30% mana | 1.0/5: 20% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, potion_of_deadly_grace
2:37.300 default S incinerate Fluffy_Pillow 280061.1/1100000: 25% mana | 1.0/5: 20% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, potion_of_deadly_grace
2:38.736 default R chaos_bolt Fluffy_Pillow 234816.6/1100000: 21% mana | 2.0/5: 40% soul_shard lord_of_flames, conflagration_of_chaos, potion_of_deadly_grace
2:41.023 default S incinerate Fluffy_Pillow 267872.3/1100000: 24% mana | 1.0/5: 20% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos
2:42.458 default S incinerate Fluffy_Pillow 222613.3/1100000: 20% mana | 1.0/5: 20% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos
2:43.892 default R chaos_bolt Fluffy_Pillow 177340.0/1100000: 16% mana | 2.0/5: 40% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos
2:45.264 default S incinerate Fluffy_Pillow 197170.4/1100000: 18% mana | 0.0/5: 0% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos
2:46.699 default D havoc enemy2 151911.5/1100000: 14% mana | 1.0/5: 20% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos
2:47.845 default H immolate Fluffy_Pillow 80475.5/1100000: 7% mana | 1.0/5: 20% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos
2:48.990 default K conflagrate Fluffy_Pillow 31025.0/1100000: 3% mana | 1.0/5: 20% soul_shard lord_of_flames, embrace_chaos
2:50.135 default L conflagrate Fluffy_Pillow 47574.4/1100000: 4% mana | 2.0/5: 40% soul_shard lord_of_flames
2:51.278 default R chaos_bolt Fluffy_Pillow 64095.0/1100000: 6% mana | 3.0/5: 60% soul_shard lord_of_flames
2:53.565 default L conflagrate Fluffy_Pillow 97150.7/1100000: 9% mana | 1.0/5: 20% soul_shard lord_of_flames, embrace_chaos
2:54.711 default R chaos_bolt Fluffy_Pillow 113714.6/1100000: 10% mana | 4.0/5: 80% soul_shard lord_of_flames, embrace_chaos
2:56.084 default L conflagrate Fluffy_Pillow 133559.5/1100000: 12% mana | 2.0/5: 40% soul_shard lord_of_flames, embrace_chaos
2:57.229 default R chaos_bolt Fluffy_Pillow 150109.0/1100000: 14% mana | 3.0/5: 60% soul_shard lord_of_flames, embrace_chaos
2:58.602 default S incinerate Fluffy_Pillow 169954.0/1100000: 15% mana | 1.0/5: 20% soul_shard lord_of_flames, embrace_chaos
3:00.035 default S incinerate Fluffy_Pillow 124666.1/1100000: 11% mana | 2.0/5: 40% soul_shard lord_of_flames, embrace_chaos
3:01.470 default Q dimensional_rift Fluffy_Pillow 79407.2/1100000: 7% mana | 2.0/5: 40% soul_shard lord_of_flames, embrace_chaos
3:02.616 default L conflagrate Fluffy_Pillow 95971.2/1100000: 9% mana | 2.0/5: 40% soul_shard lord_of_flames
3:03.834 default I berserking Fluffy_Pillow 113575.8/1100000: 10% mana | 3.0/5: 60% soul_shard lord_of_flames, conflagration_of_chaos
3:03.834 default R chaos_bolt Fluffy_Pillow 113575.8/1100000: 10% mana | 3.0/5: 60% soul_shard berserking, lord_of_flames, conflagration_of_chaos
3:05.824 default R chaos_bolt Fluffy_Pillow 146653.1/1100000: 13% mana | 3.0/5: 60% soul_shard berserking, lord_of_flames, conflagration_of_chaos, embrace_chaos
3:07.020 default D havoc enemy2 166532.7/1100000: 15% mana | 2.0/5: 40% soul_shard berserking, lord_of_flames, conflagration_of_chaos, embrace_chaos
3:08.015 default R chaos_bolt Fluffy_Pillow 95071.4/1100000: 9% mana | 4.0/5: 80% soul_shard berserking, lord_of_flames, conflagration_of_chaos, embrace_chaos
3:09.210 default S incinerate Fluffy_Pillow 114934.4/1100000: 10% mana | 2.0/5: 40% soul_shard berserking, lord_of_flames, conflagration_of_chaos, embrace_chaos
3:10.458 default F immolate Fluffy_Pillow 69678.3/1100000: 6% mana | 2.0/5: 40% soul_shard berserking, lord_of_flames, conflagration_of_chaos, embrace_chaos
3:11.455 default M service_imp Fluffy_Pillow 20250.2/1100000: 2% mana | 2.0/5: 40% soul_shard berserking, lord_of_flames, conflagration_of_chaos, embrace_chaos
3:12.450 default T life_tap Fluffy_Pillow 36788.9/1100000: 3% mana | 1.0/5: 20% soul_shard berserking, lord_of_flames, conflagration_of_chaos, embrace_chaos
3:13.447 default S incinerate Fluffy_Pillow 383360.8/1100000: 35% mana | 1.0/5: 20% soul_shard berserking, lord_of_flames, conflagration_of_chaos
3:14.696 default S incinerate Fluffy_Pillow 336252.5/1100000: 31% mana | 1.0/5: 20% soul_shard lord_of_flames, conflagration_of_chaos
3:16.131 default S incinerate Fluffy_Pillow 290993.6/1100000: 26% mana | 1.0/5: 20% soul_shard lord_of_flames, conflagration_of_chaos
3:17.566 default Q dimensional_rift Fluffy_Pillow 245734.6/1100000: 22% mana | 2.0/5: 40% soul_shard lord_of_flames, conflagration_of_chaos
3:18.712 default H immolate Fluffy_Pillow 262298.6/1100000: 24% mana | 2.0/5: 40% soul_shard lord_of_flames, conflagration_of_chaos
3:19.859 default K conflagrate Fluffy_Pillow 212877.0/1100000: 19% mana | 2.0/5: 40% soul_shard lord_of_flames, conflagration_of_chaos
3:21.006 default R chaos_bolt Fluffy_Pillow 229455.4/1100000: 21% mana | 4.0/5: 80% soul_shard lord_of_flames, conflagration_of_chaos
3:23.292 default L conflagrate Fluffy_Pillow 262496.6/1100000: 24% mana | 2.0/5: 40% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos
3:24.438 default R chaos_bolt Fluffy_Pillow 279060.5/1100000: 25% mana | 3.0/5: 60% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos
3:25.812 default L conflagrate Fluffy_Pillow 298919.9/1100000: 27% mana | 1.0/5: 20% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos
3:26.958 default S incinerate Fluffy_Pillow 315483.8/1100000: 29% mana | 2.0/5: 40% soul_shard lord_of_flames, embrace_chaos
3:28.391 default D havoc enemy2 270196.0/1100000: 25% mana | 2.0/5: 40% soul_shard lord_of_flames, embrace_chaos
3:29.538 default Q dimensional_rift Fluffy_Pillow 198774.4/1100000: 18% mana | 3.0/5: 60% soul_shard lord_of_flames, embrace_chaos
3:30.684 default R chaos_bolt Fluffy_Pillow 215338.4/1100000: 20% mana | 3.0/5: 60% soul_shard lord_of_flames
3:32.972 default L conflagrate Fluffy_Pillow 248408.4/1100000: 23% mana | 2.0/5: 40% soul_shard lord_of_flames, embrace_chaos
3:34.117 default R chaos_bolt Fluffy_Pillow 264957.9/1100000: 24% mana | 4.0/5: 80% soul_shard lord_of_flames, embrace_chaos
3:35.489 default L conflagrate Fluffy_Pillow 284788.4/1100000: 26% mana | 2.0/5: 40% soul_shard lord_of_flames, embrace_chaos
3:36.636 default R chaos_bolt Fluffy_Pillow 301366.8/1100000: 27% mana | 3.0/5: 60% soul_shard lord_of_flames, embrace_chaos
3:38.009 default S incinerate Fluffy_Pillow 321211.8/1100000: 29% mana | 1.0/5: 20% soul_shard lord_of_flames, embrace_chaos
3:39.445 default S incinerate Fluffy_Pillow 275967.3/1100000: 25% mana | 1.0/5: 20% soul_shard lord_of_flames, embrace_chaos
3:40.879 default S incinerate Fluffy_Pillow 230693.9/1100000: 21% mana | 1.0/5: 20% soul_shard lord_of_flames, embrace_chaos
3:42.313 default F immolate Fluffy_Pillow 185420.5/1100000: 17% mana | 2.0/5: 40% soul_shard lord_of_flames
3:43.458 default R chaos_bolt Fluffy_Pillow 135970.0/1100000: 12% mana | 2.0/5: 40% soul_shard lord_of_flames
3:45.747 default S incinerate Fluffy_Pillow 169054.5/1100000: 15% mana | 1.0/5: 20% soul_shard lord_of_flames, embrace_chaos
3:47.181 default C use_item_kiljaedens_burning_wish Fluffy_Pillow 123781.2/1100000: 11% mana | 1.0/5: 20% soul_shard lord_of_flames, embrace_chaos
3:47.181 default Q dimensional_rift Fluffy_Pillow 123781.2/1100000: 11% mana | 1.0/5: 20% soul_shard lord_of_flames, embrace_chaos
3:48.325 default O summon_doomguard Fluffy_Pillow 140316.2/1100000: 13% mana | 1.0/5: 20% soul_shard lord_of_flames, embrace_chaos
3:49.471 default D havoc enemy2 156880.1/1100000: 14% mana | 0.0/5: 0% soul_shard lord_of_flames, embrace_chaos
3:50.617 default S incinerate Fluffy_Pillow 85444.1/1100000: 8% mana | 0.0/5: 0% soul_shard lord_of_flames
3:52.051 default T life_tap Fluffy_Pillow 40170.7/1100000: 4% mana | 0.0/5: 0% soul_shard lord_of_flames
3:53.198 default H immolate Fluffy_Pillow 386749.1/1100000: 35% mana | 0.0/5: 0% soul_shard lord_of_flames
3:54.343 default K conflagrate Fluffy_Pillow 337298.6/1100000: 31% mana | 0.0/5: 0% soul_shard lord_of_flames
3:55.489 default L conflagrate Fluffy_Pillow 353862.6/1100000: 32% mana | 2.0/5: 40% soul_shard lord_of_flames, conflagration_of_chaos
3:56.635 default R chaos_bolt Fluffy_Pillow 370426.5/1100000: 34% mana | 3.0/5: 60% soul_shard lord_of_flames, conflagration_of_chaos
3:58.920 default L conflagrate Fluffy_Pillow 403453.2/1100000: 37% mana | 1.0/5: 20% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos
4:00.066 default S incinerate Fluffy_Pillow 420017.2/1100000: 38% mana | 2.0/5: 40% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos
4:01.503 default S incinerate Fluffy_Pillow 374787.1/1100000: 34% mana | 2.0/5: 40% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos
4:02.938 default R chaos_bolt Fluffy_Pillow 329528.2/1100000: 30% mana | 3.0/5: 60% soul_shard lord_of_flames, conflagration_of_chaos
4:05.226 default R chaos_bolt Fluffy_Pillow 362598.3/1100000: 33% mana | 3.0/5: 60% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos
4:06.599 default R chaos_bolt Fluffy_Pillow 382443.2/1100000: 35% mana | 3.0/5: 60% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, nefarious_pact
4:07.552 default L conflagrate Fluffy_Pillow 396217.6/1100000: 36% mana | 1.0/5: 20% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, nefarious_pact
4:08.346 default S incinerate Fluffy_Pillow 407693.9/1100000: 37% mana | 2.0/5: 40% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, nefarious_pact
4:09.342 default L conflagrate Fluffy_Pillow 356089.8/1100000: 32% mana | 2.0/5: 40% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, nefarious_pact
4:10.137 default D havoc enemy2 367580.4/1100000: 33% mana | 3.0/5: 60% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, nefarious_pact
4:10.931 default P soul_harvest Fluffy_Pillow 291056.7/1100000: 26% mana | 3.0/5: 60% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, nefarious_pact
4:10.931 default R chaos_bolt Fluffy_Pillow 291056.7/1100000: 26% mana | 3.0/5: 60% soul_shard soul_harvest, lord_of_flames, conflagration_of_chaos, embrace_chaos, nefarious_pact
4:11.883 default S incinerate Fluffy_Pillow 304816.6/1100000: 28% mana | 1.0/5: 20% soul_shard soul_harvest, lord_of_flames, conflagration_of_chaos, embrace_chaos, nefarious_pact
4:12.877 default S incinerate Fluffy_Pillow 253183.6/1100000: 23% mana | 1.0/5: 20% soul_shard soul_harvest, lord_of_flames, conflagration_of_chaos, embrace_chaos, nefarious_pact
4:13.873 default S incinerate Fluffy_Pillow 201579.5/1100000: 18% mana | 1.0/5: 20% soul_shard soul_harvest, lord_of_flames, conflagration_of_chaos, embrace_chaos, nefarious_pact
4:14.869 default S incinerate Fluffy_Pillow 149975.4/1100000: 14% mana | 1.0/5: 20% soul_shard soul_harvest, lord_of_flames, conflagration_of_chaos, embrace_chaos, nefarious_pact
4:15.866 default S incinerate Fluffy_Pillow 98385.7/1100000: 9% mana | 1.0/5: 20% soul_shard soul_harvest, lord_of_flames, conflagration_of_chaos, embrace_chaos, nefarious_pact
4:16.862 default T life_tap Fluffy_Pillow 46781.6/1100000: 4% mana | 1.0/5: 20% soul_shard soul_harvest, lord_of_flames, conflagration_of_chaos, nefarious_pact
4:17.656 default F immolate Fluffy_Pillow 388257.9/1100000: 35% mana | 1.0/5: 20% soul_shard soul_harvest, lord_of_flames, conflagration_of_chaos, nefarious_pact
4:18.450 default S incinerate Fluffy_Pillow 333734.1/1100000: 30% mana | 1.0/5: 20% soul_shard soul_harvest, lord_of_flames, conflagration_of_chaos, devils_due
4:20.140 default S incinerate Fluffy_Pillow 292160.9/1100000: 27% mana | 1.0/5: 20% soul_shard soul_harvest, lord_of_flames, conflagration_of_chaos, devils_due
4:21.829 default S incinerate Fluffy_Pillow 250573.2/1100000: 23% mana | 1.0/5: 20% soul_shard soul_harvest, lord_of_flames, conflagration_of_chaos, devils_due
4:23.519 default S incinerate Fluffy_Pillow 209000.0/1100000: 19% mana | 1.0/5: 20% soul_shard soul_harvest, lord_of_flames, conflagration_of_chaos, devils_due
4:25.208 default S incinerate Fluffy_Pillow 167412.3/1100000: 15% mana | 1.0/5: 20% soul_shard soul_harvest, lord_of_flames, conflagration_of_chaos, devils_due
4:26.898 default R chaos_bolt Fluffy_Pillow 125839.0/1100000: 11% mana | 2.0/5: 40% soul_shard soul_harvest, lord_of_flames, conflagration_of_chaos
4:29.187 default H immolate Fluffy_Pillow 158923.6/1100000: 14% mana | 0.0/5: 0% soul_shard soul_harvest, lord_of_flames, conflagration_of_chaos, embrace_chaos
4:30.332 default D havoc enemy2 109473.1/1100000: 10% mana | 0.0/5: 0% soul_shard lord_of_flames, embrace_chaos
4:31.478 default K conflagrate Fluffy_Pillow 38037.0/1100000: 3% mana | 0.0/5: 0% soul_shard lord_of_flames, embrace_chaos
4:32.623 default K conflagrate Fluffy_Pillow 54586.5/1100000: 5% mana | 1.0/5: 20% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos
4:33.768 default K conflagrate Fluffy_Pillow 71136.0/1100000: 6% mana | 3.0/5: 60% soul_shard lord_of_flames
4:34.914 default Q dimensional_rift Fluffy_Pillow 87699.9/1100000: 8% mana | 4.0/5: 80% soul_shard lord_of_flames
4:36.058 default R chaos_bolt Fluffy_Pillow 104235.0/1100000: 9% mana | 5.0/5: 100% soul_shard lord_of_flames
4:38.346 default G immolate enemy2 137305.1/1100000: 12% mana | 3.0/5: 60% soul_shard lord_of_flames, embrace_chaos
4:39.491 default K conflagrate Fluffy_Pillow 87854.6/1100000: 8% mana | 3.0/5: 60% soul_shard lord_of_flames, embrace_chaos
4:40.637 default R chaos_bolt Fluffy_Pillow 104418.5/1100000: 9% mana | 5.0/5: 100% soul_shard lord_of_flames, embrace_chaos
4:42.013 default M service_imp Fluffy_Pillow 124306.8/1100000: 11% mana | 3.0/5: 60% soul_shard lord_of_flames, embrace_chaos
4:43.160 default R chaos_bolt Fluffy_Pillow 140885.2/1100000: 13% mana | 3.0/5: 60% soul_shard lord_of_flames, embrace_chaos
4:44.532 default R chaos_bolt Fluffy_Pillow 160715.7/1100000: 15% mana | 3.0/5: 60% soul_shard lord_of_flames, embrace_chaos
4:45.905 default K conflagrate Fluffy_Pillow 180560.6/1100000: 16% mana | 2.0/5: 40% soul_shard lord_of_flames, embrace_chaos
4:47.050 default R chaos_bolt Fluffy_Pillow 197110.1/1100000: 18% mana | 3.0/5: 60% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos
4:48.423 default S incinerate Fluffy_Pillow 216955.1/1100000: 20% mana | 1.0/5: 20% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos
4:49.857 default S incinerate Fluffy_Pillow 171681.7/1100000: 16% mana | 1.0/5: 20% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, nefarious_pact
4:50.854 default D havoc enemy2 120092.0/1100000: 11% mana | 1.0/5: 20% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, nefarious_pact
4:51.647 default T life_tap Fluffy_Pillow 43553.8/1100000: 4% mana | 1.0/5: 20% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, nefarious_pact
4:52.440 default F immolate Fluffy_Pillow 385015.6/1100000: 35% mana | 1.0/5: 20% soul_shard lord_of_flames, conflagration_of_chaos, nefarious_pact
4:53.235 default K conflagrate Fluffy_Pillow 330506.3/1100000: 30% mana | 2.0/5: 40% soul_shard lord_of_flames, conflagration_of_chaos, nefarious_pact
4:54.028 default R chaos_bolt Fluffy_Pillow 341968.1/1100000: 31% mana | 4.0/5: 80% soul_shard lord_of_flames, nefarious_pact
4:55.613 default S incinerate Fluffy_Pillow 364877.2/1100000: 33% mana | 2.0/5: 40% soul_shard lord_of_flames, embrace_chaos, nefarious_pact
4:56.609 default S incinerate Fluffy_Pillow 313273.1/1100000: 28% mana | 2.0/5: 40% soul_shard lord_of_flames, embrace_chaos, nefarious_pact

Stats

Raid-Buffed Unbuffed Gear Amount
Strength 4201 3876 0
Agility 7254 6929 0
Stamina 53591 53591 33365
Intellect 50752 49046 39387 (4272)
Spirit 1 1 0
Health 3215460 3215460 0
Mana 1100000 1100000 0
Soul Shard 5 5 0
Spell Power 50752 49046 0
Crit 15.08% 15.08% 4033
Haste 31.40% 30.40% 11399
Damage / Heal Versatility 5.96% 5.96% 2829
ManaReg per Second 14454 14344 0
Mastery 69.57% 69.57% 6074
Armor 1954 1954 1954
Run Speed 7 0 0

Gear

Source Slot Average Item Level: 906.00
Local Head Eyes of Azj'Aqir
ilevel: 900, stats: { 253 Armor, +3255 Sta, +2170 Int, +1074 Haste, +578 Vers }
Local Neck Radiant String of Scorpid Eyes
ilevel: 900, stats: { +1831 Sta, +2011 Haste, +922 Crit }, enchant: mark_of_the_hidden_satyr
Local Shoulders Pauldrons of Azj'Aqir
ilevel: 900, stats: { 233 Armor, +2442 Sta, +1628 Int, +752 Mastery, +487 Vers }
Local Chest Robes of Fluctuating Energy
ilevel: 900, stats: { 311 Armor, +3255 Sta, +2170 Int, +1145 Haste, +507 Mastery }
Local Waist Man'ari Skullbuckled Cinch
ilevel: 900, stats: { 175 Armor, +2442 Sta, +1628 Int, +699 Haste, +540 Mastery }
Local Legs Leggings of Azj'Aqir
ilevel: 900, stats: { 272 Armor, +3255 Sta, +2170 Int, +932 Crit, +720 Haste }
Local Feet Outcast Wanderer's Footrags
ilevel: 910, stats: { 222 Armor, +2680 Sta, +1786 Int, +864 Crit, +422 Mastery }
Local Wrists Woven Lasher Tendril Bracers
ilevel: 900, stats: { 136 Armor, +1831 Sta, +1221 Int, +644 Haste, +285 Vers }
Local Hands Clutch of Azj'Aqir
ilevel: 900, stats: { 194 Armor, +2442 Sta, +1628 Int, +859 Crit, +380 Mastery }
Local Finger1 Ring of the Scoured Clan
ilevel: 900, stats: { +1831 Sta, +2095 Mastery, +838 Haste }, enchant: { +200 Haste }
Local Finger2 Ring of Braided Stems
ilevel: 905, stats: { +1918 Sta, +1814 Haste, +1209 Vers }, enchant: { +200 Haste }
Local Trinket1 Whispers in the Dark
ilevel: 905, stats: { +2162 Int }
Local Trinket2 Kil'jaeden's Burning Wish
ilevel: 940, stats: { +2994 StrAgiInt, +456 Crit, +456 Mastery, +456 Haste }
Local Back Astromancer's Greatcloak
ilevel: 905, stats: { 158 Armor, +1918 Sta, +1278 StrAgiInt, +676 Haste, +270 Vers }, enchant: { +200 Int }
Local Main Hand Scepter of Sargeras
ilevel: 929, weapon: { 7005 - 10509, 3.6 }, stats: { +2843 Int, +4265 Sta, +922 Haste, +922 Mastery, +15509 Int }, relics: { +61 ilevels, +59 ilevels, +61 ilevels }

Talents

Level
15 Backdraft (Destruction Warlock) Roaring Blaze (Destruction Warlock) Shadowburn (Destruction Warlock)
30 Reverse Entropy (Destruction Warlock) Eradication (Destruction Warlock) Empowered Life Tap
45 Demonic Circle Mortal Coil Shadowfury
60 Cataclysm (Destruction Warlock) Fire and Brimstone (Destruction Warlock) Soul Harvest
75 Demon Skin Burning Rush Dark Pact
90 Grimoire of Supremacy Grimoire of Service Grimoire of Sacrifice
100 Wreak Havoc (Destruction Warlock) Channel Demonfire (Destruction Warlock) Soul Conduit

Profile

warlock="KJ_Trinket"
level=110
race=troll
role=spell
position=back
talents=2203021
artifact=38:0:0:0:0:803:1:804:3:805:3:806:3:807:3:808:3:809:3:810:3:811:3:812:3:813:1:814:1:815:1:816:1:817:1:818:1:1355:1:1392:1:1609:4:1610:1:1611:1:1713:1
spec=destruction

# This default action priority list is automatically created based on your character.
# It is a attempt to provide you with a action list that is both simple and practicable,
# while resulting in a meaningful and good simulation. It may not result in the absolutely highest possible dps.
# Feel free to edit, adapt and improve it to your own needs.
# SimulationCraft is always looking for updates and improvements to the default action lists.

# Executed before combat begins. Accepts non-harmful actions only.
actions.precombat=flask,type=whispered_pact
actions.precombat+=/food,type=azshari_salad
actions.precombat+=/summon_pet,if=!talent.grimoire_of_supremacy.enabled&(!talent.grimoire_of_sacrifice.enabled|buff.demonic_power.down)
actions.precombat+=/summon_infernal,if=talent.grimoire_of_supremacy.enabled&artifact.lord_of_flames.rank>0
actions.precombat+=/summon_infernal,if=talent.grimoire_of_supremacy.enabled&active_enemies>1
actions.precombat+=/summon_doomguard,if=talent.grimoire_of_supremacy.enabled&active_enemies=1&artifact.lord_of_flames.rank=0
actions.precombat+=/augmentation,type=defiled
actions.precombat+=/snapshot_stats
actions.precombat+=/grimoire_of_sacrifice,if=talent.grimoire_of_sacrifice.enabled
actions.precombat+=/life_tap,if=talent.empowered_life_tap.enabled&!buff.empowered_life_tap.remains
actions.precombat+=/potion,name=prolonged_power
actions.precombat+=/chaos_bolt

# Executed every time the actor is available.
actions=use_item,name=kiljaedens_burning_wish
actions+=/havoc,target=2,if=active_enemies>1&(active_enemies<4|talent.wreak_havoc.enabled&active_enemies<6)&!debuff.havoc.remains
actions+=/dimensional_rift,if=charges=3
actions+=/immolate,if=remains<=tick_time
actions+=/immolate,cycle_targets=1,if=active_enemies>1&remains<=tick_time&(!talent.roaring_blaze.enabled|(!debuff.roaring_blaze.remains&action.conflagrate.charges<2+set_bonus.tier19_4pc))
actions+=/immolate,if=talent.roaring_blaze.enabled&remains<=duration&!debuff.roaring_blaze.remains&target.time_to_die>10&(action.conflagrate.charges=2+set_bonus.tier19_4pc|(action.conflagrate.charges>=1+set_bonus.tier19_4pc&action.conflagrate.recharge_time<cast_time+gcd)|target.time_to_die<24)
actions+=/berserking
actions+=/blood_fury
actions+=/arcane_torrent
actions+=/potion,name=deadly_grace,if=(buff.soul_harvest.remains|trinket.proc.any.react|target.time_to_die<=45)
actions+=/shadowburn,if=buff.conflagration_of_chaos.remains<=action.chaos_bolt.cast_time
actions+=/shadowburn,if=(charges=1+set_bonus.tier19_4pc&recharge_time<action.chaos_bolt.cast_time|charges=2+set_bonus.tier19_4pc)&soul_shard<5
actions+=/conflagrate,if=talent.roaring_blaze.enabled&(charges=2+set_bonus.tier19_4pc|(charges>=1+set_bonus.tier19_4pc&recharge_time<gcd)|target.time_to_die<24)
actions+=/conflagrate,if=talent.roaring_blaze.enabled&debuff.roaring_blaze.stack>0&dot.immolate.remains>dot.immolate.duration*0.3&(active_enemies=1|soul_shard<3)&soul_shard<5
actions+=/conflagrate,if=!talent.roaring_blaze.enabled&buff.backdraft.stack<3&buff.conflagration_of_chaos.remains<=action.chaos_bolt.cast_time
actions+=/conflagrate,if=!talent.roaring_blaze.enabled&buff.backdraft.stack<3&(charges=1+set_bonus.tier19_4pc&recharge_time<action.chaos_bolt.cast_time|charges=2+set_bonus.tier19_4pc)&soul_shard<5
actions+=/life_tap,if=talent.empowered_life_tap.enabled&buff.empowered_life_tap.remains<=gcd
actions+=/dimensional_rift,if=equipped.144369&!buff.lessons_of_spacetime.remains&((!talent.grimoire_of_supremacy.enabled&!cooldown.summon_doomguard.remains)|(talent.grimoire_of_service.enabled&!cooldown.service_pet.remains)|(talent.soul_harvest.enabled&!cooldown.soul_harvest.remains))
actions+=/service_pet
actions+=/summon_infernal,if=artifact.lord_of_flames.rank>0&!buff.lord_of_flames.remains
actions+=/summon_doomguard,if=!talent.grimoire_of_supremacy.enabled&spell_targets.infernal_awakening<=2&(target.time_to_die>180|target.health.pct<=20|target.time_to_die<30)
actions+=/summon_infernal,if=!talent.grimoire_of_supremacy.enabled&spell_targets.infernal_awakening>2
actions+=/summon_doomguard,if=talent.grimoire_of_supremacy.enabled&spell_targets.summon_infernal=1&artifact.lord_of_flames.rank>0&buff.lord_of_flames.remains&!pet.doomguard.active
actions+=/summon_doomguard,if=talent.grimoire_of_supremacy.enabled&spell_targets.summon_infernal=1&equipped.132379&!cooldown.sindorei_spite_icd.remains
actions+=/summon_infernal,if=talent.grimoire_of_supremacy.enabled&spell_targets.summon_infernal>1&equipped.132379&!cooldown.sindorei_spite_icd.remains
actions+=/soul_harvest
actions+=/channel_demonfire,if=dot.immolate.remains>cast_time
actions+=/havoc,if=active_enemies=1&talent.wreak_havoc.enabled&equipped.132375&!debuff.havoc.remains
actions+=/rain_of_fire,if=active_enemies>=3&cooldown.havoc.remains<=12&!talent.wreak_havoc.enabled
actions+=/rain_of_fire,if=active_enemies>=6&talent.wreak_havoc.enabled
actions+=/dimensional_rift,if=!equipped.144369|charges>1|((!talent.grimoire_of_service.enabled|recharge_time<cooldown.service_pet.remains)&(!talent.soul_harvest.enabled|recharge_time<cooldown.soul_harvest.remains)&(!talent.grimoire_of_supremacy.enabled|recharge_time<cooldown.summon_doomguard.remains))
actions+=/life_tap,if=talent.empowered_life_tap.enabled&buff.empowered_life_tap.remains<duration*0.3
actions+=/cataclysm
actions+=/chaos_bolt,if=(cooldown.havoc.remains>12&cooldown.havoc.remains|active_enemies<3|talent.wreak_havoc.enabled&active_enemies<6)&(set_bonus.tier19_4pc=0|!talent.eradication.enabled|buff.embrace_chaos.remains<=cast_time|soul_shard>=3)
actions+=/shadowburn
actions+=/conflagrate,if=!talent.roaring_blaze.enabled&buff.backdraft.stack<3
actions+=/immolate,if=!talent.roaring_blaze.enabled&remains<=duration*0.3
actions+=/incinerate
actions+=/life_tap

head=eyes_of_azjaqir,id=138314,bonus_id=3445
neck=radiant_string_of_scorpid_eyes,id=140898,bonus_id=3445,enchant_id=5439
shoulders=pauldrons_of_azjaqir,id=138323,bonus_id=3445
back=astromancers_greatcloak,id=140909,bonus_id=3518,enchant_id=5436
chest=robes_of_fluctuating_energy,id=140848,bonus_id=3445
wrists=woven_lasher_tendril_bracers,id=140886,bonus_id=3445
hands=clutch_of_azjaqir,id=138311,bonus_id=3445
waist=manari_skullbuckled_cinch,id=140887,bonus_id=3445
legs=leggings_of_azjaqir,id=138317,bonus_id=3445
feet=outcast_wanderers_footrags,id=140914,bonus_id=3519
finger1=ring_of_the_scoured_clan,id=140897,bonus_id=3445,enchant=binding_of_haste
finger2=ring_of_braided_stems,id=140896,bonus_id=3518,enchant=binding_of_haste
trinket1=whispers_in_the_dark,id=140809,ilevel=905
trinket2=kiljaedens_burning_wish,id=144259,ilevel=940
main_hand=scepter_of_sargeras,id=128941,ilevel=929,gem_id=140826/140837/140826,relic_id=3519/3518:3518/3519

# Gear Summary
# gear_ilvl=906.27
# gear_stamina=33365
# gear_intellect=39387
# gear_crit_rating=4033
# gear_haste_rating=11399
# gear_mastery_rating=6074
# gear_versatility_rating=2829
# gear_armor=1954
# set_bonus=tier19_2pc=1
# set_bonus=tier19_4pc=1
default_pet=imp

Magistrike : 1398372 dps, 828395 dps to main target

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR
1398372.5 1398372.5 1235.3 / 0.088% 247614.8 / 17.7% 45.1
RPS Out RPS In Primary Resource Waiting APM Active Skill
25035.8 25035.8 Mana 0.00% 49.7 100.0% 100%
Talents
  • 15: Roaring Blaze (Destruction Warlock)
  • 30: Eradication (Destruction Warlock)
  • 60: Soul Harvest
  • 90: Grimoire of Service
  • 100: Wreak Havoc (Destruction Warlock)
  • Talent Calculator
Artifact

Charts

Abilities

Damage Stats DPS DPS% Execute Interval DPE DPET Type Count Hit Crit Avg Crit% Up%
Magistrike 1398372
Chaos Bolt 392242 (464219) 28.1% (33.3%) 60.2 4.84sec 2317166 1531538 Direct 115.0 0 1025828 1025828 100.0%  

Stats details: chaos_bolt

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 60.25 114.99 0.00 0.00 1.5130 0.0000 117956820.42 117956820.42 0.00 1531538.38 1531538.38
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
crit 114.99 100.00% 1025827.68 659299 1575825 1026066.60 960537 1105382 117956820 117956820 0.00
 
 

Action details: chaos_bolt

Static Values
  • id:116858
  • school:chromatic
  • resource:soul_shard
  • range:40.0
  • travel_speed:16.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:2.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:3.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:116858
  • name:Chaos Bolt
  • school:chromatic
  • tooltip:
  • description:Unleashes a devastating blast of chaos, causing {$s1=1} Chaos damage. Chaos Bolt always critically strikes and your critical strike chance increases its damage.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:4.000000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
    Chaos Bolt (_magistrike) 71977 5.2% 0.0 0.00sec 0 0 Direct 23.0 0 942467 942467 100.0%  

Stats details: chaos_bolt_magistrike

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 0.00 22.96 0.00 0.00 0.0000 0.0000 21641371.29 21641371.29 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
crit 22.96 100.00% 942467.47 603781 1443085 942723.89 805808 1093756 21641371 21641371 0.00
 
 

Action details: chaos_bolt_magistrike

Static Values
  • id:213229
  • school:chromatic
  • resource:none
  • range:50000.0
  • travel_speed:16.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:213229
  • name:Chaos Bolt
  • school:chromatic
  • tooltip:Deals Shadow damage every $t2 sec.
  • description:{$@spelldesc213014=Chaos Bolt has a {$h=20}% chance to strike an additional enemy within {$s2=30} yards.}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:3.663000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
Conflagrate 164721 11.8% 48.0 6.26sec 1031020 985068 Direct 95.4 304709 692443 518328 55.1%  

Stats details: conflagrate

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 47.98 95.43 0.00 0.00 1.0467 0.0000 49464227.91 49464227.91 0.00 985068.47 985068.47
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 42.86 44.91% 304708.54 198193 473705 304874.19 271087 340180 13058521 13058521 0.00
crit 52.58 55.09% 692442.54 396397 1095942 692717.45 624198 765003 36405706 36405706 0.00
 
 

Action details: conflagrate

Static Values
  • id:17962
  • school:fire
  • resource:chi
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:9.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:talent.roaring_blaze.enabled&(charges=2+set_bonus.tier19_4pc|(charges>=1+set_bonus.tier19_4pc&recharge_time<gcd)|target.time_to_die<24)
Spelldata
  • id:17962
  • name:Conflagrate
  • school:fire
  • tooltip:
  • description:Triggers an explosion on the target, dealing {$s1=1} Fire damage.{$?s196406=false}[ Reduces the cast time of Incinerate and Chaos Bolt by {$117828s1=30}% for {$117828d=10 seconds}.][] |cFFFFFFFFGenerates 1 Soul Shard.|r
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:2.265510
  • base_dd_min:1.00
  • base_dd_max:1.00
 
Cry Havoc 40189 2.9% 51.8 5.57sec 233516 0 Direct 103.5 100955 201809 116757 15.7%  

Stats details: cry_havoc

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 51.76 103.52 0.00 0.00 0.0000 0.0000 12086726.84 12086726.84 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 87.30 84.33% 100955.09 71370 152311 101001.30 94632 109650 8813305 8813305 0.00
crit 16.22 15.67% 201808.83 142741 304617 201903.47 160750 240312 3273421 3273421 0.00
 
 

Action details: cry_havoc

Static Values
  • id:243011
  • school:chromatic
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:243011
  • name:Cry Havoc
  • school:chromatic
  • tooltip:
  • description:Deals {$s2=0} Chaos damage to enemies within $A2 yards.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:1.000000
  • base_dd_min:0.00
  • base_dd_max:0.00
 
Deadly Grace 6065 0.4% 14.3 2.08sec 125512 0 Direct 14.3 108686 217342 125512 15.5%  

Stats details: deadly_grace

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 14.27 14.27 0.00 0.00 0.0000 0.0000 1791249.98 1791249.98 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 12.06 84.51% 108685.52 96342 115611 108698.07 100196 115611 1310897 1310897 0.00
crit 2.21 15.49% 217342.40 192685 231222 197199.25 0 231222 480353 480353 0.00
 
 

Action details: deadly_grace

Static Values
  • id:188091
  • school:arcane
  • resource:none
  • range:40.0
  • travel_speed:25.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:188091
  • name:Deadly Grace
  • school:arcane
  • tooltip:
  • description:Deal {$s1=63339 to 95008} Arcane damage.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:63338.72
  • base_dd_max:95008.08
 
Immolate 301974 21.6% 19.8 15.35sec 4571605 4308511 Direct 38.4 159295 318579 260752 63.7%  
Periodic 290.7 169538 339306 277526 63.6% 195.9%

Stats details: immolate

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 19.84 38.40 290.72 290.72 1.0611 2.0286 90694159.61 90694159.61 0.00 148482.03 4308511.15
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 13.94 36.30% 159295.21 104169 248967 159281.64 129424 201632 2220821 2220821 0.00
crit 24.46 63.70% 318578.86 208334 497952 318595.03 280171 362038 7792662 7792662 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 105.8 36.39% 169538.42 46 494655 169841.37 140533 207618 17936100 17936100 0.00
crit 184.9 63.61% 339306.16 102 989325 339833.56 289880 389210 62744577 62744577 0.00
 
 

Action details: immolate

Static Values
  • id:348
  • school:fire
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:66000.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:1.50
  • base_crit:0.48
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:remains<=tick_time
Spelldata
  • id:348
  • name:Immolate
  • school:fire
  • tooltip:
  • description:Burns the enemy, causing {$s1=1} Fire damage immediately and an additional $157736o1 Fire damage over {$157736d=18 seconds}. |cFFFFFFFFPeriodic damage has a {$193541s1=15}% chance to generate 1 Soul Shard. Chance doubled on critical strikes.|r
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:1.332000
  • base_dd_min:1.00
  • base_dd_max:1.00
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.721500
  • base_td:0.00
  • dot_duration:18.00
  • base_tick_time:3.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
 
Incinerate 144779 10.4% 74.5 3.86sec 584651 452546 Direct 142.6 264177 528564 305465 15.6%  

Stats details: incinerate

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 74.50 142.59 0.00 0.00 1.2919 0.0000 43555712.53 43555712.53 0.00 452545.69 452545.69
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 120.32 84.38% 264177.16 168387 402471 264243.69 248280 281838 31786790 31786790 0.00
crit 22.27 15.62% 528564.13 336781 804915 528629.23 437416 612646 11768923 11768923 0.00
 
 

Action details: incinerate

Static Values
  • id:29722
  • school:fire
  • resource:mana
  • range:40.0
  • travel_speed:20.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:66000.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:1.88
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:29722
  • name:Incinerate
  • school:fire
  • tooltip:
  • description:Draws fire toward the enemy, dealing {$s2=0} Fire damage.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:2.331000
  • base_dd_min:0.00
  • base_dd_max:0.00
 
Mark of the Hidden Satyr 10175 0.7% 19.8 15.21sec 154657 0 Direct 19.8 133746 267504 154660 15.6%  

Stats details: mark_of_the_hidden_satyr

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 19.78 19.78 0.00 0.00 0.0000 0.0000 3058964.98 3058964.98 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 16.69 84.37% 133745.87 127447 160909 133787.43 127447 146368 2231801 2231801 0.00
crit 3.09 15.63% 267504.33 254894 321818 255069.21 0 321818 827164 827164 0.00
 
 

Action details: mark_of_the_hidden_satyr

Static Values
  • id:191259
  • school:fire
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:191259
  • name:Mark of the Hidden Satyr
  • school:fire
  • tooltip:
  • description:Deals fire damage.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:2.500000
  • spell_power_mod.direct:2.000000
  • base_dd_min:0.00
  • base_dd_max:0.00
 
pet - imp 48505 / 48505
Firebolt 48505 3.5% 107.8 2.79sec 135181 110111 Direct 107.0 117695 235383 136225 15.7%  

Stats details: firebolt

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 107.82 106.99 0.00 0.00 1.2277 0.0000 14574908.96 14574908.96 0.00 110110.67 110110.67
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 90.15 84.26% 117694.77 75195 142407 117726.44 115331 120517 10609814 10609814 0.00
crit 16.85 15.74% 235382.51 150390 284814 235440.18 208641 260546 3965095 3965095 0.00
 
 

Action details: firebolt

Static Values
  • id:3110
  • school:fire
  • resource:energy
  • range:40.0
  • travel_speed:16.0000
  • trigger_gcd:0.5000
  • min_gcd:0.7500
  • base_cost:40.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:1.75
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:3110
  • name:Firebolt
  • school:fire
  • tooltip:
  • description:Deals {$s1=1} Fire damage to a target.$?a231795[ Damage increased by {$231795s1=50}% if you have Immolated the target.][] |cFF777777(Right-Click to toggle)|r
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:1.000000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
pet - service_imp 140469 / 44938
Firebolt 140469 3.2% 48.7 5.57sec 276188 240350 Direct 48.5 240030 480128 277765 15.7%  

Stats details: firebolt

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 48.75 48.47 0.00 0.00 1.1491 0.0000 13462991.36 13462991.36 0.00 240350.47 240350.47
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 40.85 84.29% 240030.47 150390 284814 240260.93 230597 250534 9805921 9805921 0.00
crit 7.62 15.71% 480127.71 300781 569629 480434.53 0 569629 3657070 3657070 0.00
 
 

Action details: firebolt

Static Values
  • id:3110
  • school:fire
  • resource:energy
  • range:40.0
  • travel_speed:16.0000
  • trigger_gcd:0.5000
  • min_gcd:0.7500
  • base_cost:40.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:1.75
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:3110
  • name:Firebolt
  • school:fire
  • tooltip:
  • description:Deals {$s1=1} Fire damage to a target.$?a231795[ Damage increased by {$231795s1=50}% if you have Immolated the target.][] |cFF777777(Right-Click to toggle)|r
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:1.000000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
pet - infernal 133232 / 11281
Immolation 103754 0.6% 1.0 0.00sec 2593964 0 Periodic 46.2 48459 96914 56100 15.8% 8.1%

Stats details: immolation

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 23.12 46.24 0.0000 1.0583 2593964.46 2593964.46 0.00 106018.90 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 38.9 84.23% 48458.55 41903 50284 48458.93 47105 49776 1887362 1887362 0.00
crit 7.3 15.77% 96913.67 83807 100568 96892.38 0 100568 706602 706602 0.00
 
 

Action details: immolation

Static Values
  • id:19483
  • school:fire
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:!ticking
Spelldata
  • id:19483
  • name:Immolation
  • school:fire
  • tooltip:Burns nearby enemies for {$20153s1=0} fire damage every $t1 seconds.
  • description:Burns nearby enemies for {$20153s1=0} fire damage every $t1 seconds.
 

Action details: immolation_tick

Static Values
  • id:20153
  • school:fire
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:20153
  • name:Immolation
  • school:fire
  • tooltip:
  • description:Deals Fire damage to all enemies near the caster.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.650000
  • base_dd_min:0.00
  • base_dd_max:0.00
 
melee 29478 0.2% 22.0 1.12sec 33498 30117 Direct 22.0 28995 57951 33498 15.6%  

Stats details: melee

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 22.00 22.00 0.00 0.00 1.1123 0.0000 736973.80 1083421.30 31.98 30117.44 30117.44
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 18.58 84.45% 28994.88 25058 30070 28995.08 28142 30070 538709 791954 31.98
crit 3.42 15.55% 57950.82 50117 60140 56570.30 0 60140 198265 291468 31.21
 
 

Action details: melee

Static Values
  • id:0
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Weapon
  • normalized:false
  • weapon_power_mod:0.285714
  • weapon_multiplier:1.00
 
pet - doomguard 107723 / 9118
Doom Bolt 107723 0.6% 10.7 2.21sec 251342 115775 Direct 10.7 217530 435368 251352 15.5%  

Stats details: doom_bolt

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 10.72 10.71 0.00 0.00 2.1710 0.0000 2693152.07 2693152.07 0.00 115774.74 115774.74
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 9.05 84.47% 217529.85 210289 252347 217567.20 210289 252347 1968811 1968811 0.00
crit 1.66 15.53% 435367.71 420578 504693 366813.31 0 504693 724341 724341 0.00
 
 

Action details: doom_bolt

Static Values
  • id:85692
  • school:shadow
  • resource:energy
  • range:30.0
  • travel_speed:20.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:35.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:3.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:85692
  • name:Doom Bolt
  • school:shadow
  • tooltip:
  • description:Sends a shadowy bolt at the enemy, causing {$s1=1} Shadow damage. Deals {$s2=20}% additional damage to targets below 20% health.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:2.750000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
pet - lord_of_flames_infernal 133173 / 11276
Immolation 103664 0.6% 1.0 0.00sec 2591712 0 Periodic 46.2 48458 96921 56050 15.7% 8.1%

Stats details: immolation

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 23.12 46.24 0.0000 1.0583 2591711.51 2591711.51 0.00 105926.82 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 39.0 84.33% 48457.83 41903 50284 48458.10 47196 49725 1889615 1889615 0.00
crit 7.2 15.67% 96921.35 83807 100568 96869.19 0 100568 702096 702096 0.00
 
 

Action details: immolation

Static Values
  • id:19483
  • school:fire
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:!ticking
Spelldata
  • id:19483
  • name:Immolation
  • school:fire
  • tooltip:Burns nearby enemies for {$20153s1=0} fire damage every $t1 seconds.
  • description:Burns nearby enemies for {$20153s1=0} fire damage every $t1 seconds.
 

Action details: immolation_tick

Static Values
  • id:20153
  • school:fire
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:20153
  • name:Immolation
  • school:fire
  • tooltip:
  • description:Deals Fire damage to all enemies near the caster.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.650000
  • base_dd_min:0.00
  • base_dd_max:0.00
 
melee 29509 0.2% 22.0 1.12sec 33533 30149 Direct 22.0 28993 57967 33534 15.7%  

Stats details: melee

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 22.00 22.00 0.00 0.00 1.1123 0.0000 737747.68 1084558.98 31.98 30149.07 30149.07
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 18.55 84.33% 28993.41 25058 30070 28993.74 28142 30070 537935 790816 31.98
crit 3.45 15.67% 57966.96 50117 60140 56654.92 0 60140 199812 293743 31.25
 
 

Action details: melee

Static Values
  • id:0
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Weapon
  • normalized:false
  • weapon_power_mod:0.285714
  • weapon_multiplier:1.00
 
pet - lord_of_flames_infernal 133276 / 11285
Immolation 103773 0.6% 1.0 0.00sec 2594428 0 Periodic 46.2 48458 96915 56109 15.8% 8.1%

Stats details: immolation

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 23.12 46.24 0.0000 1.0583 2594427.96 2594427.96 0.00 106037.85 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 38.9 84.21% 48458.42 41903 50284 48459.07 47218 49725 1886899 1886899 0.00
crit 7.3 15.79% 96915.04 83807 100568 96845.72 0 100568 707529 707529 0.00
 
 

Action details: immolation

Static Values
  • id:19483
  • school:fire
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:!ticking
Spelldata
  • id:19483
  • name:Immolation
  • school:fire
  • tooltip:Burns nearby enemies for {$20153s1=0} fire damage every $t1 seconds.
  • description:Burns nearby enemies for {$20153s1=0} fire damage every $t1 seconds.
 

Action details: immolation_tick

Static Values
  • id:20153
  • school:fire
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:20153
  • name:Immolation
  • school:fire
  • tooltip:
  • description:Deals Fire damage to all enemies near the caster.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.650000
  • base_dd_min:0.00
  • base_dd_max:0.00
 
melee 29503 0.2% 22.0 1.12sec 33527 30143 Direct 22.0 28995 57949 33527 15.7%  

Stats details: melee

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 22.00 22.00 0.00 0.00 1.1123 0.0000 737608.35 1084354.14 31.98 30143.37 30143.37
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 18.56 84.35% 28995.04 25058 30070 28995.00 28142 30070 538075 791021 31.98
crit 3.44 15.65% 57949.38 50117 60140 56501.03 0 60140 199534 293333 31.17
 
 

Action details: melee

Static Values
  • id:0
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Weapon
  • normalized:false
  • weapon_power_mod:0.285714
  • weapon_multiplier:1.00
 
pet - lord_of_flames_infernal 133235 / 11282
Immolation 103673 0.6% 1.0 0.00sec 2591932 0 Periodic 46.2 48459 96909 56055 15.7% 8.1%

Stats details: immolation

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 23.12 46.24 0.0000 1.0583 2591931.94 2591931.94 0.00 105935.83 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 39.0 84.32% 48458.99 41903 50284 48459.54 47218 49894 1889395 1889395 0.00
crit 7.2 15.68% 96908.91 83807 100568 96904.21 83807 100568 702537 702537 0.00
 
 

Action details: immolation

Static Values
  • id:19483
  • school:fire
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:!ticking
Spelldata
  • id:19483
  • name:Immolation
  • school:fire
  • tooltip:Burns nearby enemies for {$20153s1=0} fire damage every $t1 seconds.
  • description:Burns nearby enemies for {$20153s1=0} fire damage every $t1 seconds.
 

Action details: immolation_tick

Static Values
  • id:20153
  • school:fire
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:20153
  • name:Immolation
  • school:fire
  • tooltip:
  • description:Deals Fire damage to all enemies near the caster.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.650000
  • base_dd_min:0.00
  • base_dd_max:0.00
 
melee 29562 0.2% 22.0 1.12sec 33593 30203 Direct 22.0 28990 58008 33593 15.9%  

Stats details: melee

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 22.00 22.00 0.00 0.00 1.1123 0.0000 739074.91 1086510.12 31.98 30203.31 30203.31
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 18.51 84.14% 28989.56 25058 30070 28989.59 28142 30070 536608 788865 31.98
crit 3.49 15.86% 58008.03 50117 60140 56748.17 0 60140 202467 297645 31.28
 
 

Action details: melee

Static Values
  • id:0
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Weapon
  • normalized:false
  • weapon_power_mod:0.285714
  • weapon_multiplier:1.00
 
pet - shadowy_tear 134065 / 18017
Shadow Bolt 134065 1.3% 3.3 70.55sec 1621920 0 Periodic 36.6 127331 254411 147240 15.7% 15.1%

Stats details: shadow_bolt

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 3.33 0.00 36.83 36.63 0.0000 1.2310 5392958.05 5392958.05 0.00 118960.56 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 30.9 84.34% 127330.68 67 154722 126710.56 0 154722 3933211 3933211 0.00
crit 5.7 15.66% 254410.72 162 309443 246799.89 0 309443 1459747 1459747 0.00
 
 

Action details: shadow_bolt

Static Values
  • id:196657
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:20.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:196657
  • name:Shadow Bolt
  • school:shadow
  • tooltip:
  • description:Sends a shadowy bolt at the enemy, causing {$s1=1} Shadow damage.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • dot_duration:14.00
  • base_tick_time:2.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
 
pet - flame_rift 284984 / 79409
Searing Bolt 284984 5.7% 65.5 2.67sec 362416 1103040 Direct 65.2 66123 0 66123 0.0%  
Periodic 139.0 120989 241802 139928 15.7% 45.7%

Stats details: searing_bolt

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 65.54 65.16 138.96 138.96 0.3286 0.9896 23752854.86 23752854.86 0.00 149337.37 1103039.61
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 65.16 100.00% 66123.26 61274 77362 66094.16 0 77362 4308293 4308293 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 117.2 84.32% 120989.28 123 154749 120178.27 0 137907 14176933 14176933 0.00
crit 21.8 15.68% 241802.48 294 309499 239847.86 0 299182 5267629 5267629 0.00
 
 

Action details: searing_bolt

Static Values
  • id:243050
  • school:fire
  • resource:energy
  • range:100.0
  • travel_speed:20.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:1.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:243050
  • name:Searing Bolt
  • school:fire
  • tooltip:Burning for $w2 Fire damage every $t2 sec.
  • description:Sends a searing bolt at the enemy, causing {$s1=1} Fire damage, and an additional $o2 Fire damage over {$d=30 seconds}, stacking up to {$u=20} times.
Direct Damage
  • may_crit:false
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:1.000000
  • base_dd_min:1.00
  • base_dd_max:1.00
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.100000
  • base_td:1.00
  • dot_duration:30.00
  • base_tick_time:1.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
 
pet - chaos_tear 158125 / 8341
Chaos Bolt 158125 0.6% 3.3 70.90sec 759563 379563 Direct 3.3 0 764252 764252 100.0%  

Stats details: chaos_bolt

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 3.29 3.27 0.00 0.00 2.0012 0.0000 2501698.00 2501698.00 0.00 379562.74 379562.74
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
crit 3.27 100.00% 764251.67 708788 894886 764456.03 0 894886 2501698 2501698 0.00
 
 

Action details: chaos_bolt

Static Values
  • id:215279
  • school:chromatic
  • resource:none
  • range:100.0
  • travel_speed:16.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:5.500
  • base_execute_time:3.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:215279
  • name:Chaos Bolt
  • school:chromatic
  • tooltip:
  • description:Unleashes a devastating blast of chaos, causing {$s1=1} Chaos damage. Chaos Bolt always critically strikes and your critical strike chance increases its damage.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:5.000000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
pet - chaos_portal 281152 / 16207
Chaos Barrage 281152 1.2% 3.3 70.41sec 1462718 0 Periodic 115.3 36357 72727 42042 15.6% 6.0%

Stats details: chaos_barrage

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 3.31 0.00 115.80 115.33 0.0000 0.1557 4848810.92 4848810.92 0.00 268915.25 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 97.3 84.37% 36356.52 147 42550 36205.99 0 42550 3537640 3537640 0.00
crit 18.0 15.63% 72727.06 294 85099 72348.61 0 85099 1311171 1311171 0.00
 
 

Action details: chaos_barrage

Static Values
  • id:187394
  • school:magic
  • resource:none
  • range:100.0
  • travel_speed:24.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:187394
  • name:Chaos Barrage
  • school:magic
  • tooltip:
  • description:Deals {$s1=1} Chaos damage.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • dot_duration:5.50
  • base_tick_time:0.25
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
 
Simple Action Stats Execute Interval
Magistrike
augmentation 1.0 0.00sec

Stats details: augmentation

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: augmentation

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Magistrike
  • harmful:false
  • if_expr:
 
Berserking 2.1 180.57sec

Stats details: berserking

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.06 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: berserking

Static Values
  • id:26297
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:180.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:26297
  • name:Berserking
  • school:physical
  • tooltip:Haste increased by {$s1=15}%.
  • description:Increases your haste by {$s1=15}% for {$d=10 seconds}.
 
Dimensional Rift 12.9 23.78sec

Stats details: dimensional_rift

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 12.87 0.00 0.00 0.00 1.0171 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: dimensional_rift

Static Values
  • id:196586
  • school:none
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:45.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:charges=3
Spelldata
  • id:196586
  • name:Dimensional Rift
  • school:chaos
  • tooltip:
  • description:Rips a hole in time and space, opening a portal that damages your target.
 
flask 1.0 0.00sec

Stats details: flask

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: flask

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Magistrike
  • harmful:false
  • if_expr:
 
food 1.0 0.00sec

Stats details: food

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: food

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Magistrike
  • harmful:false
  • if_expr:
 
Havoc 14.9 20.93sec

Stats details: havoc

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 14.88 0.00 0.00 0.00 1.0782 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: havoc

Static Values
  • id:80240
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:88000.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:active_enemies>1&(active_enemies<4|talent.wreak_havoc.enabled&active_enemies<6)&!debuff.havoc.remains
Spelldata
  • id:80240
  • name:Havoc
  • school:shadow
  • tooltip:Spells cast by the Warlock also hit this target.
  • description:Marks a target with Havoc for {$d=8 seconds}, causing your single target spells to also strike the Havoc victim. Limit 1.
 
Life Tap 6.5 33.99sec

Stats details: life_tap

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 6.54 0.00 0.00 0.00 1.0512 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: life_tap

Static Values
  • id:1454
  • school:shadow
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:talent.empowered_life_tap.enabled&!buff.empowered_life_tap.remains
Spelldata
  • id:1454
  • name:Life Tap
  • school:shadow
  • tooltip:
  • description:Restores {$s1=30}% of your maximum mana, at the cost of {$s2=10}% of your maximum health.
 
potion 2.0 0.00sec

Stats details: potion

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: potion

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:60.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
 
Grimoire: Imp (service_imp) 3.7 91.43sec

Stats details: service_imp

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 3.69 0.00 0.00 0.00 0.9790 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: service_imp

Static Values
  • id:111859
  • school:shadow
  • resource:soul_shard
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:1.0
  • secondary_cost:0.0
  • cooldown:90.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:111859
  • name:Grimoire: Imp
  • school:shadow
  • tooltip:
  • description:Summons an Imp who attacks the target for {$108501s1=25} sec. Imps cast ranged Firebolts and cleanse a hostile magic effect from their master.
 
Soul Harvest 2.9 120.93sec

Stats details: soul_harvest

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.90 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: soul_harvest

Static Values
  • id:196098
  • school:shadow
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:120.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:196098
  • name:Soul Harvest
  • school:shadow
  • tooltip:Damage increased by {$s1=20}%.
  • description:Increases your damage and your pets' damage by {$s1=20}%. Lasts {$d=15 seconds}, increased by {$s2=2} sec for each target afflicted by your {$?s137043=false}[Agony][]{$?s137044=false}[Doom][]{$?s137046=false}[Immolate][], up to a maximum of {$s3=35} sec.
 
Summon Doomguard 1.0 0.00sec

Stats details: summon_doomguard

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 1.0884 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: summon_doomguard

Static Values
  • id:18540
  • school:shadow
  • resource:soul_shard
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:1.0
  • secondary_cost:0.0
  • cooldown:180.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:talent.grimoire_of_supremacy.enabled&active_enemies=1&artifact.lord_of_flames.rank=0
Spelldata
  • id:18540
  • name:Summon Doomguard
  • school:shadow
  • tooltip:
  • description:Summons a Doomguard for {$60478d=25 seconds} to assault the target with its Doom Bolts.
 
Summon Imp 1.0 0.00sec

Stats details: summon_imp

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: summon_imp

Static Values
  • id:688
  • school:shadow
  • resource:soul_shard
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:1.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:2.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:!talent.grimoire_of_supremacy.enabled&(!talent.grimoire_of_sacrifice.enabled|buff.demonic_power.down)
Spelldata
  • id:688
  • name:Summon Imp
  • school:shadow
  • tooltip:
  • description:Summons an Imp under your command that casts ranged Firebolts.$?s74434[ |cFFFFFFFFSoulburn:|r |cFF8282FFInstant cast.|r][]
 
Summon Infernal 1.0 0.00sec

Stats details: summon_infernal

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.7614 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: summon_infernal

Static Values
  • id:1122
  • school:shadow
  • resource:soul_shard
  • range:30.0
  • travel_speed:1.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:1.0
  • secondary_cost:0.0
  • cooldown:180.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:talent.grimoire_of_supremacy.enabled&artifact.lord_of_flames.rank>0
Spelldata
  • id:1122
  • name:Summon Infernal
  • school:shadow
  • tooltip:
  • description:Summons an Infernal from the Twisting Nether, impacting for {$22703s1=0} Fire damage and stunning all enemy targets in the area for {$22703d=2 seconds}. The Infernal will serve you for {$111685d=25 seconds}, dealing strong area-of-effect damage.
 

Buffs

Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit Overflow Expiry
Accelerando 20.1 0.0 15.4sec 15.4sec 78.44% 78.44% 1.5(1.5) 19.3

Buff details

  • buff initial source:Magistrike
  • cooldown name:buff_accelerando
  • max_stacks:5
  • duration:12.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00

Stat Buff details

  • stat:haste_rating
  • amount:734.41

Stack Uptimes

  • accelerando_1:29.68%
  • accelerando_2:24.56%
  • accelerando_3:14.62%
  • accelerando_4:6.55%
  • accelerando_5:3.03%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:225719
  • name:Accelerando
  • tooltip:Haste increased by $w1.
  • description:{$@spelldesc225125=Your damaging spells have a chance to grant you {$225719s1=528} Haste for {$225719d=12 seconds}, stacking up to 5 times. Stacking does not refresh duration.}
  • max_stacks:5
  • duration:12.00
  • cooldown:0.00
  • default_chance:101.00%
Berserking 2.1 0.0 180.6sec 180.6sec 6.86% 8.47% 0.0(0.0) 2.0

Buff details

  • buff initial source:Magistrike
  • cooldown name:buff_berserking
  • max_stacks:1
  • duration:10.00
  • cooldown:180.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • berserking_1:6.86%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:26297
  • name:Berserking
  • tooltip:Haste increased by {$s1=15}%.
  • description:Increases your haste by {$s1=15}% for {$d=10 seconds}.
  • max_stacks:0
  • duration:10.00
  • cooldown:180.00
  • default_chance:0.00%
Bloodlust 1.0 0.0 0.0sec 0.0sec 13.55% 13.55% 0.0(0.0) 1.0

Buff details

  • buff initial source:Magistrike
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • duration:40.00
  • cooldown:300.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • bloodlust_1:13.55%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:2825
  • name:Bloodlust
  • tooltip:Haste increased by {$s1=30}%.
  • description:Increases Haste by {$s1=30}% for all party and raid members for {$d=40 seconds}. Allies receiving this effect will become Sated and unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.
  • max_stacks:0
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
Conflagration of Chaos 24.0 0.0 12.4sec 12.4sec 49.10% 46.74% 0.0(0.0) 1.1

Buff details

  • buff initial source:Magistrike
  • cooldown name:buff_conflagration_of_chaos
  • max_stacks:1
  • duration:20.00
  • cooldown:0.00
  • default_chance:50.00%
  • default_value:-0.00

Stack Uptimes

  • conflagration_of_chaos_1:49.10%

Trigger Attempt Success

  • trigger_pct:49.97%

Spelldata details

  • id:196546
  • name:Conflagration of Chaos
  • tooltip:Your {$?s17877=false}[Shadowburn][Conflagrate] will always critically strike. Critical strike chance will increase the critical strike damage of {$?s17877=false}[Shadowburn][Conflagrate].
  • description:{$@spelldesc219195={$?s17877=false}[Shadowburn][Conflagrate] has a chance to guarantee your next {$?s17877=false}[Shadowburn][Conflagrate] critically strikes, and to increase its damage by your critical strike chance.}
  • max_stacks:0
  • duration:20.00
  • cooldown:0.00
  • default_chance:100.00%
Devil's Due 3.5 0.0 69.3sec 69.3sec 8.67% 8.67% 0.0(0.0) 3.2

Buff details

  • buff initial source:Magistrike
  • cooldown name:buff_devils_due
  • max_stacks:1
  • duration:8.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.18

Stack Uptimes

  • devils_due_1:8.67%

Trigger Attempt Success

  • trigger_pct:99.95%

Spelldata details

  • id:225776
  • name:Devil's Due
  • tooltip:Cast speed slowed by {$s1=7}%.
  • description:{$@spelldesc225142=Your damaging spells have a chance to grant Nefarious Pact, increasing your casting speed by {$225774s1=17}% for {$225774d=12 seconds}. When Nefarious Pact expires, your casting speed is decreased by {$225776s1=7}% for {$225776d=8 seconds}.}
  • max_stacks:0
  • duration:8.00
  • cooldown:0.00
  • default_chance:0.00%
Embrace Chaos 33.4 27.9 9.2sec 4.9sec 66.65% 79.21% 27.9(27.9) 32.7

Buff details

  • buff initial source:Magistrike
  • cooldown name:buff_embrace_chaos
  • max_stacks:1
  • duration:4.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • embrace_chaos_1:66.65%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:212019
  • name:Embrace Chaos
  • tooltip:Chaos Bolt has {$s1=40}% reduced cast time.
  • description:{$@spelldesc212018=Casting Chaos Bolt reduces the cast time of your next Chaos Bolt by {$212019s1=40}% for {$212019d=4 seconds}.}
  • max_stacks:0
  • duration:4.00
  • cooldown:0.00
  • default_chance:0.00%
Lord of Flames 1.0 0.0 0.0sec 0.0sec 97.87% 97.87% 0.0(0.0) 0.0

Buff details

  • buff initial source:Magistrike
  • cooldown name:buff_lord_of_flames
  • max_stacks:1
  • duration:600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • lord_of_flames_1:97.87%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:226802
  • name:Lord of Flames
  • tooltip:Recently activated Lord of Flames.
  • description:{$@spelldesc224103=Once every {$s2=10} minutes, {$?s152107=false}[your Infernal's Meteor Strike][Summon Infernal] will summon {$s3=3} additional Infernals to serve you for {$226804d=25 seconds}.}
  • max_stacks:0
  • duration:600.00
  • cooldown:0.00
  • default_chance:0.00%
Nefarious Pact 3.5 0.0 69.7sec 68.8sec 13.47% 13.47% 0.0(0.0) 3.3

Buff details

  • buff initial source:Magistrike
  • cooldown name:buff_nefarious_pact
  • max_stacks:1
  • duration:12.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.44

Stack Uptimes

  • nefarious_pact_1:13.47%

Trigger Attempt Success

  • trigger_pct:99.95%

Spelldata details

  • id:225774
  • name:Nefarious Pact
  • tooltip:Cast speed increased by {$s1=17}%.
  • description:{$@spelldesc225142=Your damaging spells have a chance to grant Nefarious Pact, increasing your casting speed by {$225774s1=17}% for {$225774d=12 seconds}. When Nefarious Pact expires, your casting speed is decreased by {$225776s1=7}% for {$225776d=8 seconds}.}
  • max_stacks:0
  • duration:12.00
  • cooldown:0.00
  • default_chance:0.00%
Potion of Deadly Grace 1.0 0.0 0.0sec 0.0sec 10.16% 10.16% 0.0(0.0) 1.0

Buff details

  • buff initial source:Magistrike
  • cooldown name:buff_potion_of_deadly_grace
  • max_stacks:1
  • duration:30.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • potion_of_deadly_grace_1:10.16%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:188027
  • name:Potion of Deadly Grace
  • tooltip:Your attacks have a chance to unleash a bolt of energy at your target.
  • description:Grants your attacks a chance to unleash a bolt of energy at your target. Staying away from enemies for the entire duration of the effect will extend the effect by an additional 5 seconds.
  • max_stacks:0
  • duration:25.00
  • cooldown:1.00
  • default_chance:101.00%
Potion of Prolonged Power 1.0 0.0 0.0sec 0.0sec 19.64% 19.64% 0.0(0.0) 1.0

Buff details

  • buff initial source:Magistrike
  • cooldown name:buff_potion_of_prolonged_power
  • max_stacks:1
  • duration:60.00
  • cooldown:1.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:all
  • amount:2500.00

Stack Uptimes

  • potion_of_prolonged_power_1:19.64%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:229206
  • name:Potion of Prolonged Power
  • tooltip:All stats increased by {$s1=2500}.
  • description:Drink to increase all stats by {$s1=2500} for {$d=60 seconds}.
  • max_stacks:0
  • duration:60.00
  • cooldown:1.00
  • default_chance:0.00%
Soul Harvest 2.9 0.0 120.9sec 120.9sec 17.78% 17.78% 0.0(0.0) 2.7

Buff details

  • buff initial source:Magistrike
  • cooldown name:buff_soul_harvest
  • max_stacks:1
  • duration:15.00
  • cooldown:120.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • soul_harvest_1:17.78%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:196098
  • name:Soul Harvest
  • tooltip:Damage increased by {$s1=20}%.
  • description:Increases your damage and your pets' damage by {$s1=20}%. Lasts {$d=15 seconds}, increased by {$s2=2} sec for each target afflicted by your {$?s137043=false}[Agony][]{$?s137044=false}[Doom][]{$?s137046=false}[Immolate][], up to a maximum of {$s3=35} sec.
  • max_stacks:0
  • duration:15.00
  • cooldown:120.00
  • default_chance:0.00%
Constant Buffs
Well Fed (azshari_salad)

Buff details

  • buff initial source:Magistrike
  • cooldown name:buff_azshari_salad
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:haste_rating
  • amount:375.00

Stack Uptimes

  • azshari_salad_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:225603
  • name:Well Fed
  • tooltip:Haste increased by $w1.
  • description:Increases haste by {$s1=375} for {$d=3600 seconds}.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Defiled Augmentation

Buff details

  • buff initial source:Magistrike
  • cooldown name:buff_defiled_augmentation
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:agility
  • amount:325.00
  • stat:strength
  • amount:325.00
  • stat:intellect
  • amount:325.00

Stack Uptimes

  • defiled_augmentation_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:224001
  • name:Defiled Augmentation
  • tooltip:Agility, Intellect and Strength increased by $w1.
  • description:Increases Agility, Intellect and Strength by {$s1=325} for {$d=3600 seconds}. Augment Rune.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Flask of the Whispered Pact

Buff details

  • buff initial source:Magistrike
  • cooldown name:buff_flask_of_the_whispered_pact
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:intellect
  • amount:1300.00

Stack Uptimes

  • flask_of_the_whispered_pact_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:188031
  • name:Flask of the Whispered Pact
  • tooltip:Intellect increased by $w1.
  • description:Increases Intellect by {$s1=1300} for {$d=3600 seconds}. Counts as both a Battle and Guardian elixir. This effect persists through death.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:101.00%
Tormented Souls

Buff details

  • buff initial source:Magistrike
  • cooldown name:buff_tormented_souls
  • max_stacks:12
  • duration:0.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00

Stack Uptimes

  • tormented_souls_2:0.38%
  • tormented_souls_3:99.62%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:216695
  • name:Tormented Souls
  • tooltip:Activate Reap Souls to consume all Tormented Souls collected by |cFFFFCC99Ulthalesh|r, increasing your damage by 10% and doubling the effect of all of |cFFFFCC99Ulthalesh|r's other traits for {$216708d=5 seconds} per soul consumed.
  • description:Activate Reap Souls to consume all Tormented Souls collected by |cFFFFCC99Ulthalesh|r, increasing your damage by 10% and doubling the effect of all of |cFFFFCC99Ulthalesh|r's other traits for {$216708d=5 seconds} per soul consumed.
  • max_stacks:12
  • duration:-0.00
  • cooldown:0.00
  • default_chance:101.00%

Procs

Count Interval
shadowy_tear 3.2 70.6sec
flame_rift 3.2 71.1sec
chaos_tear 3.2 71.1sec
chaos_portal 3.2 70.5sec
dimension_ripper 3.7 56.7sec
t19_2pc_chaos_bolt 42.4 6.8sec

Resources

Resource Usage Type Count Total Average RPE APR
Magistrike
chaos_bolt Soul Shard 61.2 122.5 2.0 2.0 1139699.4
havoc Mana 14.9 1309742.3 88000.0 88000.3 0.0
immolate Mana 19.8 1309344.2 66000.0 65999.9 69.3
incinerate Mana 74.5 4916990.1 66000.0 66001.1 8.9
service_imp Soul Shard 3.7 3.7 1.0 1.0 0.0
summon_doomguard Soul Shard 1.0 1.0 1.0 1.0 0.0
summon_infernal Soul Shard 1.0 1.0 1.0 1.0 0.0
pet - imp
firebolt Energy 107.8 4312.7 40.0 40.0 3379.5
pet - service_imp
firebolt Energy 48.7 1949.9 40.0 40.0 6904.6
pet - doomguard
doom_bolt Energy 10.7 375.0 35.0 35.0 7181.3
pet - flame_rift
searing_bolt Energy 63.8 63.8 1.0 1.0 372390.7
Resource Gains Type Count Total Average Overflow
life_tap Mana 6.54 2159037.29 (32.36%) 330000.00 0.00 0.00%
immolate Soul Shard 71.48 70.41 (55.24%) 0.99 1.07 1.50%
conflagrate Soul Shard 47.98 47.87 (37.56%) 1.00 0.10 0.21%
mp5_regen Mana 517.33 4511883.16 (67.64%) 8721.56 74940.25 1.63%
soulsnatcher Soul Shard 9.18 9.18 (7.20%) 1.00 0.00 0.00%
pet - imp
energy_regen Energy 1898.99 4146.36 (100.00%) 2.18 21.59 0.52%
pet - service_imp
energy_regen Energy 440.91 1330.32 (100.00%) 3.02 61.89 4.45%
pet - doomguard
energy_regen Energy 15.57 333.75 (100.00%) 21.44 42.52 11.30%
Resource RPS-Gain RPS-Loss
Health 0.00 7135.16
Mana 22161.58 25035.82
Soul Shard 0.42 0.43
Combat End Resource Mean Min Max
Mana 232510.41 8926.83 495304.93
Soul Shard 2.26 0.00 5.00

Benefits & Uptimes

Benefits %
Uptimes %
Mana Cap 1.2%

Statistics & Data Analysis

Fight Length
Sample Data Magistrike Fight Length
Count 9999
Mean 301.01
Minimum 217.68
Maximum 385.07
Spread ( max - min ) 167.39
Range [ ( max - min ) / 2 * 100% ] 27.80%
DPS
Sample Data Magistrike Damage Per Second
Count 9999
Mean 1398372.47
Minimum 1195010.80
Maximum 1635455.45
Spread ( max - min ) 440444.65
Range [ ( max - min ) / 2 * 100% ] 15.75%
Standard Deviation 63025.4377
5th Percentile 1300094.21
95th Percentile 1507865.45
( 95th Percentile - 5th Percentile ) 207771.24
Mean Distribution
Standard Deviation 630.2859
95.00% Confidence Intervall ( 1397137.14 - 1399607.81 )
Normalized 95.00% Confidence Intervall ( 99.91% - 100.09% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 79
0.1% Error 7804
0.1 Scale Factor Error with Delta=300 33909034
0.05 Scale Factor Error with Delta=300 135636134
0.01 Scale Factor Error with Delta=300 3390903336
Priority Target DPS
Sample Data Magistrike Priority Target Damage Per Second
Count 9999
Mean 828395.11
Minimum 688061.97
Maximum 1041773.59
Spread ( max - min ) 353711.63
Range [ ( max - min ) / 2 * 100% ] 21.35%
Standard Deviation 46550.3177
5th Percentile 756985.04
95th Percentile 909266.73
( 95th Percentile - 5th Percentile ) 152281.69
Mean Distribution
Standard Deviation 465.5265
95.00% Confidence Intervall ( 827482.70 - 829307.53 )
Normalized 95.00% Confidence Intervall ( 99.89% - 100.11% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 122
0.1% Error 12131
0.1 Scale Factor Error with Delta=300 18498179
0.05 Scale Factor Error with Delta=300 73992715
0.01 Scale Factor Error with Delta=300 1849817856
DPS(e)
Sample Data Magistrike Damage Per Second (Effective)
Count 9999
Mean 1398372.47
Minimum 1195010.80
Maximum 1635455.45
Spread ( max - min ) 440444.65
Range [ ( max - min ) / 2 * 100% ] 15.75%
Damage
Sample Data Magistrike Damage
Count 9999
Mean 340249233.56
Minimum 232987502.61
Maximum 461851214.83
Spread ( max - min ) 228863712.22
Range [ ( max - min ) / 2 * 100% ] 33.63%
DTPS
Sample Data Magistrike Damage Taken Per Second
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HPS
Sample Data Magistrike Healing Per Second
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
HPS(e)
Sample Data Magistrike Healing Per Second (Effective)
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
Sample Data Magistrike Heal
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
Sample Data Magistrike Healing Taken Per Second
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
TMI
Sample Data Magistrike Theck-Meloree Index
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
ETMI
Sample Data MagistrikeTheck-Meloree Index (Effective)
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
MSD
Sample Data Magistrike Max Spike Value
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 flask,type=whispered_pact
1 0.00 food,type=azshari_salad
2 0.00 summon_pet,if=!talent.grimoire_of_supremacy.enabled&(!talent.grimoire_of_sacrifice.enabled|buff.demonic_power.down)
3 0.00 summon_infernal,if=talent.grimoire_of_supremacy.enabled&artifact.lord_of_flames.rank>0
4 0.00 summon_infernal,if=talent.grimoire_of_supremacy.enabled&active_enemies>1
5 0.00 summon_doomguard,if=talent.grimoire_of_supremacy.enabled&active_enemies=1&artifact.lord_of_flames.rank=0
6 0.00 augmentation,type=defiled
7 0.00 snapshot_stats
8 0.00 grimoire_of_sacrifice,if=talent.grimoire_of_sacrifice.enabled
9 0.00 life_tap,if=talent.empowered_life_tap.enabled&!buff.empowered_life_tap.remains
A 0.00 potion,name=prolonged_power
B 0.00 chaos_bolt
Default action list Executed every time the actor is available.
# count action,conditions
C 14.88 havoc,target=2,if=active_enemies>1&(active_enemies<4|talent.wreak_havoc.enabled&active_enemies<6)&!debuff.havoc.remains
D 1.00 dimensional_rift,if=charges=3
E 10.29 immolate,if=remains<=tick_time
F 0.63 immolate,cycle_targets=1,if=active_enemies>1&remains<=tick_time&(!talent.roaring_blaze.enabled|(!debuff.roaring_blaze.remains&action.conflagrate.charges<2+set_bonus.tier19_4pc))
G 8.96 immolate,if=talent.roaring_blaze.enabled&remains<=duration&!debuff.roaring_blaze.remains&target.time_to_die>10&(action.conflagrate.charges=2+set_bonus.tier19_4pc|(action.conflagrate.charges>=1+set_bonus.tier19_4pc&action.conflagrate.recharge_time<cast_time+gcd)|target.time_to_die<24)
H 2.06 berserking
0.00 blood_fury
0.00 arcane_torrent
I 1.00 potion,name=deadly_grace,if=(buff.soul_harvest.remains|trinket.proc.any.react|target.time_to_die<=45)
0.00 shadowburn,if=buff.conflagration_of_chaos.remains<=action.chaos_bolt.cast_time
0.00 shadowburn,if=(charges=1+set_bonus.tier19_4pc&recharge_time<action.chaos_bolt.cast_time|charges=2+set_bonus.tier19_4pc)&soul_shard<5
J 13.94 conflagrate,if=talent.roaring_blaze.enabled&(charges=2+set_bonus.tier19_4pc|(charges>=1+set_bonus.tier19_4pc&recharge_time<gcd)|target.time_to_die<24)
K 34.04 conflagrate,if=talent.roaring_blaze.enabled&debuff.roaring_blaze.stack>0&dot.immolate.remains>dot.immolate.duration*0.3&(active_enemies=1|soul_shard<3)&soul_shard<5
0.00 conflagrate,if=!talent.roaring_blaze.enabled&buff.backdraft.stack<3&buff.conflagration_of_chaos.remains<=action.chaos_bolt.cast_time
0.00 conflagrate,if=!talent.roaring_blaze.enabled&buff.backdraft.stack<3&(charges=1+set_bonus.tier19_4pc&recharge_time<action.chaos_bolt.cast_time|charges=2+set_bonus.tier19_4pc)&soul_shard<5
0.00 life_tap,if=talent.empowered_life_tap.enabled&buff.empowered_life_tap.remains<=gcd
0.00 dimensional_rift,if=equipped.144369&!buff.lessons_of_spacetime.remains&((!talent.grimoire_of_supremacy.enabled&!cooldown.summon_doomguard.remains)|(talent.grimoire_of_service.enabled&!cooldown.service_pet.remains)|(talent.soul_harvest.enabled&!cooldown.soul_harvest.remains))
L 3.69 service_pet
M 1.00 summon_infernal,if=artifact.lord_of_flames.rank>0&!buff.lord_of_flames.remains
N 1.00 summon_doomguard,if=!talent.grimoire_of_supremacy.enabled&spell_targets.infernal_awakening<=2&(target.time_to_die>180|target.health.pct<=20|target.time_to_die<30)
0.00 summon_infernal,if=!talent.grimoire_of_supremacy.enabled&spell_targets.infernal_awakening>2
0.00 summon_doomguard,if=talent.grimoire_of_supremacy.enabled&spell_targets.summon_infernal=1&artifact.lord_of_flames.rank>0&buff.lord_of_flames.remains&!pet.doomguard.active
0.00 summon_doomguard,if=talent.grimoire_of_supremacy.enabled&spell_targets.summon_infernal=1&equipped.132379&!cooldown.sindorei_spite_icd.remains
0.00 summon_infernal,if=talent.grimoire_of_supremacy.enabled&spell_targets.summon_infernal>1&equipped.132379&!cooldown.sindorei_spite_icd.remains
O 2.90 soul_harvest
0.00 channel_demonfire,if=dot.immolate.remains>cast_time
0.00 havoc,if=active_enemies=1&talent.wreak_havoc.enabled&equipped.132375&!debuff.havoc.remains
0.00 rain_of_fire,if=active_enemies>=3&cooldown.havoc.remains<=12&!talent.wreak_havoc.enabled
0.00 rain_of_fire,if=active_enemies>=6&talent.wreak_havoc.enabled
P 11.87 dimensional_rift,if=!equipped.144369|charges>1|((!talent.grimoire_of_service.enabled|recharge_time<cooldown.service_pet.remains)&(!talent.soul_harvest.enabled|recharge_time<cooldown.soul_harvest.remains)&(!talent.grimoire_of_supremacy.enabled|recharge_time<cooldown.summon_doomguard.remains))
0.00 life_tap,if=talent.empowered_life_tap.enabled&buff.empowered_life_tap.remains<duration*0.3
0.00 cataclysm
Q 60.56 chaos_bolt,if=(cooldown.havoc.remains>12&cooldown.havoc.remains|active_enemies<3|talent.wreak_havoc.enabled&active_enemies<6)&(set_bonus.tier19_4pc=0|!talent.eradication.enabled|buff.embrace_chaos.remains<=cast_time|soul_shard>=3)
0.00 shadowburn
0.00 conflagrate,if=!talent.roaring_blaze.enabled&buff.backdraft.stack<3
0.00 immolate,if=!talent.roaring_blaze.enabled&remains<=duration*0.3
R 74.82 incinerate
S 6.54 life_tap

Sample Sequence

0126ABCDEGHJKLMOPPQKQKRKQQRRKQCRRPQRERPQRRGJKKQRKRCQRRKPQRRQERQRQCQGJKQQKQKRQRRKQCQQERRPQQLRGJQKCQKKQRQKQRRQRERSCROIRRRGJQKPQKKQQCRKQRRQERSQRRRRQRCGJQKQKRQKRQRKPHQQCLQESQRRQRGJKQKQKCQQQRKRQRREQRRPCNSGJQKKQRQKRRQCKORREQRRRQRSRRQGJQCQJJPJQLRJQQRRRRJQCEQSRJ

Sample Sequence Table

time list # name target resources buffs
Pre precombat 0 flask Magistrike 1100000.0/1100000: 100% mana | 3.0/5: 60% soul_shard
Pre precombat 1 food Magistrike 1100000.0/1100000: 100% mana | 3.0/5: 60% soul_shard
Pre precombat 2 summon_imp Fluffy_Pillow 1100000.0/1100000: 100% mana | 3.0/5: 60% soul_shard
Pre precombat 6 augmentation Magistrike 1100000.0/1100000: 100% mana | 3.0/5: 60% soul_shard
Pre precombat A potion Fluffy_Pillow 1100000.0/1100000: 100% mana | 3.0/5: 60% soul_shard potion_of_prolonged_power
0:00.000 precombat B chaos_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 1.0/5: 20% soul_shard embrace_chaos, accelerando, potion_of_prolonged_power
0:00.000 default C havoc enemy2 1100000.0/1100000: 100% mana | 1.0/5: 20% soul_shard embrace_chaos, accelerando, potion_of_prolonged_power
0:01.156 default D dimensional_rift Fluffy_Pillow 1033559.7/1100000: 94% mana | 1.0/5: 20% soul_shard bloodlust, embrace_chaos, accelerando, potion_of_prolonged_power
0:02.044 default E immolate Fluffy_Pillow 1050121.1/1100000: 95% mana | 1.0/5: 20% soul_shard bloodlust, embrace_chaos, accelerando, potion_of_prolonged_power
0:02.931 default G immolate Fluffy_Pillow 1000664.7/1100000: 91% mana | 1.0/5: 20% soul_shard bloodlust, embrace_chaos, accelerando(2), potion_of_prolonged_power
0:03.806 default H berserking Fluffy_Pillow 951228.9/1100000: 86% mana | 1.0/5: 20% soul_shard bloodlust, embrace_chaos, accelerando(2), potion_of_prolonged_power
0:03.806 default J conflagrate Fluffy_Pillow 951228.9/1100000: 86% mana | 1.0/5: 20% soul_shard bloodlust, berserking, embrace_chaos, accelerando(2), potion_of_prolonged_power
0:04.568 default K conflagrate Fluffy_Pillow 967817.8/1100000: 88% mana | 2.0/5: 40% soul_shard bloodlust, berserking, accelerando(2), potion_of_prolonged_power
0:05.329 default L service_imp Fluffy_Pillow 984384.8/1100000: 89% mana | 4.0/5: 80% soul_shard bloodlust, berserking, conflagration_of_chaos, accelerando(2), potion_of_prolonged_power
0:06.089 default M summon_infernal Fluffy_Pillow 1000930.1/1100000: 91% mana | 3.0/5: 60% soul_shard bloodlust, berserking, conflagration_of_chaos, accelerando(2), potion_of_prolonged_power
0:06.850 default O soul_harvest Fluffy_Pillow 1017497.2/1100000: 92% mana | 3.0/5: 60% soul_shard bloodlust, berserking, lord_of_flames, conflagration_of_chaos, accelerando(2), potion_of_prolonged_power
0:06.850 default P dimensional_rift Fluffy_Pillow 1017497.2/1100000: 92% mana | 3.0/5: 60% soul_shard bloodlust, berserking, soul_harvest, lord_of_flames, conflagration_of_chaos, accelerando(2), potion_of_prolonged_power
0:07.610 default P dimensional_rift Fluffy_Pillow 1034042.4/1100000: 94% mana | 3.0/5: 60% soul_shard bloodlust, berserking, soul_harvest, lord_of_flames, conflagration_of_chaos, accelerando(2), potion_of_prolonged_power
0:08.370 default Q chaos_bolt Fluffy_Pillow 1050587.7/1100000: 96% mana | 3.0/5: 60% soul_shard bloodlust, berserking, soul_harvest, lord_of_flames, conflagration_of_chaos, accelerando(2), potion_of_prolonged_power
0:09.890 default K conflagrate Fluffy_Pillow 1083678.3/1100000: 99% mana | 2.0/5: 40% soul_shard bloodlust, berserking, soul_harvest, lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(2), potion_of_prolonged_power
0:10.651 default Q chaos_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 3.0/5: 60% soul_shard bloodlust, berserking, soul_harvest, lord_of_flames, embrace_chaos, accelerando(2), potion_of_prolonged_power
0:11.564 default K conflagrate Fluffy_Pillow 1100000.0/1100000: 100% mana | 1.0/5: 20% soul_shard bloodlust, berserking, soul_harvest, lord_of_flames, embrace_chaos, accelerando(3), potion_of_prolonged_power
0:12.320 default R incinerate Fluffy_Pillow 1100000.0/1100000: 100% mana | 2.0/5: 40% soul_shard bloodlust, berserking, soul_harvest, lord_of_flames, conflagration_of_chaos, embrace_chaos, potion_of_prolonged_power
0:13.300 default K conflagrate Fluffy_Pillow 1034042.3/1100000: 94% mana | 2.0/5: 40% soul_shard bloodlust, berserking, soul_harvest, lord_of_flames, conflagration_of_chaos, embrace_chaos, potion_of_prolonged_power
0:14.086 default Q chaos_bolt Fluffy_Pillow 1049875.7/1100000: 95% mana | 4.0/5: 80% soul_shard bloodlust, soul_harvest, lord_of_flames, embrace_chaos, potion_of_prolonged_power
0:15.168 default Q chaos_bolt Fluffy_Pillow 1069753.8/1100000: 97% mana | 3.0/5: 60% soul_shard bloodlust, soul_harvest, lord_of_flames, embrace_chaos, accelerando, potion_of_prolonged_power
0:16.233 default R incinerate Fluffy_Pillow 1089617.4/1100000: 99% mana | 2.0/5: 40% soul_shard bloodlust, soul_harvest, lord_of_flames, embrace_chaos, accelerando(2), potion_of_prolonged_power
0:17.330 default R incinerate Fluffy_Pillow 1034096.1/1100000: 94% mana | 2.0/5: 40% soul_shard bloodlust, soul_harvest, lord_of_flames, embrace_chaos, accelerando(3), potion_of_prolonged_power
0:18.408 default K conflagrate Fluffy_Pillow 988804.9/1100000: 90% mana | 2.0/5: 40% soul_shard bloodlust, soul_harvest, lord_of_flames, embrace_chaos, accelerando(3), potion_of_prolonged_power
0:19.270 default Q chaos_bolt Fluffy_Pillow 1005364.3/1100000: 91% mana | 3.0/5: 60% soul_shard bloodlust, soul_harvest, lord_of_flames, embrace_chaos, accelerando(3), potion_of_prolonged_power
0:20.304 default C havoc enemy2 1025227.9/1100000: 93% mana | 1.0/5: 20% soul_shard bloodlust, soul_harvest, lord_of_flames, embrace_chaos, accelerando(3), potion_of_prolonged_power
0:21.165 default R incinerate Fluffy_Pillow 953768.0/1100000: 87% mana | 2.0/5: 40% soul_shard bloodlust, soul_harvest, lord_of_flames, embrace_chaos, accelerando(3), potion_of_prolonged_power
0:22.246 default R incinerate Fluffy_Pillow 908534.5/1100000: 83% mana | 2.0/5: 40% soul_shard bloodlust, soul_harvest, lord_of_flames, embrace_chaos, accelerando(3), potion_of_prolonged_power
0:23.328 default P dimensional_rift Fluffy_Pillow 863320.2/1100000: 78% mana | 2.0/5: 40% soul_shard bloodlust, soul_harvest, lord_of_flames, embrace_chaos, accelerando(3), potion_of_prolonged_power
0:24.189 default Q chaos_bolt Fluffy_Pillow 879860.4/1100000: 80% mana | 2.0/5: 40% soul_shard bloodlust, soul_harvest, lord_of_flames, embrace_chaos, accelerando(3), potion_of_prolonged_power
0:25.223 default R incinerate Fluffy_Pillow 899724.0/1100000: 82% mana | 1.0/5: 20% soul_shard bloodlust, soul_harvest, lord_of_flames, embrace_chaos, accelerando(3), potion_of_prolonged_power
0:26.303 default E immolate Fluffy_Pillow 854471.2/1100000: 78% mana | 1.0/5: 20% soul_shard bloodlust, lord_of_flames, embrace_chaos, accelerando(3), potion_of_prolonged_power
0:27.167 default R incinerate Fluffy_Pillow 805066.2/1100000: 73% mana | 1.0/5: 20% soul_shard bloodlust, lord_of_flames, embrace_chaos, potion_of_prolonged_power
0:28.299 default P dimensional_rift Fluffy_Pillow 760025.8/1100000: 69% mana | 1.0/5: 20% soul_shard bloodlust, lord_of_flames, embrace_chaos, accelerando(2), potion_of_prolonged_power
0:29.173 default Q chaos_bolt Fluffy_Pillow 776571.1/1100000: 71% mana | 2.0/5: 40% soul_shard bloodlust, lord_of_flames, embrace_chaos, accelerando(2), potion_of_prolonged_power
0:30.222 default R incinerate Fluffy_Pillow 796429.2/1100000: 72% mana | 0.0/5: 0% soul_shard bloodlust, lord_of_flames, embrace_chaos, accelerando(2), potion_of_prolonged_power
0:31.319 default R incinerate Fluffy_Pillow 751196.0/1100000: 68% mana | 0.0/5: 0% soul_shard bloodlust, lord_of_flames, embrace_chaos, accelerando(2), potion_of_prolonged_power
0:32.416 default G immolate Fluffy_Pillow 705962.8/1100000: 64% mana | 0.0/5: 0% soul_shard bloodlust, lord_of_flames, embrace_chaos, accelerando(2), potion_of_prolonged_power
0:33.292 default J conflagrate Fluffy_Pillow 656545.9/1100000: 60% mana | 0.0/5: 0% soul_shard bloodlust, lord_of_flames, embrace_chaos, accelerando(2), potion_of_prolonged_power
0:34.165 default K conflagrate Fluffy_Pillow 673072.3/1100000: 61% mana | 1.0/5: 20% soul_shard bloodlust, lord_of_flames, embrace_chaos, accelerando(2), potion_of_prolonged_power
0:35.044 default K conflagrate Fluffy_Pillow 689712.2/1100000: 63% mana | 2.0/5: 40% soul_shard bloodlust, lord_of_flames, conflagration_of_chaos, accelerando(2), potion_of_prolonged_power
0:35.920 default Q chaos_bolt Fluffy_Pillow 706295.4/1100000: 64% mana | 3.0/5: 60% soul_shard bloodlust, lord_of_flames, conflagration_of_chaos, accelerando(2), potion_of_prolonged_power
0:37.667 default R incinerate Fluffy_Pillow 739368.1/1100000: 67% mana | 1.0/5: 20% soul_shard bloodlust, lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(3), potion_of_prolonged_power
0:38.747 default K conflagrate Fluffy_Pillow 694115.4/1100000: 63% mana | 1.0/5: 20% soul_shard bloodlust, lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(3), potion_of_prolonged_power
0:39.646 default R incinerate Fluffy_Pillow 711446.1/1100000: 65% mana | 2.0/5: 40% soul_shard bloodlust, lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(4), potion_of_prolonged_power
0:40.711 default C havoc enemy2 665092.3/1100000: 60% mana | 2.0/5: 40% soul_shard bloodlust, lord_of_flames, conflagration_of_chaos, embrace_chaos, potion_of_prolonged_power
0:41.613 default Q chaos_bolt Fluffy_Pillow 589838.5/1100000: 54% mana | 2.0/5: 40% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, potion_of_prolonged_power
0:43.017 default R incinerate Fluffy_Pillow 609678.5/1100000: 55% mana | 0.0/5: 0% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, potion_of_prolonged_power
0:44.485 default R incinerate Fluffy_Pillow 564422.9/1100000: 51% mana | 1.0/5: 20% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, potion_of_prolonged_power
0:45.954 default K conflagrate Fluffy_Pillow 519181.4/1100000: 47% mana | 2.0/5: 40% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, potion_of_prolonged_power
0:47.126 default P dimensional_rift Fluffy_Pillow 535742.9/1100000: 49% mana | 3.0/5: 60% soul_shard lord_of_flames, potion_of_prolonged_power
0:48.296 default Q chaos_bolt Fluffy_Pillow 552276.2/1100000: 50% mana | 4.0/5: 80% soul_shard lord_of_flames, potion_of_prolonged_power
0:50.637 default R incinerate Fluffy_Pillow 585394.5/1100000: 53% mana | 2.0/5: 40% soul_shard lord_of_flames, embrace_chaos, accelerando, potion_of_prolonged_power
0:52.083 default R incinerate Fluffy_Pillow 540139.3/1100000: 49% mana | 2.0/5: 40% soul_shard lord_of_flames, embrace_chaos, accelerando, potion_of_prolonged_power
0:53.531 default Q chaos_bolt Fluffy_Pillow 494912.8/1100000: 45% mana | 3.0/5: 60% soul_shard lord_of_flames, embrace_chaos, accelerando, potion_of_prolonged_power
0:54.915 default E immolate Fluffy_Pillow 514768.1/1100000: 47% mana | 1.0/5: 20% soul_shard lord_of_flames, embrace_chaos, accelerando, potion_of_prolonged_power
0:56.070 default R incinerate Fluffy_Pillow 465338.2/1100000: 42% mana | 2.0/5: 40% soul_shard lord_of_flames, embrace_chaos, accelerando, potion_of_prolonged_power
0:57.515 default Q chaos_bolt Fluffy_Pillow 420068.6/1100000: 38% mana | 3.0/5: 60% soul_shard lord_of_flames, embrace_chaos, accelerando, potion_of_prolonged_power
0:58.900 default R incinerate Fluffy_Pillow 439938.3/1100000: 40% mana | 2.0/5: 40% soul_shard lord_of_flames, embrace_chaos, accelerando
1:00.347 default Q chaos_bolt Fluffy_Pillow 394697.5/1100000: 36% mana | 4.0/5: 80% soul_shard lord_of_flames, embrace_chaos, accelerando
1:01.732 default C havoc enemy2 414567.2/1100000: 38% mana | 3.0/5: 60% soul_shard lord_of_flames, embrace_chaos, accelerando
1:02.888 default Q chaos_bolt Fluffy_Pillow 343060.1/1100000: 31% mana | 3.0/5: 60% soul_shard lord_of_flames, embrace_chaos
1:04.292 default G immolate Fluffy_Pillow 363051.8/1100000: 33% mana | 1.0/5: 20% soul_shard lord_of_flames, embrace_chaos, accelerando
1:05.447 default J conflagrate Fluffy_Pillow 313621.9/1100000: 29% mana | 1.0/5: 20% soul_shard lord_of_flames, embrace_chaos, accelerando
1:06.601 default K conflagrate Fluffy_Pillow 330177.5/1100000: 30% mana | 2.0/5: 40% soul_shard lord_of_flames, embrace_chaos, accelerando
1:07.754 default Q chaos_bolt Fluffy_Pillow 346926.9/1100000: 32% mana | 3.0/5: 60% soul_shard lord_of_flames, embrace_chaos, accelerando(2)
1:09.117 default Q chaos_bolt Fluffy_Pillow 366774.9/1100000: 33% mana | 3.0/5: 60% soul_shard lord_of_flames, embrace_chaos, accelerando(2)
1:10.481 default K conflagrate Fluffy_Pillow 386637.4/1100000: 35% mana | 2.0/5: 40% soul_shard lord_of_flames, embrace_chaos, accelerando(2)
1:11.618 default Q chaos_bolt Fluffy_Pillow 403194.3/1100000: 37% mana | 3.0/5: 60% soul_shard lord_of_flames, embrace_chaos, accelerando(2)
1:12.982 default K conflagrate Fluffy_Pillow 423056.8/1100000: 38% mana | 1.0/5: 20% soul_shard lord_of_flames, embrace_chaos, accelerando(2)
1:14.120 default R incinerate Fluffy_Pillow 439628.3/1100000: 40% mana | 2.0/5: 40% soul_shard lord_of_flames, embrace_chaos, accelerando(2)
1:15.542 default Q chaos_bolt Fluffy_Pillow 394335.4/1100000: 36% mana | 3.0/5: 60% soul_shard lord_of_flames, embrace_chaos, accelerando(2)
1:16.905 default R incinerate Fluffy_Pillow 413616.2/1100000: 38% mana | 1.0/5: 20% soul_shard lord_of_flames, embrace_chaos, accelerando
1:18.349 default R incinerate Fluffy_Pillow 368332.4/1100000: 33% mana | 1.0/5: 20% soul_shard lord_of_flames, embrace_chaos, accelerando
1:19.796 default K conflagrate Fluffy_Pillow 323091.5/1100000: 29% mana | 2.0/5: 40% soul_shard lord_of_flames, embrace_chaos, accelerando
1:20.950 default Q chaos_bolt Fluffy_Pillow 339647.2/1100000: 31% mana | 3.0/5: 60% soul_shard lord_of_flames, accelerando
1:23.255 default C havoc enemy2 373019.3/1100000: 34% mana | 3.0/5: 60% soul_shard lord_of_flames, embrace_chaos, accelerando(3)
1:24.375 default Q chaos_bolt Fluffy_Pillow 301569.8/1100000: 27% mana | 4.0/5: 80% soul_shard lord_of_flames, embrace_chaos, accelerando(3)
1:25.716 default Q chaos_bolt Fluffy_Pillow 321386.1/1100000: 29% mana | 3.0/5: 60% soul_shard lord_of_flames, embrace_chaos, accelerando(3)
1:27.061 default E immolate Fluffy_Pillow 341261.5/1100000: 31% mana | 2.0/5: 40% soul_shard lord_of_flames, embrace_chaos, accelerando(3)
1:28.182 default R incinerate Fluffy_Pillow 291826.8/1100000: 27% mana | 2.0/5: 40% soul_shard lord_of_flames, embrace_chaos, accelerando(3)
1:29.586 default R incinerate Fluffy_Pillow 246131.5/1100000: 22% mana | 2.0/5: 40% soul_shard lord_of_flames, embrace_chaos
1:31.054 default P dimensional_rift Fluffy_Pillow 200875.8/1100000: 18% mana | 4.0/5: 80% soul_shard lord_of_flames, embrace_chaos
1:32.328 default Q chaos_bolt Fluffy_Pillow 218878.8/1100000: 20% mana | 4.0/5: 80% soul_shard lord_of_flames
1:34.666 default Q chaos_bolt Fluffy_Pillow 252236.7/1100000: 23% mana | 3.0/5: 60% soul_shard lord_of_flames, embrace_chaos, accelerando(2)
1:36.030 default L service_imp Fluffy_Pillow 272099.2/1100000: 25% mana | 3.0/5: 60% soul_shard lord_of_flames, embrace_chaos, accelerando(2)
1:37.169 default R incinerate Fluffy_Pillow 288686.5/1100000: 26% mana | 2.0/5: 40% soul_shard lord_of_flames, embrace_chaos, accelerando(3)
1:38.574 default G immolate Fluffy_Pillow 243459.1/1100000: 22% mana | 2.0/5: 40% soul_shard lord_of_flames, embrace_chaos, accelerando(4)
1:39.680 default J conflagrate Fluffy_Pillow 194041.2/1100000: 18% mana | 2.0/5: 40% soul_shard lord_of_flames, embrace_chaos, accelerando(4)
1:40.784 default Q chaos_bolt Fluffy_Pillow 210593.3/1100000: 19% mana | 3.0/5: 60% soul_shard lord_of_flames, accelerando(4)
1:42.991 default K conflagrate Fluffy_Pillow 243855.9/1100000: 22% mana | 1.0/5: 20% soul_shard lord_of_flames, embrace_chaos, accelerando(5)
1:44.081 default C havoc enemy2 260432.8/1100000: 24% mana | 2.0/5: 40% soul_shard lord_of_flames, embrace_chaos, accelerando(5)
1:45.168 default Q chaos_bolt Fluffy_Pillow 188964.0/1100000: 17% mana | 3.0/5: 60% soul_shard lord_of_flames, embrace_chaos, accelerando(5)
1:46.475 default K conflagrate Fluffy_Pillow 207664.8/1100000: 19% mana | 1.0/5: 20% soul_shard lord_of_flames, embrace_chaos, accelerando
1:47.627 default K conflagrate Fluffy_Pillow 224191.7/1100000: 20% mana | 2.0/5: 40% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando
1:48.780 default Q chaos_bolt Fluffy_Pillow 240733.1/1100000: 22% mana | 3.0/5: 60% soul_shard lord_of_flames, embrace_chaos, accelerando
1:50.165 default R incinerate Fluffy_Pillow 260885.0/1100000: 24% mana | 2.0/5: 40% soul_shard lord_of_flames, embrace_chaos, accelerando(2)
1:51.590 default Q chaos_bolt Fluffy_Pillow 215635.8/1100000: 20% mana | 3.0/5: 60% soul_shard lord_of_flames, embrace_chaos, accelerando(2)
1:52.955 default K conflagrate Fluffy_Pillow 235512.8/1100000: 21% mana | 1.0/5: 20% soul_shard lord_of_flames, embrace_chaos, accelerando(2)
1:54.093 default Q chaos_bolt Fluffy_Pillow 252084.3/1100000: 23% mana | 4.0/5: 80% soul_shard lord_of_flames, embrace_chaos, accelerando(2)
1:55.457 default R incinerate Fluffy_Pillow 271948.5/1100000: 25% mana | 2.0/5: 40% soul_shard lord_of_flames, embrace_chaos, accelerando(3)
1:56.862 default R incinerate Fluffy_Pillow 226970.6/1100000: 21% mana | 2.0/5: 40% soul_shard lord_of_flames, embrace_chaos, accelerando(4)
1:58.246 default Q chaos_bolt Fluffy_Pillow 181064.9/1100000: 16% mana | 3.0/5: 60% soul_shard lord_of_flames, embrace_chaos
1:59.652 default R incinerate Fluffy_Pillow 200933.1/1100000: 18% mana | 1.0/5: 20% soul_shard lord_of_flames, embrace_chaos
2:01.121 default E immolate Fluffy_Pillow 155884.7/1100000: 14% mana | 1.0/5: 20% soul_shard lord_of_flames, embrace_chaos, accelerando
2:02.276 default R incinerate Fluffy_Pillow 106454.8/1100000: 10% mana | 1.0/5: 20% soul_shard lord_of_flames, embrace_chaos, accelerando
2:03.722 default S life_tap Fluffy_Pillow 61199.6/1100000: 6% mana | 1.0/5: 20% soul_shard lord_of_flames, accelerando
2:04.876 default C havoc enemy2 407755.3/1100000: 37% mana | 1.0/5: 20% soul_shard lord_of_flames, accelerando
2:06.030 default R incinerate Fluffy_Pillow 336311.0/1100000: 31% mana | 1.0/5: 20% soul_shard lord_of_flames, accelerando
2:07.474 default O soul_harvest Fluffy_Pillow 291027.1/1100000: 26% mana | 1.0/5: 20% soul_shard lord_of_flames, accelerando
2:07.474 default I potion Fluffy_Pillow 291027.1/1100000: 26% mana | 1.0/5: 20% soul_shard soul_harvest, lord_of_flames, accelerando
2:07.474 default R incinerate Fluffy_Pillow 291027.1/1100000: 26% mana | 1.0/5: 20% soul_shard soul_harvest, lord_of_flames, accelerando, potion_of_deadly_grace
2:08.919 default R incinerate Fluffy_Pillow 245757.5/1100000: 22% mana | 1.0/5: 20% soul_shard soul_harvest, lord_of_flames, accelerando, potion_of_deadly_grace
2:10.364 default R incinerate Fluffy_Pillow 200488.9/1100000: 18% mana | 1.0/5: 20% soul_shard soul_harvest, lord_of_flames, accelerando(2), potion_of_deadly_grace
2:11.789 default G immolate Fluffy_Pillow 155239.7/1100000: 14% mana | 1.0/5: 20% soul_shard soul_harvest, lord_of_flames, accelerando(2), potion_of_deadly_grace
2:12.926 default J conflagrate Fluffy_Pillow 105494.1/1100000: 10% mana | 1.0/5: 20% soul_shard soul_harvest, lord_of_flames, potion_of_deadly_grace
2:14.098 default Q chaos_bolt Fluffy_Pillow 122055.7/1100000: 11% mana | 3.0/5: 60% soul_shard soul_harvest, lord_of_flames, conflagration_of_chaos, potion_of_deadly_grace
2:16.437 default K conflagrate Fluffy_Pillow 155108.2/1100000: 14% mana | 2.0/5: 40% soul_shard soul_harvest, lord_of_flames, conflagration_of_chaos, embrace_chaos, potion_of_deadly_grace
2:17.608 default P dimensional_rift Fluffy_Pillow 171655.6/1100000: 16% mana | 3.0/5: 60% soul_shard soul_harvest, lord_of_flames, conflagration_of_chaos, embrace_chaos, potion_of_deadly_grace
2:18.780 default Q chaos_bolt Fluffy_Pillow 188217.2/1100000: 17% mana | 3.0/5: 60% soul_shard soul_harvest, lord_of_flames, conflagration_of_chaos, embrace_chaos, potion_of_deadly_grace
2:20.187 default K conflagrate Fluffy_Pillow 208099.6/1100000: 19% mana | 1.0/5: 20% soul_shard soul_harvest, lord_of_flames, conflagration_of_chaos, embrace_chaos, potion_of_deadly_grace
2:21.359 default K conflagrate Fluffy_Pillow 224661.2/1100000: 20% mana | 2.0/5: 40% soul_shard soul_harvest, lord_of_flames, conflagration_of_chaos, embrace_chaos, potion_of_deadly_grace
2:22.530 default Q chaos_bolt Fluffy_Pillow 241208.6/1100000: 22% mana | 3.0/5: 60% soul_shard soul_harvest, lord_of_flames, embrace_chaos, potion_of_deadly_grace
2:23.935 default Q chaos_bolt Fluffy_Pillow 261463.1/1100000: 24% mana | 3.0/5: 60% soul_shard soul_harvest, lord_of_flames, embrace_chaos, accelerando(2), potion_of_deadly_grace
2:25.299 default C havoc enemy2 281326.7/1100000: 26% mana | 1.0/5: 20% soul_shard soul_harvest, lord_of_flames, embrace_chaos, accelerando(3), potion_of_deadly_grace
2:26.419 default R incinerate Fluffy_Pillow 209877.2/1100000: 19% mana | 2.0/5: 40% soul_shard soul_harvest, lord_of_flames, embrace_chaos, accelerando(3), potion_of_deadly_grace
2:27.823 default K conflagrate Fluffy_Pillow 164924.6/1100000: 15% mana | 2.0/5: 40% soul_shard lord_of_flames, embrace_chaos, accelerando(4), potion_of_deadly_grace
2:28.929 default Q chaos_bolt Fluffy_Pillow 181506.7/1100000: 17% mana | 3.0/5: 60% soul_shard lord_of_flames, embrace_chaos, accelerando(4), potion_of_deadly_grace
2:30.254 default R incinerate Fluffy_Pillow 201413.2/1100000: 18% mana | 2.0/5: 40% soul_shard lord_of_flames, embrace_chaos, accelerando(5), potion_of_deadly_grace
2:31.614 default R incinerate Fluffy_Pillow 156096.2/1100000: 14% mana | 2.0/5: 40% soul_shard lord_of_flames, embrace_chaos, accelerando(5), potion_of_deadly_grace
2:32.977 default Q chaos_bolt Fluffy_Pillow 110825.0/1100000: 10% mana | 3.0/5: 60% soul_shard lord_of_flames, embrace_chaos, accelerando(5), potion_of_deadly_grace
2:34.283 default E immolate Fluffy_Pillow 130686.8/1100000: 12% mana | 1.0/5: 20% soul_shard lord_of_flames, embrace_chaos, accelerando(5), potion_of_deadly_grace
2:35.372 default R incinerate Fluffy_Pillow 80504.2/1100000: 7% mana | 2.0/5: 40% soul_shard lord_of_flames, embrace_chaos, potion_of_deadly_grace
2:36.839 default S life_tap Fluffy_Pillow 35234.5/1100000: 3% mana | 2.0/5: 40% soul_shard lord_of_flames, embrace_chaos, potion_of_deadly_grace
2:38.012 default Q chaos_bolt Fluffy_Pillow 381810.2/1100000: 35% mana | 2.0/5: 40% soul_shard lord_of_flames, embrace_chaos
2:39.417 default R incinerate Fluffy_Pillow 401664.3/1100000: 37% mana | 1.0/5: 20% soul_shard lord_of_flames, embrace_chaos, nefarious_pact
2:40.435 default R incinerate Fluffy_Pillow 350084.3/1100000: 32% mana | 2.0/5: 40% soul_shard lord_of_flames, embrace_chaos, nefarious_pact, accelerando
2:41.436 default R incinerate Fluffy_Pillow 298445.0/1100000: 27% mana | 2.0/5: 40% soul_shard lord_of_flames, embrace_chaos, nefarious_pact, accelerando
2:42.439 default R incinerate Fluffy_Pillow 246834.4/1100000: 22% mana | 2.0/5: 40% soul_shard lord_of_flames, embrace_chaos, nefarious_pact, accelerando
2:43.442 default Q chaos_bolt Fluffy_Pillow 195223.8/1100000: 18% mana | 2.0/5: 40% soul_shard lord_of_flames, nefarious_pact, accelerando
2:45.040 default R incinerate Fluffy_Pillow 218149.3/1100000: 20% mana | 0.0/5: 0% soul_shard lord_of_flames, embrace_chaos, nefarious_pact, accelerando
2:46.042 default C havoc enemy2 166582.7/1100000: 15% mana | 0.0/5: 0% soul_shard lord_of_flames, embrace_chaos, nefarious_pact, accelerando(2)
2:46.832 default G immolate Fluffy_Pillow 90086.7/1100000: 8% mana | 0.0/5: 0% soul_shard lord_of_flames, embrace_chaos, nefarious_pact, accelerando(2)
2:47.622 default J conflagrate Fluffy_Pillow 35590.6/1100000: 3% mana | 1.0/5: 20% soul_shard lord_of_flames, embrace_chaos, nefarious_pact, accelerando(2)
2:48.411 default Q chaos_bolt Fluffy_Pillow 47080.0/1100000: 4% mana | 3.0/5: 60% soul_shard lord_of_flames, embrace_chaos, nefarious_pact, accelerando(2)
2:49.357 default K conflagrate Fluffy_Pillow 60946.7/1100000: 6% mana | 2.0/5: 40% soul_shard lord_of_flames, embrace_chaos, nefarious_pact, accelerando(3)
2:50.134 default Q chaos_bolt Fluffy_Pillow 72428.6/1100000: 7% mana | 3.0/5: 60% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, nefarious_pact, accelerando(3)
2:51.066 default K conflagrate Fluffy_Pillow 86201.9/1100000: 8% mana | 1.0/5: 20% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, devils_due, accelerando(4)
2:52.368 default R incinerate Fluffy_Pillow 105641.5/1100000: 10% mana | 2.0/5: 40% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, devils_due
2:54.099 default Q chaos_bolt Fluffy_Pillow 64218.0/1100000: 6% mana | 2.0/5: 40% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, devils_due, accelerando
2:55.728 default K conflagrate Fluffy_Pillow 87588.2/1100000: 8% mana | 0.0/5: 0% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, devils_due, accelerando
2:57.088 default R incinerate Fluffy_Pillow 107099.2/1100000: 10% mana | 1.0/5: 20% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, devils_due, accelerando
2:58.790 default Q chaos_bolt Fluffy_Pillow 65827.2/1100000: 6% mana | 2.0/5: 40% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(3)
3:00.133 default R incinerate Fluffy_Pillow 85687.9/1100000: 8% mana | 2.0/5: 40% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(4)
3:01.517 default K conflagrate Fluffy_Pillow 40439.1/1100000: 4% mana | 2.0/5: 40% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(5)
3:02.606 default P dimensional_rift Fluffy_Pillow 57000.8/1100000: 5% mana | 3.0/5: 60% soul_shard lord_of_flames, embrace_chaos, accelerando(5)
3:03.695 default H berserking Fluffy_Pillow 73562.5/1100000: 7% mana | 3.0/5: 60% soul_shard lord_of_flames, embrace_chaos, accelerando(5)
3:03.806 default Q chaos_bolt Fluffy_Pillow 75250.6/1100000: 7% mana | 4.0/5: 80% soul_shard berserking, lord_of_flames, embrace_chaos, accelerando(5)
3:04.942 default Q chaos_bolt Fluffy_Pillow 95118.5/1100000: 9% mana | 4.0/5: 80% soul_shard berserking, lord_of_flames, embrace_chaos, accelerando(5)
3:06.077 default C havoc enemy2 114331.0/1100000: 10% mana | 4.0/5: 80% soul_shard berserking, lord_of_flames, embrace_chaos
3:07.095 default L service_imp Fluffy_Pillow 42874.2/1100000: 4% mana | 4.0/5: 80% soul_shard berserking, lord_of_flames, embrace_chaos
3:08.114 default Q chaos_bolt Fluffy_Pillow 59601.3/1100000: 5% mana | 3.0/5: 60% soul_shard berserking, lord_of_flames, embrace_chaos, accelerando
3:09.318 default E immolate Fluffy_Pillow 79465.3/1100000: 7% mana | 2.0/5: 40% soul_shard berserking, lord_of_flames, embrace_chaos, accelerando
3:10.323 default S life_tap Fluffy_Pillow 30133.3/1100000: 3% mana | 2.0/5: 40% soul_shard berserking, lord_of_flames, embrace_chaos, accelerando(2)
3:11.312 default Q chaos_bolt Fluffy_Pillow 376695.4/1100000: 34% mana | 3.0/5: 60% soul_shard berserking, lord_of_flames, embrace_chaos, accelerando(2)
3:12.499 default R incinerate Fluffy_Pillow 396573.1/1100000: 36% mana | 1.0/5: 20% soul_shard berserking, lord_of_flames, embrace_chaos, accelerando(2)
3:13.737 default R incinerate Fluffy_Pillow 351305.0/1100000: 32% mana | 1.0/5: 20% soul_shard berserking, lord_of_flames, embrace_chaos, accelerando(2)
3:14.975 default Q chaos_bolt Fluffy_Pillow 303624.0/1100000: 28% mana | 3.0/5: 60% soul_shard lord_of_flames, embrace_chaos, accelerando(3)
3:16.318 default R incinerate Fluffy_Pillow 323470.7/1100000: 29% mana | 1.0/5: 20% soul_shard lord_of_flames, embrace_chaos, accelerando(4)
3:17.701 default G immolate Fluffy_Pillow 278315.8/1100000: 25% mana | 1.0/5: 20% soul_shard lord_of_flames, embrace_chaos, accelerando(5)
3:18.789 default J conflagrate Fluffy_Pillow 228862.3/1100000: 21% mana | 1.0/5: 20% soul_shard lord_of_flames, embrace_chaos, accelerando(5)
3:19.876 default K conflagrate Fluffy_Pillow 244920.7/1100000: 22% mana | 2.0/5: 40% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos
3:21.047 default Q chaos_bolt Fluffy_Pillow 261468.2/1100000: 24% mana | 3.0/5: 60% soul_shard lord_of_flames
3:23.386 default K conflagrate Fluffy_Pillow 294520.7/1100000: 27% mana | 2.0/5: 40% soul_shard lord_of_flames, embrace_chaos
3:24.557 default Q chaos_bolt Fluffy_Pillow 311068.1/1100000: 28% mana | 3.0/5: 60% soul_shard lord_of_flames, embrace_chaos
3:25.964 default K conflagrate Fluffy_Pillow 330950.5/1100000: 30% mana | 2.0/5: 40% soul_shard lord_of_flames, embrace_chaos
3:27.200 default C havoc enemy2 348416.5/1100000: 32% mana | 3.0/5: 60% soul_shard lord_of_flames, embrace_chaos
3:28.371 default Q chaos_bolt Fluffy_Pillow 277216.0/1100000: 25% mana | 4.0/5: 80% soul_shard lord_of_flames, embrace_chaos, accelerando
3:29.754 default Q chaos_bolt Fluffy_Pillow 297057.0/1100000: 27% mana | 3.0/5: 60% soul_shard lord_of_flames, embrace_chaos, accelerando
3:31.139 default Q chaos_bolt Fluffy_Pillow 316926.7/1100000: 29% mana | 3.0/5: 60% soul_shard lord_of_flames, embrace_chaos, accelerando
3:32.523 default R incinerate Fluffy_Pillow 336840.7/1100000: 31% mana | 1.0/5: 20% soul_shard lord_of_flames, embrace_chaos, accelerando(2)
3:33.946 default K conflagrate Fluffy_Pillow 291562.4/1100000: 27% mana | 1.0/5: 20% soul_shard lord_of_flames, embrace_chaos, accelerando(2)
3:35.084 default R incinerate Fluffy_Pillow 308133.9/1100000: 28% mana | 2.0/5: 40% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(2)
3:36.509 default Q chaos_bolt Fluffy_Pillow 263117.8/1100000: 24% mana | 2.0/5: 40% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(4)
3:37.834 default R incinerate Fluffy_Pillow 282983.4/1100000: 26% mana | 1.0/5: 20% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(4)
3:39.218 default R incinerate Fluffy_Pillow 237717.9/1100000: 22% mana | 1.0/5: 20% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos
3:40.684 default E immolate Fluffy_Pillow 192434.1/1100000: 17% mana | 1.0/5: 20% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos
3:41.854 default Q chaos_bolt Fluffy_Pillow 142967.4/1100000: 13% mana | 2.0/5: 40% soul_shard lord_of_flames, conflagration_of_chaos
3:44.193 default R incinerate Fluffy_Pillow 176019.9/1100000: 16% mana | 1.0/5: 20% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos
3:45.660 default R incinerate Fluffy_Pillow 130750.1/1100000: 12% mana | 1.0/5: 20% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos
3:47.128 default P dimensional_rift Fluffy_Pillow 85589.0/1100000: 8% mana | 1.0/5: 20% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando
3:48.281 default C havoc enemy2 102130.3/1100000: 9% mana | 1.0/5: 20% soul_shard lord_of_flames, conflagration_of_chaos, accelerando
3:49.436 default N summon_doomguard Fluffy_Pillow 30700.4/1100000: 3% mana | 1.0/5: 20% soul_shard lord_of_flames, conflagration_of_chaos, accelerando
3:50.590 default S life_tap Fluffy_Pillow 47256.0/1100000: 4% mana | 0.0/5: 0% soul_shard lord_of_flames, conflagration_of_chaos, accelerando
3:51.744 default G immolate Fluffy_Pillow 393874.0/1100000: 36% mana | 0.0/5: 0% soul_shard lord_of_flames, conflagration_of_chaos, accelerando(2)
3:52.881 default J conflagrate Fluffy_Pillow 344431.0/1100000: 31% mana | 0.0/5: 0% soul_shard lord_of_flames, conflagration_of_chaos, accelerando(2)
3:54.019 default Q chaos_bolt Fluffy_Pillow 361002.5/1100000: 33% mana | 3.0/5: 60% soul_shard lord_of_flames, conflagration_of_chaos, accelerando(2)
3:56.290 default K conflagrate Fluffy_Pillow 394072.6/1100000: 36% mana | 1.0/5: 20% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(2)
3:57.428 default K conflagrate Fluffy_Pillow 410644.1/1100000: 37% mana | 2.0/5: 40% soul_shard lord_of_flames, embrace_chaos, accelerando(2)
3:58.568 default Q chaos_bolt Fluffy_Pillow 427244.8/1100000: 39% mana | 4.0/5: 80% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(2)
3:59.931 default R incinerate Fluffy_Pillow 446558.4/1100000: 41% mana | 2.0/5: 40% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando
4:01.377 default Q chaos_bolt Fluffy_Pillow 401303.2/1100000: 36% mana | 3.0/5: 60% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando
4:02.761 default K conflagrate Fluffy_Pillow 421158.5/1100000: 38% mana | 1.0/5: 20% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando
4:03.916 default R incinerate Fluffy_Pillow 437728.6/1100000: 40% mana | 2.0/5: 40% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando
4:05.364 default R incinerate Fluffy_Pillow 392554.9/1100000: 36% mana | 2.0/5: 40% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(2)
4:06.790 default Q chaos_bolt Fluffy_Pillow 347320.2/1100000: 32% mana | 2.0/5: 40% soul_shard lord_of_flames, conflagration_of_chaos, accelerando(2)
4:09.062 default C havoc enemy2 380406.3/1100000: 35% mana | 0.0/5: 0% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(3)
4:10.183 default K conflagrate Fluffy_Pillow 308971.6/1100000: 28% mana | 0.0/5: 0% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(3)
4:11.304 default O soul_harvest Fluffy_Pillow 325536.9/1100000: 30% mana | 1.0/5: 20% soul_shard lord_of_flames, embrace_chaos, accelerando(3)
4:11.304 default R incinerate Fluffy_Pillow 325536.9/1100000: 30% mana | 1.0/5: 20% soul_shard soul_harvest, lord_of_flames, embrace_chaos, accelerando(3)
4:12.708 default R incinerate Fluffy_Pillow 279781.4/1100000: 25% mana | 1.0/5: 20% soul_shard soul_harvest, lord_of_flames, embrace_chaos
4:14.176 default E immolate Fluffy_Pillow 234538.0/1100000: 21% mana | 3.0/5: 60% soul_shard soul_harvest, lord_of_flames, accelerando
4:15.330 default Q chaos_bolt Fluffy_Pillow 185093.7/1100000: 17% mana | 3.0/5: 60% soul_shard soul_harvest, lord_of_flames, accelerando
4:17.635 default R incinerate Fluffy_Pillow 218162.0/1100000: 20% mana | 1.0/5: 20% soul_shard soul_harvest, lord_of_flames, embrace_chaos, accelerando
4:19.082 default R incinerate Fluffy_Pillow 172921.2/1100000: 16% mana | 1.0/5: 20% soul_shard soul_harvest, lord_of_flames, embrace_chaos, accelerando
4:20.528 default R incinerate Fluffy_Pillow 127666.0/1100000: 12% mana | 1.0/5: 20% soul_shard soul_harvest, lord_of_flames, embrace_chaos, nefarious_pact, accelerando
4:21.530 default Q chaos_bolt Fluffy_Pillow 76041.0/1100000: 7% mana | 3.0/5: 60% soul_shard soul_harvest, lord_of_flames, embrace_chaos, nefarious_pact, accelerando
4:22.490 default R incinerate Fluffy_Pillow 89817.9/1100000: 8% mana | 1.0/5: 20% soul_shard soul_harvest, lord_of_flames, embrace_chaos, nefarious_pact, accelerando(2)
4:23.477 default S life_tap Fluffy_Pillow 38190.5/1100000: 3% mana | 1.0/5: 20% soul_shard soul_harvest, lord_of_flames, embrace_chaos, nefarious_pact, accelerando(2)
4:24.266 default R incinerate Fluffy_Pillow 379679.9/1100000: 35% mana | 2.0/5: 40% soul_shard soul_harvest, lord_of_flames, embrace_chaos, nefarious_pact, accelerando(2)
4:25.255 default R incinerate Fluffy_Pillow 328081.6/1100000: 30% mana | 2.0/5: 40% soul_shard soul_harvest, lord_of_flames, embrace_chaos, nefarious_pact, accelerando(2)
4:26.243 default Q chaos_bolt Fluffy_Pillow 276415.4/1100000: 25% mana | 3.0/5: 60% soul_shard soul_harvest, lord_of_flames, embrace_chaos, nefarious_pact
4:27.219 default G immolate Fluffy_Pillow 290207.3/1100000: 26% mana | 3.0/5: 60% soul_shard soul_harvest, lord_of_flames, embrace_chaos, nefarious_pact
4:28.032 default J conflagrate Fluffy_Pillow 235696.9/1100000: 21% mana | 3.0/5: 60% soul_shard soul_harvest, lord_of_flames, embrace_chaos, nefarious_pact, accelerando
4:28.834 default Q chaos_bolt Fluffy_Pillow 247210.7/1100000: 22% mana | 4.0/5: 80% soul_shard soul_harvest, lord_of_flames, embrace_chaos, nefarious_pact, accelerando(2)
4:29.780 default C havoc enemy2 260986.3/1100000: 24% mana | 3.0/5: 60% soul_shard soul_harvest, lord_of_flames, embrace_chaos, nefarious_pact, accelerando(2)
4:30.569 default Q chaos_bolt Fluffy_Pillow 184475.6/1100000: 17% mana | 3.0/5: 60% soul_shard lord_of_flames, embrace_chaos, nefarious_pact, accelerando(2)
4:31.518 default J conflagrate Fluffy_Pillow 198296.4/1100000: 18% mana | 1.0/5: 20% soul_shard lord_of_flames, embrace_chaos, nefarious_pact, accelerando(3)
4:32.296 default J conflagrate Fluffy_Pillow 209793.1/1100000: 19% mana | 2.0/5: 40% soul_shard lord_of_flames, embrace_chaos, devils_due, accelerando(3)
4:33.616 default P dimensional_rift Fluffy_Pillow 229583.7/1100000: 21% mana | 4.0/5: 80% soul_shard lord_of_flames, embrace_chaos, devils_due, accelerando(4)
4:34.916 default J conflagrate Fluffy_Pillow 249074.4/1100000: 23% mana | 4.0/5: 80% soul_shard lord_of_flames, embrace_chaos, devils_due, accelerando(4)
4:36.222 default Q chaos_bolt Fluffy_Pillow 268934.8/1100000: 24% mana | 5.0/5: 100% soul_shard lord_of_flames, devils_due, accelerando(5)
4:38.782 default L service_imp Fluffy_Pillow 307867.7/1100000: 28% mana | 3.0/5: 60% soul_shard lord_of_flames, embrace_chaos, devils_due, accelerando(5)
4:40.065 default R incinerate Fluffy_Pillow 327338.8/1100000: 30% mana | 2.0/5: 40% soul_shard lord_of_flames, embrace_chaos, devils_due
4:41.793 default J conflagrate Fluffy_Pillow 285882.3/1100000: 26% mana | 3.0/5: 60% soul_shard lord_of_flames, embrace_chaos, nefarious_pact, accelerando
4:42.593 default Q chaos_bolt Fluffy_Pillow 297359.4/1100000: 27% mana | 4.0/5: 80% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, nefarious_pact, accelerando
4:43.554 default Q chaos_bolt Fluffy_Pillow 311146.2/1100000: 28% mana | 3.0/5: 60% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, nefarious_pact, accelerando
4:44.514 default R incinerate Fluffy_Pillow 324918.7/1100000: 30% mana | 1.0/5: 20% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, nefarious_pact, accelerando
4:45.517 default R incinerate Fluffy_Pillow 273308.1/1100000: 25% mana | 1.0/5: 20% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, nefarious_pact, accelerando
4:46.519 default R incinerate Fluffy_Pillow 221797.0/1100000: 20% mana | 2.0/5: 40% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, nefarious_pact, accelerando(2)
4:47.507 default R incinerate Fluffy_Pillow 170184.2/1100000: 15% mana | 2.0/5: 40% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, nefarious_pact, accelerando(2)
4:48.496 default J conflagrate Fluffy_Pillow 118586.0/1100000: 11% mana | 2.0/5: 40% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, nefarious_pact, accelerando(2)
4:49.285 default Q chaos_bolt Fluffy_Pillow 130075.3/1100000: 12% mana | 3.0/5: 60% soul_shard lord_of_flames, conflagration_of_chaos, nefarious_pact, accelerando(2)
4:50.860 default C havoc enemy2 153010.4/1100000: 14% mana | 3.0/5: 60% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, nefarious_pact, accelerando(2)
4:51.650 default E immolate Fluffy_Pillow 76514.3/1100000: 7% mana | 4.0/5: 80% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, nefarious_pact, accelerando(2)
4:52.441 default Q chaos_bolt Fluffy_Pillow 22032.8/1100000: 2% mana | 4.0/5: 80% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, nefarious_pact, accelerando(2)
4:53.388 default S life_tap Fluffy_Pillow 35747.2/1100000: 3% mana | 2.0/5: 40% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, devils_due
4:54.767 default R incinerate Fluffy_Pillow 385233.9/1100000: 35% mana | 2.0/5: 40% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, devils_due
4:56.492 default J conflagrate Fluffy_Pillow 343610.1/1100000: 31% mana | 2.0/5: 40% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, devils_due, accelerando

Stats

Raid-Buffed Unbuffed Gear Amount
Strength 4201 3876 0
Agility 7254 6929 0
Stamina 54709 54709 34192
Intellect 50353 48647 39007 (1278)
Spirit 1 1 0
Health 3282540 3282540 0
Mana 1100000 1100000 0
Soul Shard 5 5 0
Spell Power 50353 48647 0
Crit 15.68% 15.68% 4271
Haste 28.46% 27.46% 10299
Damage / Heal Versatility 5.36% 5.36% 2544
ManaReg per Second 14131 14021 0
Mastery 69.03% 69.03% 6003
Armor 1975 1975 1975
Run Speed 7 0 0

Gear

Source Slot Average Item Level: 906.00
Local Head Eyes of Azj'Aqir
ilevel: 900, stats: { 253 Armor, +3255 Sta, +2170 Int, +1074 Haste, +578 Vers }
Local Neck Radiant String of Scorpid Eyes
ilevel: 900, stats: { +1831 Sta, +2011 Haste, +922 Crit }, enchant: mark_of_the_hidden_satyr
Local Shoulders Pauldrons of Azj'Aqir
ilevel: 900, stats: { 233 Armor, +2442 Sta, +1628 Int, +752 Mastery, +487 Vers }
Local Chest Robes of Fluctuating Energy
ilevel: 900, stats: { 311 Armor, +3255 Sta, +2170 Int, +1145 Haste, +507 Mastery }
Local Waist Man'ari Skullbuckled Cinch
ilevel: 900, stats: { 175 Armor, +2442 Sta, +1628 Int, +699 Haste, +540 Mastery }
Local Legs Leggings of Azj'Aqir
ilevel: 900, stats: { 272 Armor, +3255 Sta, +2170 Int, +932 Crit, +720 Haste }
Local Feet Outcast Wanderer's Footrags
ilevel: 910, stats: { 222 Armor, +2680 Sta, +1786 Int, +864 Crit, +422 Mastery }
Local Wrists Magistrike Restraints
ilevel: 940, stats: { 157 Armor, +2658 Sta, +1772 Int, +694 Crit, +385 Mastery }
Local Hands Clutch of Azj'Aqir
ilevel: 900, stats: { 194 Armor, +2442 Sta, +1628 Int, +859 Crit, +380 Mastery }
Local Finger1 Ring of the Scoured Clan
ilevel: 900, stats: { +1831 Sta, +2095 Mastery, +838 Haste }, enchant: { +200 Haste }
Local Finger2 Ring of Braided Stems
ilevel: 905, stats: { +1918 Sta, +1814 Haste, +1209 Vers }, enchant: { +200 Haste }
Local Trinket1 Whispers in the Dark
ilevel: 905, stats: { +2162 Int }
Local Trinket2 Erratic Metronome
ilevel: 900, stats: { +2063 Int }
Local Back Astromancer's Greatcloak
ilevel: 905, stats: { 158 Armor, +1918 Sta, +1278 StrAgiInt, +676 Haste, +270 Vers }, enchant: { +200 Int }
Local Main Hand Scepter of Sargeras
ilevel: 929, weapon: { 7005 - 10509, 3.6 }, stats: { +2843 Int, +4265 Sta, +922 Haste, +922 Mastery, +15509 Int }, relics: { +61 ilevels, +59 ilevels, +61 ilevels }

Talents

Level
15 Backdraft (Destruction Warlock) Roaring Blaze (Destruction Warlock) Shadowburn (Destruction Warlock)
30 Reverse Entropy (Destruction Warlock) Eradication (Destruction Warlock) Empowered Life Tap
45 Demonic Circle Mortal Coil Shadowfury
60 Cataclysm (Destruction Warlock) Fire and Brimstone (Destruction Warlock) Soul Harvest
75 Demon Skin Burning Rush Dark Pact
90 Grimoire of Supremacy Grimoire of Service Grimoire of Sacrifice
100 Wreak Havoc (Destruction Warlock) Channel Demonfire (Destruction Warlock) Soul Conduit

Profile

warlock="Magistrike"
level=110
race=troll
role=spell
position=back
talents=2203021
artifact=38:0:0:0:0:803:1:804:3:805:3:806:3:807:3:808:3:809:3:810:3:811:3:812:3:813:1:814:1:815:1:816:1:817:1:818:1:1355:1:1392:1:1609:4:1610:1:1611:1:1713:1
spec=destruction

# This default action priority list is automatically created based on your character.
# It is a attempt to provide you with a action list that is both simple and practicable,
# while resulting in a meaningful and good simulation. It may not result in the absolutely highest possible dps.
# Feel free to edit, adapt and improve it to your own needs.
# SimulationCraft is always looking for updates and improvements to the default action lists.

# Executed before combat begins. Accepts non-harmful actions only.
actions.precombat=flask,type=whispered_pact
actions.precombat+=/food,type=azshari_salad
actions.precombat+=/summon_pet,if=!talent.grimoire_of_supremacy.enabled&(!talent.grimoire_of_sacrifice.enabled|buff.demonic_power.down)
actions.precombat+=/summon_infernal,if=talent.grimoire_of_supremacy.enabled&artifact.lord_of_flames.rank>0
actions.precombat+=/summon_infernal,if=talent.grimoire_of_supremacy.enabled&active_enemies>1
actions.precombat+=/summon_doomguard,if=talent.grimoire_of_supremacy.enabled&active_enemies=1&artifact.lord_of_flames.rank=0
actions.precombat+=/augmentation,type=defiled
actions.precombat+=/snapshot_stats
actions.precombat+=/grimoire_of_sacrifice,if=talent.grimoire_of_sacrifice.enabled
actions.precombat+=/life_tap,if=talent.empowered_life_tap.enabled&!buff.empowered_life_tap.remains
actions.precombat+=/potion,name=prolonged_power
actions.precombat+=/chaos_bolt

# Executed every time the actor is available.
actions=havoc,target=2,if=active_enemies>1&(active_enemies<4|talent.wreak_havoc.enabled&active_enemies<6)&!debuff.havoc.remains
actions+=/dimensional_rift,if=charges=3
actions+=/immolate,if=remains<=tick_time
actions+=/immolate,cycle_targets=1,if=active_enemies>1&remains<=tick_time&(!talent.roaring_blaze.enabled|(!debuff.roaring_blaze.remains&action.conflagrate.charges<2+set_bonus.tier19_4pc))
actions+=/immolate,if=talent.roaring_blaze.enabled&remains<=duration&!debuff.roaring_blaze.remains&target.time_to_die>10&(action.conflagrate.charges=2+set_bonus.tier19_4pc|(action.conflagrate.charges>=1+set_bonus.tier19_4pc&action.conflagrate.recharge_time<cast_time+gcd)|target.time_to_die<24)
actions+=/berserking
actions+=/blood_fury
actions+=/arcane_torrent
actions+=/potion,name=deadly_grace,if=(buff.soul_harvest.remains|trinket.proc.any.react|target.time_to_die<=45)
actions+=/shadowburn,if=buff.conflagration_of_chaos.remains<=action.chaos_bolt.cast_time
actions+=/shadowburn,if=(charges=1+set_bonus.tier19_4pc&recharge_time<action.chaos_bolt.cast_time|charges=2+set_bonus.tier19_4pc)&soul_shard<5
actions+=/conflagrate,if=talent.roaring_blaze.enabled&(charges=2+set_bonus.tier19_4pc|(charges>=1+set_bonus.tier19_4pc&recharge_time<gcd)|target.time_to_die<24)
actions+=/conflagrate,if=talent.roaring_blaze.enabled&debuff.roaring_blaze.stack>0&dot.immolate.remains>dot.immolate.duration*0.3&(active_enemies=1|soul_shard<3)&soul_shard<5
actions+=/conflagrate,if=!talent.roaring_blaze.enabled&buff.backdraft.stack<3&buff.conflagration_of_chaos.remains<=action.chaos_bolt.cast_time
actions+=/conflagrate,if=!talent.roaring_blaze.enabled&buff.backdraft.stack<3&(charges=1+set_bonus.tier19_4pc&recharge_time<action.chaos_bolt.cast_time|charges=2+set_bonus.tier19_4pc)&soul_shard<5
actions+=/life_tap,if=talent.empowered_life_tap.enabled&buff.empowered_life_tap.remains<=gcd
actions+=/dimensional_rift,if=equipped.144369&!buff.lessons_of_spacetime.remains&((!talent.grimoire_of_supremacy.enabled&!cooldown.summon_doomguard.remains)|(talent.grimoire_of_service.enabled&!cooldown.service_pet.remains)|(talent.soul_harvest.enabled&!cooldown.soul_harvest.remains))
actions+=/service_pet
actions+=/summon_infernal,if=artifact.lord_of_flames.rank>0&!buff.lord_of_flames.remains
actions+=/summon_doomguard,if=!talent.grimoire_of_supremacy.enabled&spell_targets.infernal_awakening<=2&(target.time_to_die>180|target.health.pct<=20|target.time_to_die<30)
actions+=/summon_infernal,if=!talent.grimoire_of_supremacy.enabled&spell_targets.infernal_awakening>2
actions+=/summon_doomguard,if=talent.grimoire_of_supremacy.enabled&spell_targets.summon_infernal=1&artifact.lord_of_flames.rank>0&buff.lord_of_flames.remains&!pet.doomguard.active
actions+=/summon_doomguard,if=talent.grimoire_of_supremacy.enabled&spell_targets.summon_infernal=1&equipped.132379&!cooldown.sindorei_spite_icd.remains
actions+=/summon_infernal,if=talent.grimoire_of_supremacy.enabled&spell_targets.summon_infernal>1&equipped.132379&!cooldown.sindorei_spite_icd.remains
actions+=/soul_harvest
actions+=/channel_demonfire,if=dot.immolate.remains>cast_time
actions+=/havoc,if=active_enemies=1&talent.wreak_havoc.enabled&equipped.132375&!debuff.havoc.remains
actions+=/rain_of_fire,if=active_enemies>=3&cooldown.havoc.remains<=12&!talent.wreak_havoc.enabled
actions+=/rain_of_fire,if=active_enemies>=6&talent.wreak_havoc.enabled
actions+=/dimensional_rift,if=!equipped.144369|charges>1|((!talent.grimoire_of_service.enabled|recharge_time<cooldown.service_pet.remains)&(!talent.soul_harvest.enabled|recharge_time<cooldown.soul_harvest.remains)&(!talent.grimoire_of_supremacy.enabled|recharge_time<cooldown.summon_doomguard.remains))
actions+=/life_tap,if=talent.empowered_life_tap.enabled&buff.empowered_life_tap.remains<duration*0.3
actions+=/cataclysm
actions+=/chaos_bolt,if=(cooldown.havoc.remains>12&cooldown.havoc.remains|active_enemies<3|talent.wreak_havoc.enabled&active_enemies<6)&(set_bonus.tier19_4pc=0|!talent.eradication.enabled|buff.embrace_chaos.remains<=cast_time|soul_shard>=3)
actions+=/shadowburn
actions+=/conflagrate,if=!talent.roaring_blaze.enabled&buff.backdraft.stack<3
actions+=/immolate,if=!talent.roaring_blaze.enabled&remains<=duration*0.3
actions+=/incinerate
actions+=/life_tap

head=eyes_of_azjaqir,id=138314,bonus_id=3445
neck=radiant_string_of_scorpid_eyes,id=140898,bonus_id=3445,enchant_id=5439
shoulders=pauldrons_of_azjaqir,id=138323,bonus_id=3445
back=astromancers_greatcloak,id=140909,bonus_id=3518,enchant_id=5436
chest=robes_of_fluctuating_energy,id=140848,bonus_id=3445
wrists=magistrike_restraints,id=132407,ilevel=940
hands=clutch_of_azjaqir,id=138311,bonus_id=3445
waist=manari_skullbuckled_cinch,id=140887,bonus_id=3445
legs=leggings_of_azjaqir,id=138317,bonus_id=3445
feet=outcast_wanderers_footrags,id=140914,bonus_id=3519
finger1=ring_of_the_scoured_clan,id=140897,bonus_id=3445,enchant=binding_of_haste
finger2=ring_of_braided_stems,id=140896,bonus_id=3518,enchant=binding_of_haste
trinket1=whispers_in_the_dark,id=140809,ilevel=905
trinket2=erratic_metronome,id=140792,ilevel=900
main_hand=scepter_of_sargeras,id=128941,ilevel=929,gem_id=140826/140837/140826,relic_id=3519/3518:3518/3519

# Gear Summary
# gear_ilvl=906.27
# gear_stamina=34192
# gear_intellect=39007
# gear_crit_rating=4271
# gear_haste_rating=10299
# gear_mastery_rating=6003
# gear_versatility_rating=2544
# gear_armor=1975
# set_bonus=tier19_2pc=1
# set_bonus=tier19_4pc=1
default_pet=imp

Meme_Build : 1083140 dps, 825420 dps to main target

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR
1083140.0 1083140.0 1015.9 / 0.094% 203762.5 / 18.8% 32.1
RPS Out RPS In Primary Resource Waiting APM Active Skill
25443.4 25443.4 Mana 0.00% 57.0 100.0% 100%
Talents
  • 15: Backdraft (Destruction Warlock)
  • 30: Eradication (Destruction Warlock)
  • 60: Soul Harvest
  • 90: Grimoire of Service
  • 100: Soul Conduit
  • Talent Calculator
Artifact

Charts

Abilities

Damage Stats DPS DPS% Execute Interval DPE DPET Type Count Hit Crit Avg Crit% Up%
Meme_Build 1083140
Chaos Bolt 420475 38.9% 94.3 3.11sec 1340628 1215178 Direct 125.7 0 1005964 1005964 100.0%  

Stats details: chaos_bolt

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 94.32 125.70 0.00 0.00 1.1032 0.0000 126446591.15 126446591.15 0.00 1215178.28 1215178.28
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
crit 125.70 100.00% 1005963.79 655599 1545301 1006386.04 946638 1065985 126446591 126446591 0.00
 
 

Action details: chaos_bolt

Static Values
  • id:116858
  • school:chromatic
  • resource:soul_shard
  • range:40.0
  • travel_speed:16.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:2.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:3.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:116858
  • name:Chaos Bolt
  • school:chromatic
  • tooltip:
  • description:Unleashes a devastating blast of chaos, causing {$s1=1} Chaos damage. Chaos Bolt always critically strikes and your critical strike chance increases its damage.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:4.000000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
Conflagrate 119603 11.1% 48.9 6.15sec 734854 713229 Direct 69.3 305093 689417 518654 55.6%  

Stats details: conflagrate

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 48.89 69.27 0.00 0.00 1.0303 0.0000 35926052.30 35926052.30 0.00 713228.89 713228.89
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 30.78 44.43% 305092.83 200081 471594 305259.62 270774 341588 9389734 9389734 0.00
crit 38.49 55.57% 689417.18 400155 1074687 689691.50 613970 770182 26536318 26536318 0.00
 
 

Action details: conflagrate

Static Values
  • id:17962
  • school:fire
  • resource:chi
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:9.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:talent.roaring_blaze.enabled&(charges=2+set_bonus.tier19_4pc|(charges>=1+set_bonus.tier19_4pc&recharge_time<gcd)|target.time_to_die<24)
Spelldata
  • id:17962
  • name:Conflagrate
  • school:fire
  • tooltip:
  • description:Triggers an explosion on the target, dealing {$s1=1} Fire damage.{$?s196406=false}[ Reduces the cast time of Incinerate and Chaos Bolt by {$117828s1=30}% for {$117828d=10 seconds}.][] |cFFFFFFFFGenerates 1 Soul Shard.|r
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:2.265510
  • base_dd_min:1.00
  • base_dd_max:1.00
 
Cry Havoc 15040 1.4% 19.9 13.86sec 227018 0 Direct 39.8 99618 199077 113511 14.0%  

Stats details: cry_havoc

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 19.92 39.84 0.00 0.00 0.0000 0.0000 4522596.17 4522596.17 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 34.28 86.03% 99617.77 72051 151626 99646.54 89503 112434 3414769 3414769 0.00
crit 5.56 13.97% 199077.09 144102 302747 198259.66 0 287208 1107827 1107827 0.00
 
 

Action details: cry_havoc

Static Values
  • id:243011
  • school:chromatic
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:243011
  • name:Cry Havoc
  • school:chromatic
  • tooltip:
  • description:Deals {$s2=0} Chaos damage to enemies within $A2 yards.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:1.000000
  • base_dd_min:0.00
  • base_dd_max:0.00
 
Deadly Grace 6269 0.6% 14.9 2.03sec 124492 0 Direct 14.9 109378 218626 124491 13.8%  

Stats details: deadly_grace

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 14.87 14.87 0.00 0.00 0.0000 0.0000 1851337.58 1851337.58 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 12.81 86.17% 109377.85 96891 116269 109385.98 102059 116269 1401536 1401536 0.00
crit 2.06 13.83% 218625.97 193782 232539 193663.18 0 232539 449802 449802 0.00
 
 

Action details: deadly_grace

Static Values
  • id:188091
  • school:arcane
  • resource:none
  • range:40.0
  • travel_speed:25.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:188091
  • name:Deadly Grace
  • school:arcane
  • tooltip:
  • description:Deal {$s1=63339 to 95008} Arcane damage.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:63338.72
  • base_dd_max:95008.08
 
Immolate 160252 14.8% 27.9 10.81sec 1726901 1639965 Direct 34.2 158211 316390 256141 61.9%  
Periodic 294.4 82661 165304 133898 62.0% 196.4%

Stats details: immolate

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 27.90 34.20 294.44 294.44 1.0530 2.0078 48183807.25 48183807.25 0.00 77646.31 1639964.85
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 13.03 38.09% 158211.47 105162 247863 158302.69 132362 188477 2060808 2060808 0.00
crit 21.17 61.91% 316390.08 210317 495720 316544.47 269380 364766 6698029 6698029 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 111.9 38.00% 82661.32 23 129094 82696.94 76562 88467 9249233 9249233 0.00
crit 182.5 62.00% 165303.51 56 258191 165365.08 155157 177883 30175738 30175738 0.00
 
 

Action details: immolate

Static Values
  • id:348
  • school:fire
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:66000.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:1.50
  • base_crit:0.48
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:remains<=tick_time
Spelldata
  • id:348
  • name:Immolate
  • school:fire
  • tooltip:
  • description:Burns the enemy, causing {$s1=1} Fire damage immediately and an additional $157736o1 Fire damage over {$157736d=18 seconds}. |cFFFFFFFFPeriodic damage has a {$193541s1=15}% chance to generate 1 Soul Shard. Chance doubled on critical strikes.|r
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:1.332000
  • base_dd_min:1.00
  • base_dd_max:1.00
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.721500
  • base_td:0.00
  • dot_duration:18.00
  • base_tick_time:3.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
 
Incinerate 85689 7.9% 68.1 4.25sec 378636 345579 Direct 86.8 260659 521425 296814 13.9%  

Stats details: incinerate

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 68.08 86.85 0.00 0.00 1.0957 0.0000 25777799.48 25777799.48 0.00 345579.34 345579.34
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 74.81 86.13% 260659.11 169991 400670 260726.99 237051 281042 19499061 19499061 0.00
crit 12.04 13.87% 521425.46 339989 801259 521519.74 384382 666655 6278739 6278739 0.00
 
 

Action details: incinerate

Static Values
  • id:29722
  • school:fire
  • resource:mana
  • range:40.0
  • travel_speed:20.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:66000.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:1.88
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:29722
  • name:Incinerate
  • school:fire
  • tooltip:
  • description:Draws fire toward the enemy, dealing {$s2=0} Fire damage.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:2.331000
  • base_dd_min:0.00
  • base_dd_max:0.00
 
Mark of the Hidden Satyr 10298 1.0% 20.1 14.94sec 153685 0 Direct 20.1 135010 270165 153685 13.8%  

Stats details: mark_of_the_hidden_satyr

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 20.13 20.13 0.00 0.00 0.0000 0.0000 3094335.53 3094335.53 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 17.35 86.18% 135009.88 128661 162412 135040.90 128661 147751 2342717 2342717 0.00
crit 2.78 13.82% 270164.58 257323 324824 251939.96 0 324824 751619 751619 0.00
 
 

Action details: mark_of_the_hidden_satyr

Static Values
  • id:191259
  • school:fire
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:191259
  • name:Mark of the Hidden Satyr
  • school:fire
  • tooltip:
  • description:Deals fire damage.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:2.500000
  • spell_power_mod.direct:2.000000
  • base_dd_min:0.00
  • base_dd_max:0.00
 
pet - imp 49102 / 49102
Firebolt 49102 4.5% 109.5 2.75sec 134786 111486 Direct 108.6 119216 238445 135828 13.9%  

Stats details: firebolt

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 109.46 108.63 0.00 0.00 1.2090 0.0000 14754381.73 14754381.73 0.00 111485.92 111485.92
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 93.49 86.07% 119216.40 75912 143737 119255.01 116863 121733 11145607 11145607 0.00
crit 15.13 13.93% 238444.86 151823 287475 238510.79 193722 268056 3608775 3608775 0.00
 
 

Action details: firebolt

Static Values
  • id:3110
  • school:fire
  • resource:energy
  • range:40.0
  • travel_speed:16.0000
  • trigger_gcd:0.5000
  • min_gcd:0.7500
  • base_cost:40.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:1.75
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:3110
  • name:Firebolt
  • school:fire
  • tooltip:
  • description:Deals {$s1=1} Fire damage to a target.$?a231795[ Damage increased by {$231795s1=50}% if you have Immolated the target.][] |cFF777777(Right-Click to toggle)|r
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:1.000000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
pet - service_imp 141907 / 45747
Firebolt 141907 4.2% 49.8 5.48sec 275172 243357 Direct 49.5 243016 486406 276955 13.9%  

Stats details: firebolt

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 49.83 49.51 0.00 0.00 1.1308 0.0000 13710705.52 13710705.52 0.00 243356.51 243356.51
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 42.60 86.06% 243016.11 151823 287475 243241.80 235674 251246 10353212 10353212 0.00
crit 6.90 13.94% 486406.48 303647 574949 486644.60 0 574949 3357493 3357493 0.00
 
 

Action details: firebolt

Static Values
  • id:3110
  • school:fire
  • resource:energy
  • range:40.0
  • travel_speed:16.0000
  • trigger_gcd:0.5000
  • min_gcd:0.7500
  • base_cost:40.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:1.75
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:3110
  • name:Firebolt
  • school:fire
  • tooltip:
  • description:Deals {$s1=1} Fire damage to a target.$?a231795[ Damage increased by {$231795s1=50}% if you have Immolated the target.][] |cFF777777(Right-Click to toggle)|r
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:1.000000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
pet - infernal 135026 / 11433
Immolation 105226 0.8% 1.0 0.00sec 2630750 0 Periodic 47.1 49061 98105 55887 13.9% 8.1%

Stats details: immolation

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 23.54 47.07 0.0000 1.0342 2630750.08 2630750.08 0.00 108078.96 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 40.5 86.08% 49061.03 42295 50754 49067.81 47865 50256 1988047 1988047 0.00
crit 6.6 13.92% 98104.67 84590 101507 98012.87 0 101507 642703 642703 0.00
 
 

Action details: immolation

Static Values
  • id:19483
  • school:fire
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:!ticking
Spelldata
  • id:19483
  • name:Immolation
  • school:fire
  • tooltip:Burns nearby enemies for {$20153s1=0} fire damage every $t1 seconds.
  • description:Burns nearby enemies for {$20153s1=0} fire damage every $t1 seconds.
 

Action details: immolation_tick

Static Values
  • id:20153
  • school:fire
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:20153
  • name:Immolation
  • school:fire
  • tooltip:
  • description:Deals Fire damage to all enemies near the caster.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.650000
  • base_dd_min:0.00
  • base_dd_max:0.00
 
melee 29800 0.2% 22.3 1.09sec 33456 30692 Direct 22.3 29379 58756 33455 13.9%  

Stats details: melee

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 22.27 22.27 0.00 0.00 1.0901 0.0000 745040.27 1095279.77 31.98 30691.67 30691.67
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 19.18 86.12% 29379.05 25292 30351 29380.74 28665 30351 563458 828337 31.98
crit 3.09 13.88% 58756.26 50585 60702 56697.07 0 60702 181582 266943 30.85
 
 

Action details: melee

Static Values
  • id:0
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Weapon
  • normalized:false
  • weapon_power_mod:0.285714
  • weapon_multiplier:1.00
 
pet - doomguard 110632 / 9358
Doom Bolt 110632 0.9% 11.1 2.18sec 249694 116538 Direct 11.1 219504 438727 249691 13.8%  

Stats details: doom_bolt

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 11.08 11.08 0.00 0.00 2.1427 0.0000 2765912.65 2765912.65 0.00 116537.99 116537.99
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 9.55 86.22% 219504.47 212293 254751 219525.74 212293 254751 2096436 2096436 0.00
crit 1.53 13.78% 438727.34 424586 509503 356640.29 0 509503 669477 669477 0.00
 
 

Action details: doom_bolt

Static Values
  • id:85692
  • school:shadow
  • resource:energy
  • range:30.0
  • travel_speed:20.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:35.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:3.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:85692
  • name:Doom Bolt
  • school:shadow
  • tooltip:
  • description:Sends a shadowy bolt at the enemy, causing {$s1=1} Shadow damage. Deals {$s2=20}% additional damage to targets below 20% health.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:2.750000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
pet - lord_of_flames_infernal 135031 / 11433
Immolation 105221 0.8% 1.0 0.00sec 2630623 0 Periodic 47.1 49057 98154 55884 13.9% 8.1%

Stats details: immolation

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 23.54 47.07 0.0000 1.0342 2630623.18 2630623.18 0.00 108073.75 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 40.5 86.10% 49057.05 42295 50754 49064.04 47606 50320 1988174 1988174 0.00
crit 6.5 13.90% 98153.85 84590 101507 98051.86 0 101507 642449 642449 0.00
 
 

Action details: immolation

Static Values
  • id:19483
  • school:fire
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:!ticking
Spelldata
  • id:19483
  • name:Immolation
  • school:fire
  • tooltip:Burns nearby enemies for {$20153s1=0} fire damage every $t1 seconds.
  • description:Burns nearby enemies for {$20153s1=0} fire damage every $t1 seconds.
 

Action details: immolation_tick

Static Values
  • id:20153
  • school:fire
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:20153
  • name:Immolation
  • school:fire
  • tooltip:
  • description:Deals Fire damage to all enemies near the caster.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.650000
  • base_dd_min:0.00
  • base_dd_max:0.00
 
melee 29810 0.2% 22.3 1.09sec 33467 30702 Direct 22.3 29381 58730 33467 13.9%  

Stats details: melee

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 22.27 22.27 0.00 0.00 1.0901 0.0000 745281.58 1095634.52 31.98 30701.61 30701.61
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 19.17 86.08% 29381.15 25292 30351 29382.82 28665 30351 563217 827982 31.98
crit 3.10 13.92% 58730.36 50585 60702 56538.30 0 60702 182065 267652 30.79
 
 

Action details: melee

Static Values
  • id:0
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Weapon
  • normalized:false
  • weapon_power_mod:0.285714
  • weapon_multiplier:1.00
 
pet - lord_of_flames_infernal 135126 / 11440
Immolation 105306 0.8% 1.0 0.00sec 2632768 0 Periodic 47.1 49060 98115 55929 14.0% 8.1%

Stats details: immolation

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 23.54 47.07 0.0000 1.0342 2632767.74 2632767.74 0.00 108161.86 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 40.5 86.00% 49060.23 42295 50754 49067.63 47870 50296 1986030 1986030 0.00
crit 6.6 14.00% 98114.58 84590 101507 98047.79 0 101507 646738 646738 0.00
 
 

Action details: immolation

Static Values
  • id:19483
  • school:fire
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:!ticking
Spelldata
  • id:19483
  • name:Immolation
  • school:fire
  • tooltip:Burns nearby enemies for {$20153s1=0} fire damage every $t1 seconds.
  • description:Burns nearby enemies for {$20153s1=0} fire damage every $t1 seconds.
 

Action details: immolation_tick

Static Values
  • id:20153
  • school:fire
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:20153
  • name:Immolation
  • school:fire
  • tooltip:
  • description:Deals Fire damage to all enemies near the caster.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.650000
  • base_dd_min:0.00
  • base_dd_max:0.00
 
melee 29819 0.2% 22.3 1.09sec 33477 30711 Direct 22.3 29380 58747 33476 14.0%  

Stats details: melee

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 22.27 22.27 0.00 0.00 1.0901 0.0000 745506.71 1095965.48 31.98 30710.88 30710.88
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 19.16 86.05% 29379.83 25292 30351 29381.68 28665 30351 562992 827651 31.98
crit 3.11 13.95% 58746.60 50585 60702 56837.34 0 60702 182515 268314 30.93
 
 

Action details: melee

Static Values
  • id:0
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Weapon
  • normalized:false
  • weapon_power_mod:0.285714
  • weapon_multiplier:1.00
 
pet - lord_of_flames_infernal 135003 / 11431
Immolation 105192 0.8% 1.0 0.00sec 2629912 0 Periodic 47.1 49063 98076 55869 13.9% 8.1%

Stats details: immolation

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 23.54 47.07 0.0000 1.0342 2629911.71 2629911.71 0.00 108044.52 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 40.5 86.12% 49063.34 42295 50754 49070.87 47992 50512 1988886 1988886 0.00
crit 6.5 13.88% 98075.95 84590 101507 97924.12 0 101507 641026 641026 0.00
 
 

Action details: immolation

Static Values
  • id:19483
  • school:fire
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:!ticking
Spelldata
  • id:19483
  • name:Immolation
  • school:fire
  • tooltip:Burns nearby enemies for {$20153s1=0} fire damage every $t1 seconds.
  • description:Burns nearby enemies for {$20153s1=0} fire damage every $t1 seconds.
 

Action details: immolation_tick

Static Values
  • id:20153
  • school:fire
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:20153
  • name:Immolation
  • school:fire
  • tooltip:
  • description:Deals Fire damage to all enemies near the caster.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.650000
  • base_dd_min:0.00
  • base_dd_max:0.00
 
melee 29810 0.2% 22.3 1.09sec 33467 30702 Direct 22.3 29378 58771 33466 13.9%  

Stats details: melee

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 22.27 22.27 0.00 0.00 1.0901 0.0000 745289.68 1095646.42 31.98 30701.94 30701.94
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 19.17 86.09% 29377.85 25292 30351 29379.38 28665 30351 563209 827970 31.98
crit 3.10 13.91% 58771.15 50585 60702 56462.56 0 60702 182081 267676 30.72
 
 

Action details: melee

Static Values
  • id:0
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Weapon
  • normalized:false
  • weapon_power_mod:0.285714
  • weapon_multiplier:1.00
 
pet - shadowy_tear 136359 / 17690
Shadow Bolt 136359 1.6% 3.2 73.31sec 1649189 0 Periodic 35.8 129674 259523 147825 14.0% 14.5%

Stats details: shadow_bolt

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 3.21 0.00 36.01 35.82 0.0000 1.2160 5295878.32 5295878.32 0.00 120951.89 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 30.8 86.02% 129674.08 70 156167 129046.26 0 156167 3996187 3996187 0.00
crit 5.0 13.98% 259522.96 277 312334 249312.67 0 312334 1299691 1299691 0.00
 
 

Action details: shadow_bolt

Static Values
  • id:196657
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:20.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:196657
  • name:Shadow Bolt
  • school:shadow
  • tooltip:
  • description:Sends a shadowy bolt at the enemy, causing {$s1=1} Shadow damage.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • dot_duration:14.00
  • base_tick_time:2.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
 
pet - flame_rift 280003 / 77343
Searing Bolt 280003 7.1% 63.9 2.70sec 361952 1119146 Direct 63.5 66864 0 66864 0.0%  
Periodic 135.3 122509 244884 139607 14.0% 44.5%

Stats details: searing_bolt

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 63.91 63.53 135.27 135.27 0.3234 0.9904 23131621.77 23131621.77 0.00 149584.66 1119145.67
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 63.53 100.00% 66863.54 61858 78084 66898.67 0 78084 4247719 4247719 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 116.4 86.03% 122509.05 124 156195 121900.73 0 141443 14255857 14255857 0.00
crit 18.9 13.97% 244883.98 247 312389 243498.72 0 312389 4628046 4628046 0.00
 
 

Action details: searing_bolt

Static Values
  • id:243050
  • school:fire
  • resource:energy
  • range:100.0
  • travel_speed:20.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:1.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:243050
  • name:Searing Bolt
  • school:fire
  • tooltip:Burning for $w2 Fire damage every $t2 sec.
  • description:Sends a searing bolt at the enemy, causing {$s1=1} Fire damage, and an additional $o2 Fire damage over {$d=30 seconds}, stacking up to {$u=20} times.
Direct Damage
  • may_crit:false
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:1.000000
  • base_dd_min:1.00
  • base_dd_max:1.00
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.100000
  • base_td:1.00
  • dot_duration:30.00
  • base_tick_time:1.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
 
pet - chaos_tear 162620 / 8177
Chaos Bolt 162620 0.8% 3.2 72.20sec 756312 385480 Direct 3.2 0 760921 760921 100.0%  

Stats details: chaos_bolt

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 3.24 3.22 0.00 0.00 1.9623 0.0000 2449341.65 2449341.65 0.00 385480.27 385480.27
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
crit 3.22 100.00% 760921.40 704810 889697 760490.83 0 889697 2449342 2449342 0.00
 
 

Action details: chaos_bolt

Static Values
  • id:215279
  • school:chromatic
  • resource:none
  • range:100.0
  • travel_speed:16.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:5.500
  • base_execute_time:3.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:215279
  • name:Chaos Bolt
  • school:chromatic
  • tooltip:
  • description:Unleashes a devastating blast of chaos, causing {$s1=1} Chaos damage. Chaos Bolt always critically strikes and your critical strike chance increases its damage.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:5.000000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
pet - chaos_portal 298812 / 16285
Chaos Barrage 298812 1.5% 3.2 72.33sec 1506213 0 Periodic 115.7 36988 73930 42143 14.0% 5.8%

Stats details: chaos_barrage

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 3.24 0.00 116.20 115.68 0.0000 0.1514 4875033.29 4875033.29 0.00 277069.24 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 99.5 86.05% 36987.71 151 42947 36756.08 0 42947 3681678 3681678 0.00
crit 16.1 13.95% 73929.51 311 85894 73345.21 0 85894 1193356 1193356 0.00
 
 

Action details: chaos_barrage

Static Values
  • id:187394
  • school:magic
  • resource:none
  • range:100.0
  • travel_speed:24.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:187394
  • name:Chaos Barrage
  • school:magic
  • tooltip:
  • description:Deals {$s1=1} Chaos damage.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • dot_duration:5.50
  • base_tick_time:0.25
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
 
Simple Action Stats Execute Interval
Meme_Build
augmentation 1.0 0.00sec

Stats details: augmentation

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: augmentation

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Meme_Build
  • harmful:false
  • if_expr:
 
Berserking 2.1 181.01sec

Stats details: berserking

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.07 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: berserking

Static Values
  • id:26297
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:180.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:26297
  • name:Berserking
  • school:physical
  • tooltip:Haste increased by {$s1=15}%.
  • description:Increases your haste by {$s1=15}% for {$d=10 seconds}.
 
Dimensional Rift 12.5 24.43sec

Stats details: dimensional_rift

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 12.51 0.00 0.00 0.00 0.9993 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: dimensional_rift

Static Values
  • id:196586
  • school:none
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:45.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:charges=3
Spelldata
  • id:196586
  • name:Dimensional Rift
  • school:chaos
  • tooltip:
  • description:Rips a hole in time and space, opening a portal that damages your target.
 
flask 1.0 0.00sec

Stats details: flask

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: flask

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Meme_Build
  • harmful:false
  • if_expr:
 
food 1.0 0.00sec

Stats details: food

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: food

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Meme_Build
  • harmful:false
  • if_expr:
 
Havoc 15.0 20.70sec

Stats details: havoc

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 15.04 0.00 0.00 0.00 1.0577 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: havoc

Static Values
  • id:80240
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:88000.0
  • secondary_cost:0.0
  • cooldown:20.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:active_enemies>1&(active_enemies<4|talent.wreak_havoc.enabled&active_enemies<6)&!debuff.havoc.remains
Spelldata
  • id:80240
  • name:Havoc
  • school:shadow
  • tooltip:Spells cast by the Warlock also hit this target.
  • description:Marks a target with Havoc for {$d=8 seconds}, causing your single target spells to also strike the Havoc victim. Limit 1.
 
Life Tap 6.8 32.00sec

Stats details: life_tap

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 6.83 0.00 0.00 0.00 1.0411 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: life_tap

Static Values
  • id:1454
  • school:shadow
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:talent.empowered_life_tap.enabled&!buff.empowered_life_tap.remains
Spelldata
  • id:1454
  • name:Life Tap
  • school:shadow
  • tooltip:
  • description:Restores {$s1=30}% of your maximum mana, at the cost of {$s2=10}% of your maximum health.
 
potion 2.0 0.00sec

Stats details: potion

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: potion

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:60.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
 
Grimoire: Imp (service_imp) 3.7 90.69sec

Stats details: service_imp

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 3.73 0.00 0.00 0.00 0.9664 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: service_imp

Static Values
  • id:111859
  • school:shadow
  • resource:soul_shard
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:1.0
  • secondary_cost:0.0
  • cooldown:90.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:111859
  • name:Grimoire: Imp
  • school:shadow
  • tooltip:
  • description:Summons an Imp who attacks the target for {$108501s1=25} sec. Imps cast ranged Firebolts and cleanse a hostile magic effect from their master.
 
Soul Harvest 2.9 120.58sec

Stats details: soul_harvest

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.93 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: soul_harvest

Static Values
  • id:196098
  • school:shadow
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:120.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:196098
  • name:Soul Harvest
  • school:shadow
  • tooltip:Damage increased by {$s1=20}%.
  • description:Increases your damage and your pets' damage by {$s1=20}%. Lasts {$d=15 seconds}, increased by {$s2=2} sec for each target afflicted by your {$?s137043=false}[Agony][]{$?s137044=false}[Doom][]{$?s137046=false}[Immolate][], up to a maximum of {$s3=35} sec.
 
Summon Doomguard 1.0 0.00sec

Stats details: summon_doomguard

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 1.0744 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: summon_doomguard

Static Values
  • id:18540
  • school:shadow
  • resource:soul_shard
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:1.0
  • secondary_cost:0.0
  • cooldown:180.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:talent.grimoire_of_supremacy.enabled&active_enemies=1&artifact.lord_of_flames.rank=0
Spelldata
  • id:18540
  • name:Summon Doomguard
  • school:shadow
  • tooltip:
  • description:Summons a Doomguard for {$60478d=25 seconds} to assault the target with its Doom Bolts.
 
Summon Imp 1.0 0.00sec

Stats details: summon_imp

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: summon_imp

Static Values
  • id:688
  • school:shadow
  • resource:soul_shard
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:1.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:2.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:!talent.grimoire_of_supremacy.enabled&(!talent.grimoire_of_sacrifice.enabled|buff.demonic_power.down)
Spelldata
  • id:688
  • name:Summon Imp
  • school:shadow
  • tooltip:
  • description:Summons an Imp under your command that casts ranged Firebolts.$?s74434[ |cFFFFFFFFSoulburn:|r |cFF8282FFInstant cast.|r][]
 
Summon Infernal 1.0 0.00sec

Stats details: summon_infernal

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.7570 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: summon_infernal

Static Values
  • id:1122
  • school:shadow
  • resource:soul_shard
  • range:30.0
  • travel_speed:1.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:1.0
  • secondary_cost:0.0
  • cooldown:180.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:talent.grimoire_of_supremacy.enabled&artifact.lord_of_flames.rank>0
Spelldata
  • id:1122
  • name:Summon Infernal
  • school:shadow
  • tooltip:
  • description:Summons an Infernal from the Twisting Nether, impacting for {$22703s1=0} Fire damage and stunning all enemy targets in the area for {$22703d=2 seconds}. The Infernal will serve you for {$111685d=25 seconds}, dealing strong area-of-effect damage.
 

Buffs

Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit Overflow Expiry
Accelerando 20.0 0.0 15.4sec 15.4sec 78.25% 78.25% 1.7(1.7) 19.2

Buff details

  • buff initial source:Meme_Build
  • cooldown name:buff_accelerando
  • max_stacks:5
  • duration:12.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00

Stat Buff details

  • stat:haste_rating
  • amount:734.41

Stack Uptimes

  • accelerando_1:29.42%
  • accelerando_2:24.21%
  • accelerando_3:14.59%
  • accelerando_4:6.72%
  • accelerando_5:3.31%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:225719
  • name:Accelerando
  • tooltip:Haste increased by $w1.
  • description:{$@spelldesc225125=Your damaging spells have a chance to grant you {$225719s1=528} Haste for {$225719d=12 seconds}, stacking up to 5 times. Stacking does not refresh duration.}
  • max_stacks:5
  • duration:12.00
  • cooldown:0.00
  • default_chance:101.00%
Backdraft 40.6 8.3 7.4sec 6.2sec 58.51% 49.40% 0.0(0.0) 1.0

Buff details

  • buff initial source:Meme_Build
  • cooldown name:buff_backdraft
  • max_stacks:4
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • backdraft_1:17.59%
  • backdraft_2:33.59%
  • backdraft_3:3.91%
  • backdraft_4:3.43%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:117828
  • name:Backdraft
  • tooltip:Incinerate and Chaos Bolt cast times reduced by {$s1=30}%.
  • description:{$@spelldesc196406=Casting Conflagrate reduces the cast time of your next two Incinerates or Chaos Bolts by {$117828s1=30}%.}
  • max_stacks:4
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
Berserking 2.1 0.0 181.0sec 181.0sec 6.87% 8.32% 0.0(0.0) 2.0

Buff details

  • buff initial source:Meme_Build
  • cooldown name:buff_berserking
  • max_stacks:1
  • duration:10.00
  • cooldown:180.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • berserking_1:6.87%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:26297
  • name:Berserking
  • tooltip:Haste increased by {$s1=15}%.
  • description:Increases your haste by {$s1=15}% for {$d=10 seconds}.
  • max_stacks:0
  • duration:10.00
  • cooldown:180.00
  • default_chance:0.00%
Bloodlust 1.0 0.0 0.0sec 0.0sec 13.55% 13.55% 0.0(0.0) 1.0

Buff details

  • buff initial source:Meme_Build
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • duration:40.00
  • cooldown:300.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • bloodlust_1:13.55%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:2825
  • name:Bloodlust
  • tooltip:Haste increased by {$s1=30}%.
  • description:Increases Haste by {$s1=30}% for all party and raid members for {$d=40 seconds}. Allies receiving this effect will become Sated and unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.
  • max_stacks:0
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
Conflagration of Chaos 24.5 0.0 12.2sec 12.2sec 53.73% 48.94% 0.0(0.0) 0.0

Buff details

  • buff initial source:Meme_Build
  • cooldown name:buff_conflagration_of_chaos
  • max_stacks:1
  • duration:20.00
  • cooldown:0.00
  • default_chance:50.00%
  • default_value:-0.00

Stack Uptimes

  • conflagration_of_chaos_1:53.73%

Trigger Attempt Success

  • trigger_pct:50.08%

Spelldata details

  • id:196546
  • name:Conflagration of Chaos
  • tooltip:Your {$?s17877=false}[Shadowburn][Conflagrate] will always critically strike. Critical strike chance will increase the critical strike damage of {$?s17877=false}[Shadowburn][Conflagrate].
  • description:{$@spelldesc219195={$?s17877=false}[Shadowburn][Conflagrate] has a chance to guarantee your next {$?s17877=false}[Shadowburn][Conflagrate] critically strikes, and to increase its damage by your critical strike chance.}
  • max_stacks:0
  • duration:20.00
  • cooldown:0.00
  • default_chance:100.00%
Devil's Due 3.5 0.0 70.1sec 70.1sec 8.67% 8.67% 0.0(0.0) 3.2

Buff details

  • buff initial source:Meme_Build
  • cooldown name:buff_devils_due
  • max_stacks:1
  • duration:8.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.18

Stack Uptimes

  • devils_due_1:8.67%

Trigger Attempt Success

  • trigger_pct:99.93%

Spelldata details

  • id:225776
  • name:Devil's Due
  • tooltip:Cast speed slowed by {$s1=7}%.
  • description:{$@spelldesc225142=Your damaging spells have a chance to grant Nefarious Pact, increasing your casting speed by {$225774s1=17}% for {$225774d=12 seconds}. When Nefarious Pact expires, your casting speed is decreased by {$225776s1=7}% for {$225776d=8 seconds}.}
  • max_stacks:0
  • duration:8.00
  • cooldown:0.00
  • default_chance:0.00%
Embrace Chaos 32.8 62.5 9.3sec 3.1sec 82.77% 90.09% 62.5(62.5) 32.0

Buff details

  • buff initial source:Meme_Build
  • cooldown name:buff_embrace_chaos
  • max_stacks:1
  • duration:4.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • embrace_chaos_1:82.77%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:212019
  • name:Embrace Chaos
  • tooltip:Chaos Bolt has {$s1=40}% reduced cast time.
  • description:{$@spelldesc212018=Casting Chaos Bolt reduces the cast time of your next Chaos Bolt by {$212019s1=40}% for {$212019d=4 seconds}.}
  • max_stacks:0
  • duration:4.00
  • cooldown:0.00
  • default_chance:0.00%
Lord of Flames 1.0 0.0 0.0sec 0.0sec 98.41% 98.41% 0.0(0.0) 0.0

Buff details

  • buff initial source:Meme_Build
  • cooldown name:buff_lord_of_flames
  • max_stacks:1
  • duration:600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • lord_of_flames_1:98.41%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:226802
  • name:Lord of Flames
  • tooltip:Recently activated Lord of Flames.
  • description:{$@spelldesc224103=Once every {$s2=10} minutes, {$?s152107=false}[your Infernal's Meteor Strike][Summon Infernal] will summon {$s3=3} additional Infernals to serve you for {$226804d=25 seconds}.}
  • max_stacks:0
  • duration:600.00
  • cooldown:0.00
  • default_chance:0.00%
Nefarious Pact 3.5 0.0 70.5sec 69.7sec 13.49% 13.49% 0.0(0.0) 3.3

Buff details

  • buff initial source:Meme_Build
  • cooldown name:buff_nefarious_pact
  • max_stacks:1
  • duration:12.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.44

Stack Uptimes

  • nefarious_pact_1:13.49%

Trigger Attempt Success

  • trigger_pct:99.93%

Spelldata details

  • id:225774
  • name:Nefarious Pact
  • tooltip:Cast speed increased by {$s1=17}%.
  • description:{$@spelldesc225142=Your damaging spells have a chance to grant Nefarious Pact, increasing your casting speed by {$225774s1=17}% for {$225774d=12 seconds}. When Nefarious Pact expires, your casting speed is decreased by {$225776s1=7}% for {$225776d=8 seconds}.}
  • max_stacks:0
  • duration:12.00
  • cooldown:0.00
  • default_chance:0.00%
Potion of Deadly Grace 1.0 0.0 0.0sec 0.0sec 10.16% 10.16% 0.0(0.0) 1.0

Buff details

  • buff initial source:Meme_Build
  • cooldown name:buff_potion_of_deadly_grace
  • max_stacks:1
  • duration:30.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • potion_of_deadly_grace_1:10.16%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:188027
  • name:Potion of Deadly Grace
  • tooltip:Your attacks have a chance to unleash a bolt of energy at your target.
  • description:Grants your attacks a chance to unleash a bolt of energy at your target. Staying away from enemies for the entire duration of the effect will extend the effect by an additional 5 seconds.
  • max_stacks:0
  • duration:25.00
  • cooldown:1.00
  • default_chance:101.00%
Potion of Prolonged Power 1.0 0.0 0.0sec 0.0sec 19.64% 19.64% 0.0(0.0) 1.0

Buff details

  • buff initial source:Meme_Build
  • cooldown name:buff_potion_of_prolonged_power
  • max_stacks:1
  • duration:60.00
  • cooldown:1.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:all
  • amount:2500.00

Stack Uptimes

  • potion_of_prolonged_power_1:19.64%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:229206
  • name:Potion of Prolonged Power
  • tooltip:All stats increased by {$s1=2500}.
  • description:Drink to increase all stats by {$s1=2500} for {$d=60 seconds}.
  • max_stacks:0
  • duration:60.00
  • cooldown:1.00
  • default_chance:0.00%
Soul Harvest 2.9 0.0 120.6sec 120.6sec 17.95% 17.95% 0.0(0.0) 2.7

Buff details

  • buff initial source:Meme_Build
  • cooldown name:buff_soul_harvest
  • max_stacks:1
  • duration:15.00
  • cooldown:120.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • soul_harvest_1:17.95%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:196098
  • name:Soul Harvest
  • tooltip:Damage increased by {$s1=20}%.
  • description:Increases your damage and your pets' damage by {$s1=20}%. Lasts {$d=15 seconds}, increased by {$s2=2} sec for each target afflicted by your {$?s137043=false}[Agony][]{$?s137044=false}[Doom][]{$?s137046=false}[Immolate][], up to a maximum of {$s3=35} sec.
  • max_stacks:0
  • duration:15.00
  • cooldown:120.00
  • default_chance:0.00%
Constant Buffs
Well Fed (azshari_salad)

Buff details

  • buff initial source:Meme_Build
  • cooldown name:buff_azshari_salad
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:haste_rating
  • amount:375.00

Stack Uptimes

  • azshari_salad_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:225603
  • name:Well Fed
  • tooltip:Haste increased by $w1.
  • description:Increases haste by {$s1=375} for {$d=3600 seconds}.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Defiled Augmentation

Buff details

  • buff initial source:Meme_Build
  • cooldown name:buff_defiled_augmentation
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:agility
  • amount:325.00
  • stat:strength
  • amount:325.00
  • stat:intellect
  • amount:325.00

Stack Uptimes

  • defiled_augmentation_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:224001
  • name:Defiled Augmentation
  • tooltip:Agility, Intellect and Strength increased by $w1.
  • description:Increases Agility, Intellect and Strength by {$s1=325} for {$d=3600 seconds}. Augment Rune.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Flask of the Whispered Pact

Buff details

  • buff initial source:Meme_Build
  • cooldown name:buff_flask_of_the_whispered_pact
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:intellect
  • amount:1300.00

Stack Uptimes

  • flask_of_the_whispered_pact_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:188031
  • name:Flask of the Whispered Pact
  • tooltip:Intellect increased by $w1.
  • description:Increases Intellect by {$s1=1300} for {$d=3600 seconds}. Counts as both a Battle and Guardian elixir. This effect persists through death.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:101.00%
Tormented Souls

Buff details

  • buff initial source:Meme_Build
  • cooldown name:buff_tormented_souls
  • max_stacks:12
  • duration:0.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00

Stack Uptimes

  • tormented_souls_2:0.37%
  • tormented_souls_3:99.63%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:216695
  • name:Tormented Souls
  • tooltip:Activate Reap Souls to consume all Tormented Souls collected by |cFFFFCC99Ulthalesh|r, increasing your damage by 10% and doubling the effect of all of |cFFFFCC99Ulthalesh|r's other traits for {$216708d=5 seconds} per soul consumed.
  • description:Activate Reap Souls to consume all Tormented Souls collected by |cFFFFCC99Ulthalesh|r, increasing your damage by 10% and doubling the effect of all of |cFFFFCC99Ulthalesh|r's other traits for {$216708d=5 seconds} per soul consumed.
  • max_stacks:12
  • duration:-0.00
  • cooldown:0.00
  • default_chance:101.00%

Procs

Count Interval
shadowy_tear 3.1 72.8sec
flame_rift 3.1 72.9sec
chaos_tear 3.2 72.1sec
chaos_portal 3.1 72.6sec
dimension_ripper 3.4 59.6sec
soul_conduit 39.1 8.3sec
t19_2pc_chaos_bolt 81.0 3.6sec

Resources

Resource Usage Type Count Total Average RPE APR
Meme_Build
chaos_bolt Soul Shard 95.3 190.6 2.0 2.0 663295.0
havoc Mana 15.0 1323826.9 88000.0 87999.9 0.0
immolate Mana 27.9 1841500.9 66000.0 65999.1 26.2
incinerate Mana 68.1 4493370.8 66000.0 66000.7 5.7
service_imp Soul Shard 3.7 3.7 1.0 1.0 0.0
summon_doomguard Soul Shard 1.0 1.0 1.0 1.0 0.0
summon_infernal Soul Shard 1.0 1.0 1.0 1.0 0.0
pet - imp
firebolt Energy 109.5 4378.6 40.0 40.0 3369.7
pet - service_imp
firebolt Energy 49.8 1993.1 40.0 40.0 6879.1
pet - doomguard
doom_bolt Energy 11.1 387.7 35.0 35.0 7134.1
pet - flame_rift
searing_bolt Energy 61.8 61.8 1.0 1.0 374418.3
Resource Gains Type Count Total Average Overflow
life_tap Mana 6.83 2252498.25 (33.16%) 330000.00 0.00 0.00%
immolate Soul Shard 71.62 68.62 (35.03%) 0.96 3.00 4.18%
conflagrate Soul Shard 48.89 48.47 (24.74%) 0.99 0.42 0.85%
mp5_regen Mana 569.37 4540829.81 (66.84%) 7975.19 117983.34 2.53%
soul_conduit Soul Shard 39.13 39.13 (19.97%) 1.00 0.00 0.00%
soulsnatcher Soul Shard 14.33 14.17 (7.23%) 0.99 0.16 1.11%
feretory_of_souls Soul Shard 25.94 25.50 (13.02%) 0.98 0.44 1.70%
pet - imp
energy_regen Energy 1902.54 4212.13 (100.00%) 2.21 21.52 0.51%
pet - service_imp
energy_regen Energy 452.61 1374.10 (100.00%) 3.04 62.95 4.38%
pet - doomguard
energy_regen Energy 15.79 346.79 (100.00%) 21.97 43.04 11.04%
Resource RPS-Gain RPS-Loss
Health 0.00 7494.38
Mana 22568.37 25443.38
Soul Shard 0.65 0.65
Combat End Resource Mean Min Max
Mana 234292.87 3016.55 537450.91
Soul Shard 2.51 0.00 5.00

Benefits & Uptimes

Benefits %
Uptimes %
Mana Cap 1.8%

Statistics & Data Analysis

Fight Length
Sample Data Meme_Build Fight Length
Count 9999
Mean 301.01
Minimum 217.68
Maximum 385.07
Spread ( max - min ) 167.39
Range [ ( max - min ) / 2 * 100% ] 27.80%
DPS
Sample Data Meme_Build Damage Per Second
Count 9999
Mean 1083140.05
Minimum 928157.29
Maximum 1329952.09
Spread ( max - min ) 401794.79
Range [ ( max - min ) / 2 * 100% ] 18.55%
Standard Deviation 51829.7735
5th Percentile 1002789.03
95th Percentile 1172848.48
( 95th Percentile - 5th Percentile ) 170059.45
Mean Distribution
Standard Deviation 518.3237
95.00% Confidence Intervall ( 1082124.15 - 1084155.94 )
Normalized 95.00% Confidence Intervall ( 99.91% - 100.09% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 88
0.1% Error 8797
0.1 Scale Factor Error with Delta=300 22932019
0.05 Scale Factor Error with Delta=300 91728076
0.01 Scale Factor Error with Delta=300 2293201889
Priority Target DPS
Sample Data Meme_Build Priority Target Damage Per Second
Count 9999
Mean 825419.65
Minimum 697197.88
Maximum 1030429.43
Spread ( max - min ) 333231.55
Range [ ( max - min ) / 2 * 100% ] 20.19%
Standard Deviation 44216.5366
5th Percentile 756786.50
95th Percentile 903509.08
( 95th Percentile - 5th Percentile ) 146722.58
Mean Distribution
Standard Deviation 442.1875
95.00% Confidence Intervall ( 824552.98 - 826286.32 )
Normalized 95.00% Confidence Intervall ( 99.90% - 100.10% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 111
0.1% Error 11024
0.1 Scale Factor Error with Delta=300 16689877
0.05 Scale Factor Error with Delta=300 66759505
0.01 Scale Factor Error with Delta=300 1668987612
DPS(e)
Sample Data Meme_Build Damage Per Second (Effective)
Count 9999
Mean 1083140.05
Minimum 928157.29
Maximum 1329952.09
Spread ( max - min ) 401794.79
Range [ ( max - min ) / 2 * 100% ] 18.55%
Damage
Sample Data Meme_Build Damage
Count 9999
Mean 245802519.47
Minimum 164423700.18
Maximum 332329348.41
Spread ( max - min ) 167905648.23
Range [ ( max - min ) / 2 * 100% ] 34.15%
DTPS
Sample Data Meme_Build Damage Taken Per Second
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HPS
Sample Data Meme_Build Healing Per Second
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
HPS(e)
Sample Data Meme_Build Healing Per Second (Effective)
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
Sample Data Meme_Build Heal
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
Sample Data Meme_Build Healing Taken Per Second
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
TMI
Sample Data Meme_Build Theck-Meloree Index
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
ETMI
Sample Data Meme_BuildTheck-Meloree Index (Effective)
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
MSD
Sample Data Meme_Build Max Spike Value
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 flask,type=whispered_pact
1 0.00 food,type=azshari_salad
2 0.00 summon_pet,if=!talent.grimoire_of_supremacy.enabled&(!talent.grimoire_of_sacrifice.enabled|buff.demonic_power.down)
3 0.00 summon_infernal,if=talent.grimoire_of_supremacy.enabled&artifact.lord_of_flames.rank>0
4 0.00 summon_infernal,if=talent.grimoire_of_supremacy.enabled&active_enemies>1
5 0.00 summon_doomguard,if=talent.grimoire_of_supremacy.enabled&active_enemies=1&artifact.lord_of_flames.rank=0
6 0.00 augmentation,type=defiled
7 0.00 snapshot_stats
8 0.00 grimoire_of_sacrifice,if=talent.grimoire_of_sacrifice.enabled
9 0.00 life_tap,if=talent.empowered_life_tap.enabled&!buff.empowered_life_tap.remains
A 0.00 potion,name=prolonged_power
B 0.00 chaos_bolt
Default action list Executed every time the actor is available.
# count action,conditions
C 15.05 havoc,target=2,if=active_enemies>1&(active_enemies<4|talent.wreak_havoc.enabled&active_enemies<6)&!debuff.havoc.remains
D 1.00 dimensional_rift,if=charges=3
E 5.70 immolate,if=remains<=tick_time
F 10.77 immolate,cycle_targets=1,if=active_enemies>1&remains<=tick_time&(!talent.roaring_blaze.enabled|(!debuff.roaring_blaze.remains&action.conflagrate.charges<2+set_bonus.tier19_4pc))
0.00 immolate,if=talent.roaring_blaze.enabled&remains<=duration&!debuff.roaring_blaze.remains&target.time_to_die>10&(action.conflagrate.charges=2+set_bonus.tier19_4pc|(action.conflagrate.charges>=1+set_bonus.tier19_4pc&action.conflagrate.recharge_time<cast_time+gcd)|target.time_to_die<24)
G 2.07 berserking
0.00 blood_fury
0.00 arcane_torrent
H 1.00 potion,name=deadly_grace,if=(buff.soul_harvest.remains|trinket.proc.any.react|target.time_to_die<=45)
0.00 shadowburn,if=buff.conflagration_of_chaos.remains<=action.chaos_bolt.cast_time
0.00 shadowburn,if=(charges=1+set_bonus.tier19_4pc&recharge_time<action.chaos_bolt.cast_time|charges=2+set_bonus.tier19_4pc)&soul_shard<5
0.00 conflagrate,if=talent.roaring_blaze.enabled&(charges=2+set_bonus.tier19_4pc|(charges>=1+set_bonus.tier19_4pc&recharge_time<gcd)|target.time_to_die<24)
0.00 conflagrate,if=talent.roaring_blaze.enabled&debuff.roaring_blaze.stack>0&dot.immolate.remains>dot.immolate.duration*0.3&(active_enemies=1|soul_shard<3)&soul_shard<5
I 24.99 conflagrate,if=!talent.roaring_blaze.enabled&buff.backdraft.stack<3&buff.conflagration_of_chaos.remains<=action.chaos_bolt.cast_time
J 0.55 conflagrate,if=!talent.roaring_blaze.enabled&buff.backdraft.stack<3&(charges=1+set_bonus.tier19_4pc&recharge_time<action.chaos_bolt.cast_time|charges=2+set_bonus.tier19_4pc)&soul_shard<5
0.00 life_tap,if=talent.empowered_life_tap.enabled&buff.empowered_life_tap.remains<=gcd
0.00 dimensional_rift,if=equipped.144369&!buff.lessons_of_spacetime.remains&((!talent.grimoire_of_supremacy.enabled&!cooldown.summon_doomguard.remains)|(talent.grimoire_of_service.enabled&!cooldown.service_pet.remains)|(talent.soul_harvest.enabled&!cooldown.soul_harvest.remains))
K 3.73 service_pet
L 1.00 summon_infernal,if=artifact.lord_of_flames.rank>0&!buff.lord_of_flames.remains
M 1.00 summon_doomguard,if=!talent.grimoire_of_supremacy.enabled&spell_targets.infernal_awakening<=2&(target.time_to_die>180|target.health.pct<=20|target.time_to_die<30)
0.00 summon_infernal,if=!talent.grimoire_of_supremacy.enabled&spell_targets.infernal_awakening>2
0.00 summon_doomguard,if=talent.grimoire_of_supremacy.enabled&spell_targets.summon_infernal=1&artifact.lord_of_flames.rank>0&buff.lord_of_flames.remains&!pet.doomguard.active
0.00 summon_doomguard,if=talent.grimoire_of_supremacy.enabled&spell_targets.summon_infernal=1&equipped.132379&!cooldown.sindorei_spite_icd.remains
0.00 summon_infernal,if=talent.grimoire_of_supremacy.enabled&spell_targets.summon_infernal>1&equipped.132379&!cooldown.sindorei_spite_icd.remains
N 2.93 soul_harvest
0.00 channel_demonfire,if=dot.immolate.remains>cast_time
0.00 havoc,if=active_enemies=1&talent.wreak_havoc.enabled&equipped.132375&!debuff.havoc.remains
0.00 rain_of_fire,if=active_enemies>=3&cooldown.havoc.remains<=12&!talent.wreak_havoc.enabled
0.00 rain_of_fire,if=active_enemies>=6&talent.wreak_havoc.enabled
O 11.51 dimensional_rift,if=!equipped.144369|charges>1|((!talent.grimoire_of_service.enabled|recharge_time<cooldown.service_pet.remains)&(!talent.soul_harvest.enabled|recharge_time<cooldown.soul_harvest.remains)&(!talent.grimoire_of_supremacy.enabled|recharge_time<cooldown.summon_doomguard.remains))
0.00 life_tap,if=talent.empowered_life_tap.enabled&buff.empowered_life_tap.remains<duration*0.3
0.00 cataclysm
P 94.66 chaos_bolt,if=(cooldown.havoc.remains>12&cooldown.havoc.remains|active_enemies<3|talent.wreak_havoc.enabled&active_enemies<6)&(set_bonus.tier19_4pc=0|!talent.eradication.enabled|buff.embrace_chaos.remains<=cast_time|soul_shard>=3)
0.00 shadowburn
Q 23.35 conflagrate,if=!talent.roaring_blaze.enabled&buff.backdraft.stack<3
R 11.52 immolate,if=!talent.roaring_blaze.enabled&remains<=duration*0.3
S 68.33 incinerate
T 6.83 life_tap

Sample Sequence

0126ABCDEGIIKLNOOPSIIOPPQPPSIPRPSCFIOPPPIPPSPQSPRPQPFSCOPQSSOPIPRSSOFPQCPQSPSSSQPRSSFIPSSSSCPIPPSRPOFQKIPPSSTCIPPPEPPQPSQSPPPPCINHPEPPPQPSSSOPQRQCPFPSISPSTSPQSRSSPCFQPQSSPPSIPRTOPGQFKCPSPQSSPSPPQEPIFPPSCPQPSSTPQRSPSPSFISSPSOPMCQPEQPTPSSIPSNSSPQCRPSQPSTSPPQPSPPPPRIPSCOFIKPSPIPPPRSIPPCFSP

Sample Sequence Table

time list # name target resources buffs
Pre precombat 0 flask Meme_Build 1100000.0/1100000: 100% mana | 3.0/5: 60% soul_shard
Pre precombat 1 food Meme_Build 1100000.0/1100000: 100% mana | 3.0/5: 60% soul_shard
Pre precombat 2 summon_imp Fluffy_Pillow 1100000.0/1100000: 100% mana | 3.0/5: 60% soul_shard
Pre precombat 6 augmentation Meme_Build 1100000.0/1100000: 100% mana | 3.0/5: 60% soul_shard
Pre precombat A potion Fluffy_Pillow 1100000.0/1100000: 100% mana | 3.0/5: 60% soul_shard potion_of_prolonged_power
0:00.000 precombat B chaos_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 2.0/5: 40% soul_shard embrace_chaos, accelerando, potion_of_prolonged_power
0:00.000 default C havoc enemy2 1100000.0/1100000: 100% mana | 2.0/5: 40% soul_shard embrace_chaos, accelerando, potion_of_prolonged_power
0:01.138 default D dimensional_rift Fluffy_Pillow 1033556.8/1100000: 94% mana | 2.0/5: 40% soul_shard bloodlust, embrace_chaos, accelerando, potion_of_prolonged_power
0:02.013 default E immolate Fluffy_Pillow 1050131.7/1100000: 95% mana | 2.0/5: 40% soul_shard bloodlust, embrace_chaos, accelerando, potion_of_prolonged_power
0:02.888 default G berserking Fluffy_Pillow 1000707.7/1100000: 91% mana | 2.0/5: 40% soul_shard bloodlust, embrace_chaos, accelerando(2), potion_of_prolonged_power
0:02.888 default I conflagrate Fluffy_Pillow 1000707.7/1100000: 91% mana | 2.0/5: 40% soul_shard bloodlust, berserking, embrace_chaos, accelerando(2), potion_of_prolonged_power
0:03.641 default I conflagrate Fluffy_Pillow 1017353.9/1100000: 92% mana | 3.0/5: 60% soul_shard bloodlust, berserking, backdraft(2), embrace_chaos, accelerando(2), potion_of_prolonged_power
0:04.396 default K service_imp Fluffy_Pillow 1034044.3/1100000: 94% mana | 4.0/5: 80% soul_shard bloodlust, berserking, backdraft(4), accelerando(2), potion_of_prolonged_power
0:05.149 default L summon_infernal Fluffy_Pillow 1050858.8/1100000: 96% mana | 3.0/5: 60% soul_shard bloodlust, berserking, backdraft(4), accelerando(3), potion_of_prolonged_power
0:05.901 default N soul_harvest Fluffy_Pillow 1067724.9/1100000: 97% mana | 2.0/5: 40% soul_shard bloodlust, berserking, backdraft(4), lord_of_flames, accelerando(3), potion_of_prolonged_power
0:05.901 default O dimensional_rift Fluffy_Pillow 1067724.9/1100000: 97% mana | 2.0/5: 40% soul_shard bloodlust, berserking, soul_harvest, backdraft(4), lord_of_flames, accelerando(3), potion_of_prolonged_power
0:06.657 default O dimensional_rift Fluffy_Pillow 1084680.7/1100000: 99% mana | 2.0/5: 40% soul_shard bloodlust, berserking, soul_harvest, backdraft(4), lord_of_flames, accelerando(3), potion_of_prolonged_power
0:07.412 default P chaos_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 2.0/5: 40% soul_shard bloodlust, berserking, soul_harvest, backdraft(4), lord_of_flames, accelerando(3), potion_of_prolonged_power
0:08.447 default S incinerate Fluffy_Pillow 1100000.0/1100000: 100% mana | 0.0/5: 0% soul_shard bloodlust, berserking, soul_harvest, backdraft(3), lord_of_flames, embrace_chaos, nefarious_pact, accelerando(5), potion_of_prolonged_power
0:09.201 default I conflagrate Fluffy_Pillow 1041383.2/1100000: 95% mana | 0.0/5: 0% soul_shard bloodlust, berserking, soul_harvest, lord_of_flames, embrace_chaos, nefarious_pact, accelerando(5), potion_of_prolonged_power
0:09.957 default I conflagrate Fluffy_Pillow 1058826.1/1100000: 96% mana | 1.0/5: 20% soul_shard bloodlust, berserking, soul_harvest, backdraft(2), lord_of_flames, embrace_chaos, nefarious_pact, accelerando(5), potion_of_prolonged_power
0:10.709 default O dimensional_rift Fluffy_Pillow 1076176.6/1100000: 98% mana | 5.0/5: 100% soul_shard bloodlust, berserking, soul_harvest, backdraft(4), lord_of_flames, conflagration_of_chaos, embrace_chaos, nefarious_pact, accelerando(5), potion_of_prolonged_power
0:11.462 default P chaos_bolt Fluffy_Pillow 1093550.3/1100000: 99% mana | 5.0/5: 100% soul_shard bloodlust, berserking, soul_harvest, backdraft(4), lord_of_flames, conflagration_of_chaos, embrace_chaos, nefarious_pact, accelerando(5), potion_of_prolonged_power
0:12.217 default P chaos_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 3.0/5: 60% soul_shard bloodlust, berserking, soul_harvest, backdraft(3), lord_of_flames, conflagration_of_chaos, embrace_chaos, nefarious_pact, potion_of_prolonged_power
0:12.972 default Q conflagrate Fluffy_Pillow 1100000.0/1100000: 100% mana | 2.0/5: 40% soul_shard bloodlust, soul_harvest, backdraft(2), lord_of_flames, conflagration_of_chaos, embrace_chaos, nefarious_pact, potion_of_prolonged_power
0:13.727 default P chaos_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 4.0/5: 80% soul_shard bloodlust, soul_harvest, backdraft(4), lord_of_flames, embrace_chaos, nefarious_pact, potion_of_prolonged_power
0:14.483 default P chaos_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 3.0/5: 60% soul_shard bloodlust, soul_harvest, backdraft(3), lord_of_flames, embrace_chaos, nefarious_pact, potion_of_prolonged_power
0:15.238 default S incinerate Fluffy_Pillow 1100000.0/1100000: 100% mana | 2.0/5: 40% soul_shard bloodlust, soul_harvest, backdraft(2), lord_of_flames, embrace_chaos, nefarious_pact, accelerando, potion_of_prolonged_power
0:15.993 default I conflagrate Fluffy_Pillow 1038344.4/1100000: 94% mana | 2.0/5: 40% soul_shard bloodlust, soul_harvest, backdraft, lord_of_flames, embrace_chaos, nefarious_pact, accelerando(2), potion_of_prolonged_power
0:16.863 default P chaos_bolt Fluffy_Pillow 1055068.4/1100000: 96% mana | 3.0/5: 60% soul_shard bloodlust, soul_harvest, backdraft(3), lord_of_flames, embrace_chaos, nefarious_pact, accelerando(2), potion_of_prolonged_power
0:17.618 default R immolate Fluffy_Pillow 1069581.8/1100000: 97% mana | 2.0/5: 40% soul_shard bloodlust, soul_harvest, backdraft(2), lord_of_flames, embrace_chaos, nefarious_pact, accelerando(2), potion_of_prolonged_power
0:18.372 default P chaos_bolt Fluffy_Pillow 1018075.9/1100000: 93% mana | 3.0/5: 60% soul_shard bloodlust, soul_harvest, backdraft(2), lord_of_flames, embrace_chaos, nefarious_pact, accelerando(2), potion_of_prolonged_power
0:19.127 default S incinerate Fluffy_Pillow 1032589.3/1100000: 94% mana | 2.0/5: 40% soul_shard bloodlust, soul_harvest, backdraft, lord_of_flames, embrace_chaos, nefarious_pact, accelerando(2), potion_of_prolonged_power
0:19.882 default C havoc enemy2 981102.7/1100000: 89% mana | 2.0/5: 40% soul_shard bloodlust, soul_harvest, lord_of_flames, embrace_chaos, nefarious_pact, accelerando(2), potion_of_prolonged_power
0:20.755 default F immolate enemy2 909884.4/1100000: 83% mana | 2.0/5: 40% soul_shard bloodlust, soul_harvest, lord_of_flames, embrace_chaos, devils_due, accelerando(2), potion_of_prolonged_power
0:21.771 default I conflagrate Fluffy_Pillow 863415.0/1100000: 78% mana | 2.0/5: 40% soul_shard bloodlust, soul_harvest, lord_of_flames, embrace_chaos, devils_due, accelerando(2), potion_of_prolonged_power
0:22.786 default O dimensional_rift Fluffy_Pillow 882926.3/1100000: 80% mana | 3.0/5: 60% soul_shard bloodlust, soul_harvest, backdraft(2), lord_of_flames, embrace_chaos, devils_due, accelerando(2), potion_of_prolonged_power
0:23.801 default P chaos_bolt Fluffy_Pillow 902437.7/1100000: 82% mana | 4.0/5: 80% soul_shard bloodlust, soul_harvest, backdraft(2), lord_of_flames, devils_due, accelerando(2), potion_of_prolonged_power
0:25.220 default P chaos_bolt Fluffy_Pillow 929715.1/1100000: 85% mana | 3.0/5: 60% soul_shard bloodlust, backdraft, lord_of_flames, embrace_chaos, devils_due, accelerando(2), potion_of_prolonged_power
0:26.073 default P chaos_bolt Fluffy_Pillow 946269.1/1100000: 86% mana | 3.0/5: 60% soul_shard bloodlust, lord_of_flames, embrace_chaos, devils_due, accelerando(3), potion_of_prolonged_power
0:27.274 default I conflagrate Fluffy_Pillow 969459.4/1100000: 88% mana | 2.0/5: 40% soul_shard bloodlust, lord_of_flames, embrace_chaos, devils_due, potion_of_prolonged_power
0:28.321 default P chaos_bolt Fluffy_Pillow 988999.4/1100000: 90% mana | 4.0/5: 80% soul_shard bloodlust, backdraft(2), lord_of_flames, conflagration_of_chaos, embrace_chaos, devils_due, potion_of_prolonged_power
0:29.199 default P chaos_bolt Fluffy_Pillow 1005386.5/1100000: 91% mana | 3.0/5: 60% soul_shard bloodlust, backdraft, lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando, potion_of_prolonged_power
0:29.953 default S incinerate Fluffy_Pillow 1019669.3/1100000: 93% mana | 2.0/5: 40% soul_shard bloodlust, lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando, potion_of_prolonged_power
0:31.049 default P chaos_bolt Fluffy_Pillow 974430.5/1100000: 89% mana | 3.0/5: 60% soul_shard bloodlust, lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando, potion_of_prolonged_power
0:32.098 default Q conflagrate Fluffy_Pillow 994301.5/1100000: 90% mana | 1.0/5: 20% soul_shard bloodlust, lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando, potion_of_prolonged_power
0:32.975 default S incinerate Fluffy_Pillow 1010914.3/1100000: 92% mana | 2.0/5: 40% soul_shard bloodlust, backdraft(2), lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando, potion_of_prolonged_power
0:33.743 default P chaos_bolt Fluffy_Pillow 959462.3/1100000: 87% mana | 3.0/5: 60% soul_shard bloodlust, backdraft, lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando, potion_of_prolonged_power
0:34.497 default R immolate Fluffy_Pillow 973745.1/1100000: 89% mana | 2.0/5: 40% soul_shard bloodlust, lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando, potion_of_prolonged_power
0:35.372 default P chaos_bolt Fluffy_Pillow 924320.0/1100000: 84% mana | 4.0/5: 80% soul_shard bloodlust, lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando, potion_of_prolonged_power
0:36.422 default Q conflagrate Fluffy_Pillow 944211.3/1100000: 86% mana | 2.0/5: 40% soul_shard bloodlust, lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(2), potion_of_prolonged_power
0:37.524 default P chaos_bolt Fluffy_Pillow 965637.1/1100000: 88% mana | 3.0/5: 60% soul_shard bloodlust, backdraft(2), lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(3), potion_of_prolonged_power
0:38.277 default F immolate enemy2 980322.8/1100000: 89% mana | 1.0/5: 20% soul_shard bloodlust, backdraft, lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(3), potion_of_prolonged_power
0:39.128 default S incinerate Fluffy_Pillow 930919.8/1100000: 85% mana | 1.0/5: 20% soul_shard bloodlust, backdraft, lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(3), potion_of_prolonged_power
0:39.883 default C havoc enemy2 879644.5/1100000: 80% mana | 1.0/5: 20% soul_shard bloodlust, lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(3), potion_of_prolonged_power
0:40.852 default O dimensional_rift Fluffy_Pillow 810542.8/1100000: 74% mana | 1.0/5: 20% soul_shard bloodlust, lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(3), potion_of_prolonged_power
0:41.703 default P chaos_bolt Fluffy_Pillow 823108.2/1100000: 75% mana | 2.0/5: 40% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando, potion_of_prolonged_power
0:43.067 default Q conflagrate Fluffy_Pillow 842983.4/1100000: 77% mana | 0.0/5: 0% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando, potion_of_prolonged_power
0:44.204 default S incinerate Fluffy_Pillow 859551.1/1100000: 78% mana | 1.0/5: 20% soul_shard backdraft(2), lord_of_flames, embrace_chaos, accelerando, potion_of_prolonged_power
0:45.200 default S incinerate Fluffy_Pillow 808064.1/1100000: 73% mana | 1.0/5: 20% soul_shard backdraft, lord_of_flames, embrace_chaos, accelerando, potion_of_prolonged_power
0:46.197 default O dimensional_rift Fluffy_Pillow 756591.7/1100000: 69% mana | 1.0/5: 20% soul_shard lord_of_flames, embrace_chaos, accelerando, potion_of_prolonged_power
0:47.335 default P chaos_bolt Fluffy_Pillow 773173.9/1100000: 70% mana | 2.0/5: 40% soul_shard lord_of_flames, accelerando, potion_of_prolonged_power
0:49.605 default I conflagrate Fluffy_Pillow 806252.1/1100000: 73% mana | 2.0/5: 40% soul_shard lord_of_flames, embrace_chaos, accelerando(2), potion_of_prolonged_power
0:50.724 default P chaos_bolt Fluffy_Pillow 822798.7/1100000: 75% mana | 3.0/5: 60% soul_shard backdraft(2), lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(2), potion_of_prolonged_power
0:51.664 default R immolate Fluffy_Pillow 836699.3/1100000: 76% mana | 2.0/5: 40% soul_shard backdraft, lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(3), potion_of_prolonged_power
0:52.766 default S incinerate Fluffy_Pillow 787231.7/1100000: 72% mana | 2.0/5: 40% soul_shard backdraft, lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(3), potion_of_prolonged_power
0:53.734 default S incinerate Fluffy_Pillow 735576.4/1100000: 67% mana | 2.0/5: 40% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando, potion_of_prolonged_power
0:55.159 default O dimensional_rift Fluffy_Pillow 690340.6/1100000: 63% mana | 3.0/5: 60% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando, potion_of_prolonged_power
0:56.297 default F immolate enemy2 706922.7/1100000: 64% mana | 3.0/5: 60% soul_shard lord_of_flames, conflagration_of_chaos, accelerando, potion_of_prolonged_power
0:57.433 default P chaos_bolt Fluffy_Pillow 657475.8/1100000: 60% mana | 4.0/5: 80% soul_shard lord_of_flames, conflagration_of_chaos, accelerando, potion_of_prolonged_power
0:59.700 default Q conflagrate Fluffy_Pillow 690509.6/1100000: 63% mana | 2.0/5: 40% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(2)
1:00.821 default C havoc enemy2 707085.8/1100000: 64% mana | 3.0/5: 60% soul_shard backdraft(2), lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(2)
1:01.939 default P chaos_bolt Fluffy_Pillow 635617.6/1100000: 58% mana | 3.0/5: 60% soul_shard backdraft(2), lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(2)
1:02.881 default Q conflagrate Fluffy_Pillow 649546.9/1100000: 59% mana | 1.0/5: 20% soul_shard backdraft, lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(2)
1:04.001 default S incinerate Fluffy_Pillow 666108.2/1100000: 61% mana | 2.0/5: 40% soul_shard backdraft(3), lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(2)
1:04.983 default P chaos_bolt Fluffy_Pillow 614629.0/1100000: 56% mana | 3.0/5: 60% soul_shard backdraft(2), lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(2)
1:05.924 default S incinerate Fluffy_Pillow 628459.9/1100000: 57% mana | 1.0/5: 20% soul_shard backdraft, lord_of_flames, conflagration_of_chaos, embrace_chaos
1:06.935 default S incinerate Fluffy_Pillow 576974.7/1100000: 52% mana | 1.0/5: 20% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando
1:08.358 default S incinerate Fluffy_Pillow 531709.7/1100000: 48% mana | 1.0/5: 20% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando
1:09.780 default Q conflagrate Fluffy_Pillow 486430.8/1100000: 44% mana | 1.0/5: 20% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(2)
1:10.900 default P chaos_bolt Fluffy_Pillow 502992.2/1100000: 46% mana | 2.0/5: 40% soul_shard backdraft(2), lord_of_flames, accelerando(2)
1:12.465 default R immolate Fluffy_Pillow 526133.7/1100000: 48% mana | 0.0/5: 0% soul_shard backdraft, lord_of_flames, embrace_chaos, nefarious_pact, accelerando(2)
1:13.241 default S incinerate Fluffy_Pillow 471608.4/1100000: 43% mana | 1.0/5: 20% soul_shard backdraft, lord_of_flames, embrace_chaos, nefarious_pact, accelerando(2)
1:13.996 default S incinerate Fluffy_Pillow 416772.5/1100000: 38% mana | 1.0/5: 20% soul_shard lord_of_flames, embrace_chaos, nefarious_pact, accelerando(2)
1:14.969 default F immolate enemy2 365160.2/1100000: 33% mana | 1.0/5: 20% soul_shard lord_of_flames, embrace_chaos, nefarious_pact, accelerando(2)
1:15.746 default I conflagrate Fluffy_Pillow 310649.7/1100000: 28% mana | 1.0/5: 20% soul_shard lord_of_flames, embrace_chaos, nefarious_pact, accelerando(2)
1:16.696 default P chaos_bolt Fluffy_Pillow 324697.2/1100000: 30% mana | 3.0/5: 60% soul_shard backdraft(2), lord_of_flames, nefarious_pact, accelerando(2)
1:17.783 default S incinerate Fluffy_Pillow 340770.6/1100000: 31% mana | 1.0/5: 20% soul_shard backdraft, lord_of_flames, embrace_chaos, nefarious_pact, accelerando(2)
1:18.535 default S incinerate Fluffy_Pillow 285890.4/1100000: 26% mana | 1.0/5: 20% soul_shard lord_of_flames, embrace_chaos, nefarious_pact, accelerando(2)
1:19.509 default S incinerate Fluffy_Pillow 234043.8/1100000: 21% mana | 1.0/5: 20% soul_shard lord_of_flames, embrace_chaos, nefarious_pact
1:20.511 default S incinerate Fluffy_Pillow 182428.6/1100000: 17% mana | 1.0/5: 20% soul_shard lord_of_flames, embrace_chaos, nefarious_pact
1:21.515 default C havoc enemy2 130843.3/1100000: 12% mana | 2.0/5: 40% soul_shard lord_of_flames, embrace_chaos, nefarious_pact, accelerando
1:22.305 default P chaos_bolt Fluffy_Pillow 54354.7/1100000: 5% mana | 2.0/5: 40% soul_shard lord_of_flames, nefarious_pact, accelerando
1:23.880 default I conflagrate Fluffy_Pillow 77372.4/1100000: 7% mana | 2.0/5: 40% soul_shard lord_of_flames, embrace_chaos, devils_due, accelerando(2)
1:25.197 default P chaos_bolt Fluffy_Pillow 96846.8/1100000: 9% mana | 3.0/5: 60% soul_shard backdraft(2), lord_of_flames, conflagration_of_chaos, embrace_chaos, devils_due, accelerando(2)
1:26.305 default P chaos_bolt Fluffy_Pillow 113246.2/1100000: 10% mana | 3.0/5: 60% soul_shard backdraft, lord_of_flames, conflagration_of_chaos, embrace_chaos, devils_due, accelerando(3)
1:27.396 default S incinerate Fluffy_Pillow 129613.7/1100000: 12% mana | 2.0/5: 40% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, devils_due, accelerando(3)
1:29.026 default R immolate Fluffy_Pillow 88067.3/1100000: 8% mana | 2.0/5: 40% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, devils_due, accelerando(3)
1:30.324 default P chaos_bolt Fluffy_Pillow 41540.2/1100000: 4% mana | 2.0/5: 40% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, devils_due, accelerando(3)
1:31.883 default O dimensional_rift Fluffy_Pillow 64928.7/1100000: 6% mana | 0.0/5: 0% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(3)
1:32.989 default F immolate enemy2 81521.2/1100000: 7% mana | 1.0/5: 20% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(3)
1:34.093 default Q conflagrate Fluffy_Pillow 31801.2/1100000: 3% mana | 2.0/5: 40% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando
1:35.229 default K service_imp Fluffy_Pillow 48354.3/1100000: 4% mana | 4.0/5: 80% soul_shard backdraft(2), lord_of_flames, embrace_chaos, accelerando
1:36.366 default I conflagrate Fluffy_Pillow 64921.9/1100000: 6% mana | 4.0/5: 80% soul_shard backdraft(2), lord_of_flames, accelerando
1:37.503 default P chaos_bolt Fluffy_Pillow 81489.5/1100000: 7% mana | 5.0/5: 100% soul_shard backdraft(4), lord_of_flames, accelerando
1:39.091 default P chaos_bolt Fluffy_Pillow 104732.0/1100000: 10% mana | 3.0/5: 60% soul_shard backdraft(3), lord_of_flames, embrace_chaos, accelerando(3)
1:40.019 default S incinerate Fluffy_Pillow 118654.1/1100000: 11% mana | 1.0/5: 20% soul_shard backdraft(2), lord_of_flames, embrace_chaos, accelerando(3)
1:40.986 default S incinerate Fluffy_Pillow 67161.3/1100000: 6% mana | 2.0/5: 40% soul_shard backdraft, lord_of_flames, embrace_chaos, accelerando(3)
1:41.956 default T life_tap Fluffy_Pillow 15714.8/1100000: 1% mana | 2.0/5: 40% soul_shard lord_of_flames, embrace_chaos, accelerando(4)
1:43.045 default C havoc enemy2 362287.0/1100000: 33% mana | 2.0/5: 40% soul_shard lord_of_flames, embrace_chaos, accelerando(4)
1:44.135 default I conflagrate Fluffy_Pillow 290874.4/1100000: 26% mana | 3.0/5: 60% soul_shard lord_of_flames, accelerando(4)
1:45.223 default P chaos_bolt Fluffy_Pillow 307431.4/1100000: 28% mana | 4.0/5: 80% soul_shard backdraft(2), lord_of_flames, conflagration_of_chaos, accelerando(4)
1:46.745 default P chaos_bolt Fluffy_Pillow 329651.0/1100000: 30% mana | 5.0/5: 100% soul_shard backdraft, lord_of_flames, conflagration_of_chaos, embrace_chaos
1:47.713 default P chaos_bolt Fluffy_Pillow 343547.7/1100000: 31% mana | 3.0/5: 60% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos
1:49.095 default E immolate Fluffy_Pillow 363387.7/1100000: 33% mana | 2.0/5: 40% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos
1:50.248 default P chaos_bolt Fluffy_Pillow 313940.2/1100000: 29% mana | 4.0/5: 80% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos
1:51.629 default P chaos_bolt Fluffy_Pillow 333926.3/1100000: 30% mana | 3.0/5: 60% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando
1:52.992 default Q conflagrate Fluffy_Pillow 353787.0/1100000: 32% mana | 1.0/5: 20% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando
1:54.129 default P chaos_bolt Fluffy_Pillow 370354.6/1100000: 34% mana | 3.0/5: 60% soul_shard backdraft(2), lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando
1:55.083 default S incinerate Fluffy_Pillow 384256.5/1100000: 35% mana | 1.0/5: 20% soul_shard backdraft, lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(2)
1:56.067 default Q conflagrate Fluffy_Pillow 332806.9/1100000: 30% mana | 1.0/5: 20% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(2)
1:57.434 default S incinerate Fluffy_Pillow 353020.6/1100000: 32% mana | 2.0/5: 40% soul_shard backdraft(2), lord_of_flames, embrace_chaos, accelerando(2)
1:58.417 default P chaos_bolt Fluffy_Pillow 301556.1/1100000: 27% mana | 3.0/5: 60% soul_shard backdraft, lord_of_flames, embrace_chaos, accelerando(2)
1:59.356 default P chaos_bolt Fluffy_Pillow 315441.1/1100000: 29% mana | 3.0/5: 60% soul_shard lord_of_flames, embrace_chaos, accelerando(2)
2:00.699 default P chaos_bolt Fluffy_Pillow 335299.9/1100000: 30% mana | 5.0/5: 100% soul_shard lord_of_flames, embrace_chaos, accelerando(2)
2:02.041 default P chaos_bolt Fluffy_Pillow 355144.0/1100000: 32% mana | 4.0/5: 80% soul_shard lord_of_flames, embrace_chaos, accelerando(2)
2:03.384 default C havoc enemy2 374787.4/1100000: 34% mana | 4.0/5: 80% soul_shard lord_of_flames, embrace_chaos
2:04.539 default I conflagrate Fluffy_Pillow 303405.0/1100000: 28% mana | 4.0/5: 80% soul_shard lord_of_flames, embrace_chaos, accelerando
2:05.676 default N soul_harvest Fluffy_Pillow 319972.6/1100000: 29% mana | 5.0/5: 100% soul_shard backdraft(2), lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando
2:05.901 default H potion Fluffy_Pillow 323251.1/1100000: 29% mana | 5.0/5: 100% soul_shard soul_harvest, backdraft(2), lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando
2:05.901 default P chaos_bolt Fluffy_Pillow 323251.1/1100000: 29% mana | 5.0/5: 100% soul_shard soul_harvest, backdraft(2), lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando, potion_of_deadly_grace
2:06.854 default E immolate Fluffy_Pillow 337177.7/1100000: 31% mana | 5.0/5: 100% soul_shard soul_harvest, backdraft, lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(2), potion_of_deadly_grace
2:07.972 default P chaos_bolt Fluffy_Pillow 287747.8/1100000: 26% mana | 5.0/5: 100% soul_shard soul_harvest, backdraft, lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(3), potion_of_deadly_grace
2:08.901 default P chaos_bolt Fluffy_Pillow 301684.9/1100000: 27% mana | 4.0/5: 80% soul_shard soul_harvest, lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(3), potion_of_deadly_grace
2:10.225 default P chaos_bolt Fluffy_Pillow 321547.9/1100000: 29% mana | 4.0/5: 80% soul_shard soul_harvest, lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(3), potion_of_deadly_grace
2:11.549 default Q conflagrate Fluffy_Pillow 341511.3/1100000: 31% mana | 2.0/5: 40% soul_shard soul_harvest, lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(4), potion_of_deadly_grace
2:12.638 default P chaos_bolt Fluffy_Pillow 358172.7/1100000: 33% mana | 3.0/5: 60% soul_shard soul_harvest, backdraft(2), lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(5), potion_of_deadly_grace
2:13.538 default S incinerate Fluffy_Pillow 372062.5/1100000: 34% mana | 2.0/5: 40% soul_shard soul_harvest, backdraft, lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(5), potion_of_deadly_grace
2:14.480 default S incinerate Fluffy_Pillow 320600.5/1100000: 29% mana | 2.0/5: 40% soul_shard soul_harvest, lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(5), potion_of_deadly_grace
2:15.824 default S incinerate Fluffy_Pillow 275342.7/1100000: 25% mana | 2.0/5: 40% soul_shard soul_harvest, lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(5), potion_of_deadly_grace
2:17.167 default O dimensional_rift Fluffy_Pillow 229210.9/1100000: 21% mana | 2.0/5: 40% soul_shard soul_harvest, lord_of_flames, conflagration_of_chaos, embrace_chaos, potion_of_deadly_grace
2:18.319 default P chaos_bolt Fluffy_Pillow 245749.1/1100000: 22% mana | 2.0/5: 40% soul_shard soul_harvest, lord_of_flames, conflagration_of_chaos, potion_of_deadly_grace
2:20.622 default Q conflagrate Fluffy_Pillow 278811.0/1100000: 25% mana | 0.0/5: 0% soul_shard soul_harvest, lord_of_flames, conflagration_of_chaos, embrace_chaos, potion_of_deadly_grace
2:21.775 default R immolate Fluffy_Pillow 295363.5/1100000: 27% mana | 1.0/5: 20% soul_shard soul_harvest, backdraft(2), lord_of_flames, conflagration_of_chaos, embrace_chaos, potion_of_deadly_grace
2:22.928 default Q conflagrate Fluffy_Pillow 245916.9/1100000: 22% mana | 2.0/5: 40% soul_shard soul_harvest, backdraft(2), lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando, potion_of_deadly_grace
2:24.065 default C havoc enemy2 262484.5/1100000: 24% mana | 3.0/5: 60% soul_shard soul_harvest, backdraft(4), lord_of_flames, embrace_chaos, accelerando, potion_of_deadly_grace
2:25.201 default P chaos_bolt Fluffy_Pillow 191037.5/1100000: 17% mana | 3.0/5: 60% soul_shard backdraft(4), lord_of_flames, accelerando, potion_of_deadly_grace
2:26.791 default F immolate enemy2 214443.7/1100000: 19% mana | 3.0/5: 60% soul_shard backdraft(3), lord_of_flames, embrace_chaos, accelerando(2), potion_of_deadly_grace
2:27.910 default P chaos_bolt Fluffy_Pillow 164990.3/1100000: 15% mana | 3.0/5: 60% soul_shard backdraft(3), lord_of_flames, embrace_chaos, accelerando(2), potion_of_deadly_grace
2:28.851 default S incinerate Fluffy_Pillow 178904.8/1100000: 16% mana | 1.0/5: 20% soul_shard backdraft(2), lord_of_flames, embrace_chaos, accelerando(2), potion_of_deadly_grace
2:29.832 default I conflagrate Fluffy_Pillow 127410.8/1100000: 12% mana | 1.0/5: 20% soul_shard backdraft, lord_of_flames, embrace_chaos, accelerando(2), potion_of_deadly_grace
2:30.949 default S incinerate Fluffy_Pillow 143927.8/1100000: 13% mana | 2.0/5: 40% soul_shard backdraft(3), lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(2), potion_of_deadly_grace
2:31.932 default P chaos_bolt Fluffy_Pillow 92463.4/1100000: 8% mana | 2.0/5: 40% soul_shard backdraft(2), lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(2), potion_of_deadly_grace
2:32.871 default S incinerate Fluffy_Pillow 106348.3/1100000: 10% mana | 1.0/5: 20% soul_shard backdraft, lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(2), potion_of_deadly_grace
2:33.852 default T life_tap Fluffy_Pillow 54949.7/1100000: 5% mana | 1.0/5: 20% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(3), potion_of_deadly_grace
2:34.956 default S incinerate Fluffy_Pillow 401491.5/1100000: 36% mana | 1.0/5: 20% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, potion_of_deadly_grace
2:36.401 default P chaos_bolt Fluffy_Pillow 356235.9/1100000: 32% mana | 2.0/5: 40% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos
2:37.784 default Q conflagrate Fluffy_Pillow 376090.3/1100000: 34% mana | 0.0/5: 0% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos
2:38.938 default S incinerate Fluffy_Pillow 392657.2/1100000: 36% mana | 1.0/5: 20% soul_shard backdraft(2), lord_of_flames, conflagration_of_chaos, embrace_chaos
2:39.950 default R immolate Fluffy_Pillow 341359.4/1100000: 31% mana | 1.0/5: 20% soul_shard backdraft, lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando
2:41.085 default S incinerate Fluffy_Pillow 291898.5/1100000: 27% mana | 1.0/5: 20% soul_shard backdraft, lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(2)
2:42.067 default S incinerate Fluffy_Pillow 240419.3/1100000: 22% mana | 1.0/5: 20% soul_shard lord_of_flames, conflagration_of_chaos, accelerando(2)
2:43.470 default P chaos_bolt Fluffy_Pillow 195165.4/1100000: 18% mana | 2.0/5: 40% soul_shard lord_of_flames, conflagration_of_chaos, accelerando(2)
2:45.707 default C havoc enemy2 228243.7/1100000: 21% mana | 0.0/5: 0% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(2)
2:46.827 default F immolate enemy2 156805.1/1100000: 14% mana | 1.0/5: 20% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(2)
2:47.947 default Q conflagrate Fluffy_Pillow 107578.5/1100000: 10% mana | 2.0/5: 40% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(3)
2:49.049 default P chaos_bolt Fluffy_Pillow 124111.0/1100000: 11% mana | 3.0/5: 60% soul_shard backdraft(2), lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(3)
2:49.976 default Q conflagrate Fluffy_Pillow 138186.9/1100000: 13% mana | 1.0/5: 20% soul_shard backdraft, lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(4)
2:51.065 default S incinerate Fluffy_Pillow 154759.1/1100000: 14% mana | 2.0/5: 40% soul_shard backdraft(3), lord_of_flames, embrace_chaos, accelerando(4)
2:52.020 default S incinerate Fluffy_Pillow 102670.7/1100000: 9% mana | 2.0/5: 40% soul_shard backdraft(2), lord_of_flames, embrace_chaos, accelerando
2:53.018 default P chaos_bolt Fluffy_Pillow 51212.9/1100000: 5% mana | 3.0/5: 60% soul_shard backdraft, lord_of_flames, embrace_chaos, accelerando
2:53.973 default P chaos_bolt Fluffy_Pillow 65128.5/1100000: 6% mana | 4.0/5: 80% soul_shard lord_of_flames, embrace_chaos, accelerando
2:55.337 default S incinerate Fluffy_Pillow 85003.8/1100000: 8% mana | 2.0/5: 40% soul_shard lord_of_flames, embrace_chaos, accelerando
2:56.761 default I conflagrate Fluffy_Pillow 39753.4/1100000: 4% mana | 2.0/5: 40% soul_shard lord_of_flames, embrace_chaos, accelerando
2:57.898 default P chaos_bolt Fluffy_Pillow 56321.0/1100000: 5% mana | 3.0/5: 60% soul_shard backdraft(2), lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando
2:58.852 default R immolate Fluffy_Pillow 70222.1/1100000: 6% mana | 2.0/5: 40% soul_shard backdraft, lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando
2:59.989 default T life_tap Fluffy_Pillow 20789.7/1100000: 2% mana | 2.0/5: 40% soul_shard backdraft, lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando
3:01.125 default O dimensional_rift Fluffy_Pillow 367342.7/1100000: 33% mana | 2.0/5: 40% soul_shard backdraft, lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando
3:02.276 default P chaos_bolt Fluffy_Pillow 384310.7/1100000: 35% mana | 2.0/5: 40% soul_shard backdraft, lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(2)
3:03.217 default G berserking Fluffy_Pillow 398225.2/1100000: 36% mana | 2.0/5: 40% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(2)
3:03.217 default Q conflagrate Fluffy_Pillow 398225.2/1100000: 36% mana | 2.0/5: 40% soul_shard berserking, lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(2)
3:04.285 default F immolate enemy2 415944.0/1100000: 38% mana | 3.0/5: 60% soul_shard berserking, backdraft(2), lord_of_flames, conflagration_of_chaos, embrace_chaos
3:05.290 default K service_imp Fluffy_Pillow 366537.5/1100000: 33% mana | 4.0/5: 80% soul_shard berserking, backdraft(2), lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando
3:06.278 default C havoc enemy2 383093.4/1100000: 35% mana | 4.0/5: 80% soul_shard berserking, backdraft(2), lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando
3:07.266 default P chaos_bolt Fluffy_Pillow 311721.5/1100000: 28% mana | 4.0/5: 80% soul_shard berserking, backdraft(2), lord_of_flames, conflagration_of_chaos, accelerando(2)
3:08.628 default S incinerate Fluffy_Pillow 335138.8/1100000: 30% mana | 2.0/5: 40% soul_shard berserking, backdraft, lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(4)
3:09.459 default P chaos_bolt Fluffy_Pillow 283681.7/1100000: 26% mana | 3.0/5: 60% soul_shard berserking, lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(4)
3:10.595 default Q conflagrate Fluffy_Pillow 303562.3/1100000: 28% mana | 1.0/5: 20% soul_shard berserking, lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(4)
3:11.541 default S incinerate Fluffy_Pillow 320117.8/1100000: 29% mana | 2.0/5: 40% soul_shard berserking, backdraft(2), lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(4)
3:12.372 default S incinerate Fluffy_Pillow 268662.0/1100000: 24% mana | 2.0/5: 40% soul_shard berserking, backdraft, lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(5)
3:13.191 default P chaos_bolt Fluffy_Pillow 217197.7/1100000: 20% mana | 3.0/5: 60% soul_shard berserking, lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(5)
3:14.311 default S incinerate Fluffy_Pillow 234543.0/1100000: 21% mana | 2.0/5: 40% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(5)
3:15.655 default P chaos_bolt Fluffy_Pillow 189285.2/1100000: 17% mana | 4.0/5: 80% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(5)
3:16.942 default P chaos_bolt Fluffy_Pillow 209147.6/1100000: 19% mana | 3.0/5: 60% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(5)
3:18.230 default Q conflagrate Fluffy_Pillow 228007.8/1100000: 21% mana | 2.0/5: 40% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando
3:19.368 default E immolate Fluffy_Pillow 244590.0/1100000: 22% mana | 4.0/5: 80% soul_shard backdraft(2), lord_of_flames, embrace_chaos, accelerando
3:20.506 default P chaos_bolt Fluffy_Pillow 195172.2/1100000: 18% mana | 4.0/5: 80% soul_shard backdraft(2), lord_of_flames, embrace_chaos, accelerando
3:21.461 default I conflagrate Fluffy_Pillow 209087.8/1100000: 19% mana | 3.0/5: 60% soul_shard backdraft, lord_of_flames, embrace_chaos, accelerando
3:22.599 default F immolate enemy2 225670.0/1100000: 21% mana | 4.0/5: 80% soul_shard backdraft(3), lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando
3:23.735 default P chaos_bolt Fluffy_Pillow 176223.0/1100000: 16% mana | 4.0/5: 80% soul_shard backdraft(3), lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando
3:24.689 default P chaos_bolt Fluffy_Pillow 190124.1/1100000: 17% mana | 4.0/5: 80% soul_shard backdraft(2), lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando
3:25.644 default S incinerate Fluffy_Pillow 204040.8/1100000: 19% mana | 2.0/5: 40% soul_shard backdraft, lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(2)
3:26.628 default C havoc enemy2 152591.1/1100000: 14% mana | 2.0/5: 40% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(2)
3:27.748 default P chaos_bolt Fluffy_Pillow 81152.5/1100000: 7% mana | 3.0/5: 60% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(2)
3:29.091 default Q conflagrate Fluffy_Pillow 101012.4/1100000: 9% mana | 2.0/5: 40% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(3)
3:30.194 default P chaos_bolt Fluffy_Pillow 117559.9/1100000: 11% mana | 3.0/5: 60% soul_shard backdraft(2), lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(3)
3:31.122 default S incinerate Fluffy_Pillow 130902.8/1100000: 12% mana | 1.0/5: 20% soul_shard backdraft, lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando
3:32.119 default S incinerate Fluffy_Pillow 79433.2/1100000: 7% mana | 1.0/5: 20% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(2)
3:33.520 default T life_tap Fluffy_Pillow 34150.3/1100000: 3% mana | 2.0/5: 40% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, nefarious_pact, accelerando(3)
3:34.287 default P chaos_bolt Fluffy_Pillow 375657.0/1100000: 34% mana | 2.0/5: 40% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, nefarious_pact, accelerando(3)
3:35.204 default Q conflagrate Fluffy_Pillow 389414.1/1100000: 35% mana | 1.0/5: 20% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, nefarious_pact, accelerando(3)
3:35.971 default R immolate Fluffy_Pillow 400937.4/1100000: 36% mana | 2.0/5: 40% soul_shard backdraft(2), lord_of_flames, embrace_chaos, nefarious_pact, accelerando(4)
3:36.726 default S incinerate Fluffy_Pillow 346426.9/1100000: 31% mana | 2.0/5: 40% soul_shard backdraft(2), lord_of_flames, embrace_chaos, nefarious_pact, accelerando(4)
3:37.482 default P chaos_bolt Fluffy_Pillow 291931.6/1100000: 27% mana | 3.0/5: 60% soul_shard backdraft, lord_of_flames, embrace_chaos, nefarious_pact, accelerando(4)
3:38.238 default S incinerate Fluffy_Pillow 303436.2/1100000: 28% mana | 2.0/5: 40% soul_shard lord_of_flames, embrace_chaos, nefarious_pact, accelerando(4)
3:39.184 default P chaos_bolt Fluffy_Pillow 251832.3/1100000: 23% mana | 3.0/5: 60% soul_shard lord_of_flames, embrace_chaos, nefarious_pact, accelerando(4)
3:40.089 default S incinerate Fluffy_Pillow 265604.5/1100000: 24% mana | 1.0/5: 20% soul_shard lord_of_flames, embrace_chaos, nefarious_pact, accelerando(4)
3:41.035 default F immolate enemy2 214000.5/1100000: 19% mana | 1.0/5: 20% soul_shard lord_of_flames, embrace_chaos, nefarious_pact, accelerando(4)
3:41.789 default I conflagrate Fluffy_Pillow 159474.8/1100000: 14% mana | 1.0/5: 20% soul_shard lord_of_flames, embrace_chaos, nefarious_pact, accelerando(4)
3:42.545 default S incinerate Fluffy_Pillow 171109.3/1100000: 16% mana | 2.0/5: 40% soul_shard backdraft(2), lord_of_flames, conflagration_of_chaos, embrace_chaos, nefarious_pact, accelerando(5)
3:43.300 default S incinerate Fluffy_Pillow 116564.2/1100000: 11% mana | 2.0/5: 40% soul_shard backdraft, lord_of_flames, conflagration_of_chaos, embrace_chaos, nefarious_pact
3:44.054 default P chaos_bolt Fluffy_Pillow 61388.7/1100000: 6% mana | 2.0/5: 40% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, nefarious_pact
3:45.014 default S incinerate Fluffy_Pillow 75171.5/1100000: 7% mana | 1.0/5: 20% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, devils_due, accelerando
3:46.689 default O dimensional_rift Fluffy_Pillow 33578.5/1100000: 3% mana | 2.0/5: 40% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, devils_due, accelerando
3:48.027 default P chaos_bolt Fluffy_Pillow 53075.0/1100000: 5% mana | 3.0/5: 60% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, devils_due, accelerando
3:49.633 default M summon_doomguard Fluffy_Pillow 76476.5/1100000: 7% mana | 1.0/5: 20% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, devils_due, accelerando
3:50.972 default C havoc enemy2 95987.5/1100000: 9% mana | 0.0/5: 0% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, devils_due, accelerando
3:52.310 default Q conflagrate Fluffy_Pillow 27484.0/1100000: 2% mana | 0.0/5: 0% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, devils_due, accelerando
3:53.649 default P chaos_bolt Fluffy_Pillow 47130.2/1100000: 4% mana | 2.0/5: 40% soul_shard backdraft(2), lord_of_flames, conflagration_of_chaos, accelerando(2)
3:55.215 default E immolate Fluffy_Pillow 70286.5/1100000: 6% mana | 1.0/5: 20% soul_shard backdraft, lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(2)
3:56.334 default Q conflagrate Fluffy_Pillow 21062.0/1100000: 2% mana | 2.0/5: 40% soul_shard backdraft, lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(3)
3:57.438 default P chaos_bolt Fluffy_Pillow 37347.2/1100000: 3% mana | 3.0/5: 60% soul_shard backdraft(3), lord_of_flames, embrace_chaos
3:58.407 default T life_tap Fluffy_Pillow 51258.2/1100000: 5% mana | 2.0/5: 40% soul_shard backdraft(2), lord_of_flames, embrace_chaos
3:59.560 default P chaos_bolt Fluffy_Pillow 397810.7/1100000: 36% mana | 3.0/5: 60% soul_shard backdraft(2), lord_of_flames, embrace_chaos
4:00.529 default S incinerate Fluffy_Pillow 411878.6/1100000: 37% mana | 1.0/5: 20% soul_shard backdraft, lord_of_flames, embrace_chaos, accelerando
4:01.527 default S incinerate Fluffy_Pillow 360420.8/1100000: 33% mana | 2.0/5: 40% soul_shard lord_of_flames, embrace_chaos, accelerando
4:02.950 default I conflagrate Fluffy_Pillow 315155.8/1100000: 29% mana | 2.0/5: 40% soul_shard lord_of_flames, embrace_chaos, accelerando
4:04.087 default P chaos_bolt Fluffy_Pillow 331723.5/1100000: 30% mana | 4.0/5: 80% soul_shard backdraft(2), lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando
4:05.042 default S incinerate Fluffy_Pillow 345639.1/1100000: 31% mana | 2.0/5: 40% soul_shard backdraft, lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando
4:06.040 default N soul_harvest Fluffy_Pillow 294181.3/1100000: 27% mana | 2.0/5: 40% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando
4:06.040 default S incinerate Fluffy_Pillow 294181.3/1100000: 27% mana | 2.0/5: 40% soul_shard soul_harvest, lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando
4:07.464 default S incinerate Fluffy_Pillow 249112.6/1100000: 23% mana | 2.0/5: 40% soul_shard soul_harvest, lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(3)
4:08.846 default P chaos_bolt Fluffy_Pillow 203845.7/1100000: 19% mana | 2.0/5: 40% soul_shard soul_harvest, lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(3)
4:10.171 default Q conflagrate Fluffy_Pillow 223725.0/1100000: 20% mana | 1.0/5: 20% soul_shard soul_harvest, lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(4)
4:11.257 default C havoc enemy2 240251.5/1100000: 22% mana | 2.0/5: 40% soul_shard soul_harvest, backdraft(2), lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(4)
4:12.344 default R immolate Fluffy_Pillow 168324.5/1100000: 15% mana | 2.0/5: 40% soul_shard soul_harvest, backdraft(2), lord_of_flames, conflagration_of_chaos, embrace_chaos
4:13.495 default P chaos_bolt Fluffy_Pillow 118899.5/1100000: 11% mana | 3.0/5: 60% soul_shard soul_harvest, backdraft(2), lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando
4:14.450 default S incinerate Fluffy_Pillow 132815.1/1100000: 12% mana | 2.0/5: 40% soul_shard soul_harvest, backdraft, lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando
4:15.447 default Q conflagrate Fluffy_Pillow 81342.8/1100000: 7% mana | 2.0/5: 40% soul_shard soul_harvest, lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando
4:16.585 default P chaos_bolt Fluffy_Pillow 97924.9/1100000: 9% mana | 3.0/5: 60% soul_shard soul_harvest, backdraft(2), lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando
4:17.540 default S incinerate Fluffy_Pillow 111840.6/1100000: 10% mana | 2.0/5: 40% soul_shard soul_harvest, backdraft, lord_of_flames, conflagration_of_chaos, embrace_chaos, nefarious_pact, accelerando
4:18.297 default T life_tap Fluffy_Pillow 56871.1/1100000: 5% mana | 2.0/5: 40% soul_shard soul_harvest, lord_of_flames, conflagration_of_chaos, embrace_chaos, nefarious_pact, accelerando
4:19.085 default S incinerate Fluffy_Pillow 398353.3/1100000: 36% mana | 2.0/5: 40% soul_shard soul_harvest, lord_of_flames, conflagration_of_chaos, embrace_chaos, nefarious_pact, accelerando
4:20.073 default P chaos_bolt Fluffy_Pillow 346903.3/1100000: 32% mana | 5.0/5: 100% soul_shard soul_harvest, lord_of_flames, conflagration_of_chaos, embrace_chaos, nefarious_pact, accelerando(3)
4:20.992 default P chaos_bolt Fluffy_Pillow 360690.3/1100000: 33% mana | 3.0/5: 60% soul_shard soul_harvest, lord_of_flames, conflagration_of_chaos, embrace_chaos, nefarious_pact, accelerando(3)
4:21.910 default Q conflagrate Fluffy_Pillow 374462.4/1100000: 34% mana | 2.0/5: 40% soul_shard soul_harvest, lord_of_flames, conflagration_of_chaos, embrace_chaos, nefarious_pact, accelerando(3)
4:22.878 default P chaos_bolt Fluffy_Pillow 388984.5/1100000: 35% mana | 4.0/5: 80% soul_shard soul_harvest, backdraft(2), lord_of_flames, embrace_chaos, nefarious_pact, accelerando(3)
4:23.632 default S incinerate Fluffy_Pillow 400321.0/1100000: 36% mana | 2.0/5: 40% soul_shard soul_harvest, backdraft, lord_of_flames, embrace_chaos, nefarious_pact, accelerando(4)
4:24.387 default P chaos_bolt Fluffy_Pillow 345810.5/1100000: 31% mana | 3.0/5: 60% soul_shard soul_harvest, lord_of_flames, embrace_chaos, nefarious_pact, accelerando(4)
4:25.293 default P chaos_bolt Fluffy_Pillow 359566.8/1100000: 33% mana | 3.0/5: 60% soul_shard lord_of_flames, embrace_chaos, nefarious_pact
4:26.253 default P chaos_bolt Fluffy_Pillow 373348.6/1100000: 34% mana | 3.0/5: 60% soul_shard lord_of_flames, embrace_chaos, nefarious_pact
4:27.213 default P chaos_bolt Fluffy_Pillow 387130.4/1100000: 35% mana | 3.0/5: 60% soul_shard lord_of_flames, embrace_chaos, nefarious_pact
4:28.172 default R immolate Fluffy_Pillow 400898.7/1100000: 36% mana | 1.0/5: 20% soul_shard lord_of_flames, embrace_chaos, nefarious_pact, accelerando
4:28.961 default I conflagrate Fluffy_Pillow 346458.6/1100000: 31% mana | 2.0/5: 40% soul_shard lord_of_flames, embrace_chaos, nefarious_pact, accelerando(2)
4:29.738 default P chaos_bolt Fluffy_Pillow 357948.1/1100000: 33% mana | 3.0/5: 60% soul_shard backdraft(2), lord_of_flames, embrace_chaos, devils_due, accelerando(2)
4:30.846 default S incinerate Fluffy_Pillow 374332.0/1100000: 34% mana | 2.0/5: 40% soul_shard backdraft, lord_of_flames, embrace_chaos, devils_due, accelerando(2)
4:32.003 default C havoc enemy2 325441.6/1100000: 30% mana | 2.0/5: 40% soul_shard lord_of_flames, embrace_chaos, devils_due, accelerando(3)
4:33.301 default O dimensional_rift Fluffy_Pillow 256914.5/1100000: 23% mana | 3.0/5: 60% soul_shard lord_of_flames, embrace_chaos, devils_due, accelerando(3)
4:34.600 default F immolate enemy2 276402.4/1100000: 25% mana | 3.0/5: 60% soul_shard lord_of_flames, embrace_chaos, devils_due, accelerando(3)
4:35.899 default I conflagrate Fluffy_Pillow 229890.3/1100000: 21% mana | 3.0/5: 60% soul_shard lord_of_flames, devils_due, accelerando(3)
4:37.199 default K service_imp Fluffy_Pillow 249393.2/1100000: 23% mana | 4.0/5: 80% soul_shard backdraft(2), lord_of_flames, accelerando(3)
4:38.303 default P chaos_bolt Fluffy_Pillow 265955.7/1100000: 24% mana | 4.0/5: 80% soul_shard backdraft(2), lord_of_flames, accelerando(3)
4:39.846 default S incinerate Fluffy_Pillow 289105.0/1100000: 26% mana | 2.0/5: 40% soul_shard backdraft, lord_of_flames, embrace_chaos, accelerando(4)
4:40.802 default P chaos_bolt Fluffy_Pillow 237106.9/1100000: 22% mana | 4.0/5: 80% soul_shard lord_of_flames, embrace_chaos
4:42.185 default I conflagrate Fluffy_Pillow 256962.3/1100000: 23% mana | 2.0/5: 40% soul_shard lord_of_flames, embrace_chaos, accelerando
4:43.321 default P chaos_bolt Fluffy_Pillow 273515.4/1100000: 25% mana | 4.0/5: 80% soul_shard backdraft(2), lord_of_flames, embrace_chaos, accelerando
4:44.275 default P chaos_bolt Fluffy_Pillow 287416.4/1100000: 26% mana | 3.0/5: 60% soul_shard backdraft, lord_of_flames, embrace_chaos, accelerando
4:45.231 default P chaos_bolt Fluffy_Pillow 301346.6/1100000: 27% mana | 3.0/5: 60% soul_shard lord_of_flames, embrace_chaos, accelerando
4:46.594 default R immolate Fluffy_Pillow 321207.3/1100000: 29% mana | 2.0/5: 40% soul_shard lord_of_flames, embrace_chaos, accelerando
4:47.732 default S incinerate Fluffy_Pillow 271789.5/1100000: 25% mana | 2.0/5: 40% soul_shard lord_of_flames, embrace_chaos, accelerando
4:49.155 default I conflagrate Fluffy_Pillow 226525.4/1100000: 21% mana | 2.0/5: 40% soul_shard lord_of_flames, embrace_chaos, accelerando(2)
4:50.275 default P chaos_bolt Fluffy_Pillow 243086.8/1100000: 22% mana | 5.0/5: 100% soul_shard backdraft(2), lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(2)
4:51.216 default P chaos_bolt Fluffy_Pillow 257001.3/1100000: 23% mana | 3.0/5: 60% soul_shard backdraft, lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(2)
4:52.157 default C havoc enemy2 270915.8/1100000: 25% mana | 2.0/5: 40% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(2)
4:53.277 default F immolate enemy2 199477.1/1100000: 18% mana | 2.0/5: 40% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(2)
4:54.397 default S incinerate Fluffy_Pillow 150031.8/1100000: 14% mana | 2.0/5: 40% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos
4:55.841 default P chaos_bolt Fluffy_Pillow 104761.9/1100000: 10% mana | 2.0/5: 40% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos

Stats

Raid-Buffed Unbuffed Gear Amount
Strength 4201 3876 0
Agility 7254 6929 0
Stamina 55081 55081 34467
Intellect 50545 48839 39190 (1278)
Spirit 1 1 0
Health 3304860 3304860 0
Mana 1100000 1100000 0
Soul Shard 5 5 0
Spell Power 50545 48839 0
Crit 13.94% 13.94% 3577
Haste 30.51% 29.51% 11066
Damage / Heal Versatility 5.96% 5.96% 2829
ManaReg per Second 14356 14246 0
Mastery 66.72% 66.72% 5695
Armor 1981 1981 1981
Run Speed 7 0 0

Gear

Source Slot Average Item Level: 906.00
Local Head Eyes of Azj'Aqir
ilevel: 900, stats: { 253 Armor, +3255 Sta, +2170 Int, +1074 Haste, +578 Vers }
Local Neck Radiant String of Scorpid Eyes
ilevel: 900, stats: { +1831 Sta, +2011 Haste, +922 Crit }, enchant: mark_of_the_hidden_satyr
Local Shoulders Pauldrons of Azj'Aqir
ilevel: 900, stats: { 233 Armor, +2442 Sta, +1628 Int, +752 Mastery, +487 Vers }
Local Chest Robes of Fluctuating Energy
ilevel: 900, stats: { 311 Armor, +3255 Sta, +2170 Int, +1145 Haste, +507 Mastery }
Local Waist Feretory of Souls
ilevel: 940, stats: { 202 Armor, +3544 Sta, +2362 Int, +822 Haste, +617 Mastery }
Local Legs Leggings of Azj'Aqir
ilevel: 900, stats: { 272 Armor, +3255 Sta, +2170 Int, +932 Crit, +720 Haste }
Local Feet Outcast Wanderer's Footrags
ilevel: 910, stats: { 222 Armor, +2680 Sta, +1786 Int, +864 Crit, +422 Mastery }
Local Wrists Woven Lasher Tendril Bracers
ilevel: 900, stats: { 136 Armor, +1831 Sta, +1221 Int, +644 Haste, +285 Vers }
Local Hands Clutch of Azj'Aqir
ilevel: 900, stats: { 194 Armor, +2442 Sta, +1628 Int, +859 Crit, +380 Mastery }
Local Finger1 Ring of the Scoured Clan
ilevel: 900, stats: { +1831 Sta, +2095 Mastery, +838 Haste }, enchant: { +200 Haste }
Local Finger2 Ring of Braided Stems
ilevel: 905, stats: { +1918 Sta, +1814 Haste, +1209 Vers }, enchant: { +200 Haste }
Local Trinket1 Whispers in the Dark
ilevel: 905, stats: { +2162 Int }
Local Trinket2 Erratic Metronome
ilevel: 900, stats: { +2063 Int }
Local Back Astromancer's Greatcloak
ilevel: 905, stats: { 158 Armor, +1918 Sta, +1278 StrAgiInt, +676 Haste, +270 Vers }, enchant: { +200 Int }
Local Main Hand Scepter of Sargeras
ilevel: 929, weapon: { 7005 - 10509, 3.6 }, stats: { +2843 Int, +4265 Sta, +922 Haste, +922 Mastery, +15509 Int }, relics: { +61 ilevels, +59 ilevels, +61 ilevels }

Talents

Level
15 Backdraft (Destruction Warlock) Roaring Blaze (Destruction Warlock) Shadowburn (Destruction Warlock)
30 Reverse Entropy (Destruction Warlock) Eradication (Destruction Warlock) Empowered Life Tap
45 Demonic Circle Mortal Coil Shadowfury
60 Cataclysm (Destruction Warlock) Fire and Brimstone (Destruction Warlock) Soul Harvest
75 Demon Skin Burning Rush Dark Pact
90 Grimoire of Supremacy Grimoire of Service Grimoire of Sacrifice
100 Wreak Havoc (Destruction Warlock) Channel Demonfire (Destruction Warlock) Soul Conduit

Profile

warlock="Meme_Build"
level=110
race=troll
role=spell
position=back
talents=1203023
artifact=38:0:0:0:0:803:1:804:3:805:3:806:3:807:3:808:3:809:3:810:3:811:3:812:3:813:1:814:1:815:1:816:1:817:1:818:1:1355:1:1392:1:1609:4:1610:1:1611:1:1713:1
spec=destruction

# This default action priority list is automatically created based on your character.
# It is a attempt to provide you with a action list that is both simple and practicable,
# while resulting in a meaningful and good simulation. It may not result in the absolutely highest possible dps.
# Feel free to edit, adapt and improve it to your own needs.
# SimulationCraft is always looking for updates and improvements to the default action lists.

# Executed before combat begins. Accepts non-harmful actions only.
actions.precombat=flask,type=whispered_pact
actions.precombat+=/food,type=azshari_salad
actions.precombat+=/summon_pet,if=!talent.grimoire_of_supremacy.enabled&(!talent.grimoire_of_sacrifice.enabled|buff.demonic_power.down)
actions.precombat+=/summon_infernal,if=talent.grimoire_of_supremacy.enabled&artifact.lord_of_flames.rank>0
actions.precombat+=/summon_infernal,if=talent.grimoire_of_supremacy.enabled&active_enemies>1
actions.precombat+=/summon_doomguard,if=talent.grimoire_of_supremacy.enabled&active_enemies=1&artifact.lord_of_flames.rank=0
actions.precombat+=/augmentation,type=defiled
actions.precombat+=/snapshot_stats
actions.precombat+=/grimoire_of_sacrifice,if=talent.grimoire_of_sacrifice.enabled
actions.precombat+=/life_tap,if=talent.empowered_life_tap.enabled&!buff.empowered_life_tap.remains
actions.precombat+=/potion,name=prolonged_power
actions.precombat+=/chaos_bolt

# Executed every time the actor is available.
actions=havoc,target=2,if=active_enemies>1&(active_enemies<4|talent.wreak_havoc.enabled&active_enemies<6)&!debuff.havoc.remains
actions+=/dimensional_rift,if=charges=3
actions+=/immolate,if=remains<=tick_time
actions+=/immolate,cycle_targets=1,if=active_enemies>1&remains<=tick_time&(!talent.roaring_blaze.enabled|(!debuff.roaring_blaze.remains&action.conflagrate.charges<2+set_bonus.tier19_4pc))
actions+=/immolate,if=talent.roaring_blaze.enabled&remains<=duration&!debuff.roaring_blaze.remains&target.time_to_die>10&(action.conflagrate.charges=2+set_bonus.tier19_4pc|(action.conflagrate.charges>=1+set_bonus.tier19_4pc&action.conflagrate.recharge_time<cast_time+gcd)|target.time_to_die<24)
actions+=/berserking
actions+=/blood_fury
actions+=/arcane_torrent
actions+=/potion,name=deadly_grace,if=(buff.soul_harvest.remains|trinket.proc.any.react|target.time_to_die<=45)
actions+=/shadowburn,if=buff.conflagration_of_chaos.remains<=action.chaos_bolt.cast_time
actions+=/shadowburn,if=(charges=1+set_bonus.tier19_4pc&recharge_time<action.chaos_bolt.cast_time|charges=2+set_bonus.tier19_4pc)&soul_shard<5
actions+=/conflagrate,if=talent.roaring_blaze.enabled&(charges=2+set_bonus.tier19_4pc|(charges>=1+set_bonus.tier19_4pc&recharge_time<gcd)|target.time_to_die<24)
actions+=/conflagrate,if=talent.roaring_blaze.enabled&debuff.roaring_blaze.stack>0&dot.immolate.remains>dot.immolate.duration*0.3&(active_enemies=1|soul_shard<3)&soul_shard<5
actions+=/conflagrate,if=!talent.roaring_blaze.enabled&buff.backdraft.stack<3&buff.conflagration_of_chaos.remains<=action.chaos_bolt.cast_time
actions+=/conflagrate,if=!talent.roaring_blaze.enabled&buff.backdraft.stack<3&(charges=1+set_bonus.tier19_4pc&recharge_time<action.chaos_bolt.cast_time|charges=2+set_bonus.tier19_4pc)&soul_shard<5
actions+=/life_tap,if=talent.empowered_life_tap.enabled&buff.empowered_life_tap.remains<=gcd
actions+=/dimensional_rift,if=equipped.144369&!buff.lessons_of_spacetime.remains&((!talent.grimoire_of_supremacy.enabled&!cooldown.summon_doomguard.remains)|(talent.grimoire_of_service.enabled&!cooldown.service_pet.remains)|(talent.soul_harvest.enabled&!cooldown.soul_harvest.remains))
actions+=/service_pet
actions+=/summon_infernal,if=artifact.lord_of_flames.rank>0&!buff.lord_of_flames.remains
actions+=/summon_doomguard,if=!talent.grimoire_of_supremacy.enabled&spell_targets.infernal_awakening<=2&(target.time_to_die>180|target.health.pct<=20|target.time_to_die<30)
actions+=/summon_infernal,if=!talent.grimoire_of_supremacy.enabled&spell_targets.infernal_awakening>2
actions+=/summon_doomguard,if=talent.grimoire_of_supremacy.enabled&spell_targets.summon_infernal=1&artifact.lord_of_flames.rank>0&buff.lord_of_flames.remains&!pet.doomguard.active
actions+=/summon_doomguard,if=talent.grimoire_of_supremacy.enabled&spell_targets.summon_infernal=1&equipped.132379&!cooldown.sindorei_spite_icd.remains
actions+=/summon_infernal,if=talent.grimoire_of_supremacy.enabled&spell_targets.summon_infernal>1&equipped.132379&!cooldown.sindorei_spite_icd.remains
actions+=/soul_harvest
actions+=/channel_demonfire,if=dot.immolate.remains>cast_time
actions+=/havoc,if=active_enemies=1&talent.wreak_havoc.enabled&equipped.132375&!debuff.havoc.remains
actions+=/rain_of_fire,if=active_enemies>=3&cooldown.havoc.remains<=12&!talent.wreak_havoc.enabled
actions+=/rain_of_fire,if=active_enemies>=6&talent.wreak_havoc.enabled
actions+=/dimensional_rift,if=!equipped.144369|charges>1|((!talent.grimoire_of_service.enabled|recharge_time<cooldown.service_pet.remains)&(!talent.soul_harvest.enabled|recharge_time<cooldown.soul_harvest.remains)&(!talent.grimoire_of_supremacy.enabled|recharge_time<cooldown.summon_doomguard.remains))
actions+=/life_tap,if=talent.empowered_life_tap.enabled&buff.empowered_life_tap.remains<duration*0.3
actions+=/cataclysm
actions+=/chaos_bolt,if=(cooldown.havoc.remains>12&cooldown.havoc.remains|active_enemies<3|talent.wreak_havoc.enabled&active_enemies<6)&(set_bonus.tier19_4pc=0|!talent.eradication.enabled|buff.embrace_chaos.remains<=cast_time|soul_shard>=3)
actions+=/shadowburn
actions+=/conflagrate,if=!talent.roaring_blaze.enabled&buff.backdraft.stack<3
actions+=/immolate,if=!talent.roaring_blaze.enabled&remains<=duration*0.3
actions+=/incinerate
actions+=/life_tap

head=eyes_of_azjaqir,id=138314,bonus_id=3445
neck=radiant_string_of_scorpid_eyes,id=140898,bonus_id=3445,enchant_id=5439
shoulders=pauldrons_of_azjaqir,id=138323,bonus_id=3445
back=astromancers_greatcloak,id=140909,bonus_id=3518,enchant_id=5436
chest=robes_of_fluctuating_energy,id=140848,bonus_id=3445
wrists=woven_lasher_tendril_bracers,id=140886,bonus_id=3445
hands=clutch_of_azjaqir,id=138311,bonus_id=3445
waist=feretory_of_souls,id=132456,ilevel=940
legs=leggings_of_azjaqir,id=138317,bonus_id=3445
feet=outcast_wanderers_footrags,id=140914,bonus_id=3519
finger1=ring_of_the_scoured_clan,id=140897,bonus_id=3445,enchant=binding_of_haste
finger2=ring_of_braided_stems,id=140896,bonus_id=3518,enchant=binding_of_haste
trinket1=whispers_in_the_dark,id=140809,ilevel=905
trinket2=erratic_metronome,id=140792,ilevel=900
main_hand=scepter_of_sargeras,id=128941,ilevel=929,gem_id=140826/140837/140826,relic_id=3519/3518:3518/3519

# Gear Summary
# gear_ilvl=906.27
# gear_stamina=34467
# gear_intellect=39190
# gear_crit_rating=3577
# gear_haste_rating=11066
# gear_mastery_rating=5695
# gear_versatility_rating=2829
# gear_armor=1981
# set_bonus=tier19_2pc=1
# set_bonus=tier19_4pc=1
default_pet=imp

Norgannon's : 1348622 dps, 805666 dps to main target

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR
1348622.4 1348622.4 1132.5 / 0.084% 227836.8 / 16.9% 41.4
RPS Out RPS In Primary Resource Waiting APM Active Skill
26025.7 26025.7 Mana 0.00% 51.2 100.0% 100%
Talents
  • 15: Roaring Blaze (Destruction Warlock)
  • 30: Eradication (Destruction Warlock)
  • 60: Soul Harvest
  • 90: Grimoire of Service
  • 100: Wreak Havoc (Destruction Warlock)
  • Talent Calculator
Artifact

Charts

Abilities

Damage Stats DPS DPS% Execute Interval DPE DPET Type Count Hit Crit Avg Crit% Up%
Norgannon's 1348622
Chaos Bolt 395376 29.4% 61.5 4.75sec 1931472 1331451 Direct 118.2 0 1005608 1005608 100.0%  

Stats details: chaos_bolt

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 61.54 118.21 0.00 0.00 1.4507 0.0000 118867931.41 118867931.41 0.00 1331450.78 1331450.78
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
crit 118.21 100.00% 1005608.19 649907 1540122 1005938.93 930790 1071651 118867931 118867931 0.00
 
 

Action details: chaos_bolt

Static Values
  • id:116858
  • school:chromatic
  • resource:soul_shard
  • range:40.0
  • travel_speed:16.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:2.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:3.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:116858
  • name:Chaos Bolt
  • school:chromatic
  • tooltip:
  • description:Unleashes a devastating blast of chaos, causing {$s1=1} Chaos damage. Chaos Bolt always critically strikes and your critical strike chance increases its damage.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:4.000000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
Conflagrate 166531 12.4% 49.2 6.10sec 1017230 997609 Direct 97.8 305106 682889 511679 54.7%  

Stats details: conflagrate

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 49.17 97.75 0.00 0.00 1.0197 0.0000 50017123.78 50017123.78 0.00 997609.03 997609.03
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 44.30 45.32% 305105.78 199422 472570 305214.72 272962 338118 13516572 13516572 0.00
crit 53.45 54.68% 682889.33 398858 1070996 683069.87 612864 753128 36500552 36500552 0.00
 
 

Action details: conflagrate

Static Values
  • id:17962
  • school:fire
  • resource:chi
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:9.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:talent.roaring_blaze.enabled&(charges=2+set_bonus.tier19_4pc|(charges>=1+set_bonus.tier19_4pc&recharge_time<gcd)|target.time_to_die<24)
Spelldata
  • id:17962
  • name:Conflagrate
  • school:fire
  • tooltip:
  • description:Triggers an explosion on the target, dealing {$s1=1} Fire damage.{$?s196406=false}[ Reduces the cast time of Incinerate and Chaos Bolt by {$117828s1=30}% for {$117828d=10 seconds}.][] |cFFFFFFFFGenerates 1 Soul Shard.|r
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:2.265510
  • base_dd_min:1.00
  • base_dd_max:1.00
 
Cry Havoc 41003 3.0% 53.8 5.39sec 229123 0 Direct 107.6 101056 202042 114563 13.4%  

Stats details: cry_havoc

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 53.81 107.62 0.00 0.00 0.0000 0.0000 12328574.82 12328574.82 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 93.22 86.63% 101055.93 71814 151948 101108.51 94545 108403 9420624 9420624 0.00
crit 14.39 13.37% 202042.41 143631 303895 202153.97 161486 242033 2907951 2907951 0.00
 
 

Action details: cry_havoc

Static Values
  • id:243011
  • school:chromatic
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:243011
  • name:Cry Havoc
  • school:chromatic
  • tooltip:
  • description:Deals {$s2=0} Chaos damage to enemies within $A2 yards.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:1.000000
  • base_dd_min:0.00
  • base_dd_max:0.00
 
Deadly Grace 6155 0.4% 14.7 2.03sec 123727 0 Direct 14.7 109175 218630 123731 13.3%  

Stats details: deadly_grace

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 14.69 14.69 0.00 0.00 0.0000 0.0000 1817711.08 1817711.08 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 12.74 86.70% 109174.94 96891 116269 109182.57 100121 116269 1390673 1390673 0.00
crit 1.95 13.30% 218629.58 193782 232539 189587.67 0 232539 427038 427038 0.00
 
 

Action details: deadly_grace

Static Values
  • id:188091
  • school:arcane
  • resource:none
  • range:40.0
  • travel_speed:25.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:188091
  • name:Deadly Grace
  • school:arcane
  • tooltip:
  • description:Deal {$s1=63339 to 95008} Arcane damage.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:63338.72
  • base_dd_max:95008.08
 
Immolate 310923 23.1% 20.3 14.93sec 4591790 4449297 Direct 39.1 159478 318967 257346 61.4%  
Periodic 300.2 172158 344117 277639 61.3% 195.9%

Stats details: immolate

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 20.34 39.06 300.17 300.17 1.0320 1.9647 93390739.06 93390739.06 0.00 152914.57 4449296.76
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 15.09 38.64% 159477.99 104818 248228 159442.60 134410 190519 2406525 2406525 0.00
crit 23.97 61.36% 318966.88 209631 496745 318908.70 276048 363960 7644924 7644924 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 116.0 38.66% 172157.68 76 589271 172381.32 144312 202766 19977196 19977196 0.00
crit 184.1 61.34% 344116.59 164 1229110 344619.23 300659 391684 63362094 63362094 0.00
 
 

Action details: immolate

Static Values
  • id:348
  • school:fire
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:66000.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:1.50
  • base_crit:0.48
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:remains<=tick_time
Spelldata
  • id:348
  • name:Immolate
  • school:fire
  • tooltip:
  • description:Burns the enemy, causing {$s1=1} Fire damage immediately and an additional $157736o1 Fire damage over {$157736d=18 seconds}. |cFFFFFFFFPeriodic damage has a {$193541s1=15}% chance to generate 1 Soul Shard. Chance doubled on critical strikes.|r
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:1.332000
  • base_dd_min:1.00
  • base_dd_max:1.00
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.721500
  • base_td:0.00
  • dot_duration:18.00
  • base_tick_time:3.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
 
Incinerate 148891 11.1% 78.5 3.67sec 570657 454412 Direct 149.6 264116 528533 299389 13.3%  

Stats details: incinerate

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 78.50 149.62 0.00 0.00 1.2558 0.0000 44794600.78 44794600.78 0.00 454412.29 454412.29
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 129.66 86.66% 264115.73 169434 401507 264207.13 246523 281387 34245464 34245464 0.00
crit 19.96 13.34% 528532.67 338882 803008 528692.93 445756 623876 10549137 10549137 0.00
 
 

Action details: incinerate

Static Values
  • id:29722
  • school:fire
  • resource:mana
  • range:40.0
  • travel_speed:20.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:66000.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:1.88
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:29722
  • name:Incinerate
  • school:fire
  • tooltip:
  • description:Draws fire toward the enemy, dealing {$s2=0} Fire damage.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:2.331000
  • base_dd_min:0.00
  • base_dd_max:0.00
 
Mark of the Hidden Satyr 10349 0.8% 20.4 14.73sec 152553 0 Direct 20.4 134507 269245 152554 13.4%  

Stats details: mark_of_the_hidden_satyr

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 20.38 20.38 0.00 0.00 0.0000 0.0000 3109625.36 3109625.36 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 17.65 86.61% 134506.97 128239 161905 134553.95 128239 145036 2374536 2374536 0.00
crit 2.73 13.39% 269245.38 256478 323810 253397.73 0 323810 735090 735090 0.00
 
 

Action details: mark_of_the_hidden_satyr

Static Values
  • id:191259
  • school:fire
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:191259
  • name:Mark of the Hidden Satyr
  • school:fire
  • tooltip:
  • description:Deals fire damage.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:2.500000
  • spell_power_mod.direct:2.000000
  • base_dd_min:0.00
  • base_dd_max:0.00
 
pet - imp 49139 / 49139
Firebolt 49139 3.6% 110.9 2.71sec 133192 111761 Direct 110.0 118408 236849 134217 13.3%  

Stats details: firebolt

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 110.87 110.02 0.00 0.00 1.1918 0.0000 14766614.61 14766614.61 0.00 111760.77 111760.77
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 95.33 86.65% 118408.38 75662 143289 118439.83 115680 121236 11288384 11288384 0.00
crit 14.69 13.35% 236849.46 151325 286577 236922.70 207048 265496 3478231 3478231 0.00
 
 

Action details: firebolt

Static Values
  • id:3110
  • school:fire
  • resource:energy
  • range:40.0
  • travel_speed:16.0000
  • trigger_gcd:0.5000
  • min_gcd:0.7500
  • base_cost:40.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:1.75
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:3110
  • name:Firebolt
  • school:fire
  • tooltip:
  • description:Deals {$s1=1} Fire damage to a target.$?a231795[ Damage increased by {$231795s1=50}% if you have Immolated the target.][] |cFF777777(Right-Click to toggle)|r
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:1.000000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
pet - service_imp 140697 / 44979
Firebolt 140697 3.3% 49.5 5.49sec 272469 243262 Direct 49.2 241929 483987 274062 13.3%  

Stats details: firebolt

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 49.47 49.18 0.00 0.00 1.1201 0.0000 13478661.23 13478661.23 0.00 243262.01 243262.01
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 42.65 86.72% 241929.18 151325 286577 242174.11 231607 250368 10318664 10318664 0.00
crit 6.53 13.28% 483987.19 302650 573154 483956.47 0 573154 3159997 3159997 0.00
 
 

Action details: firebolt

Static Values
  • id:3110
  • school:fire
  • resource:energy
  • range:40.0
  • travel_speed:16.0000
  • trigger_gcd:0.5000
  • min_gcd:0.7500
  • base_cost:40.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:1.75
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:3110
  • name:Firebolt
  • school:fire
  • tooltip:
  • description:Deals {$s1=1} Fire damage to a target.$?a231795[ Damage increased by {$231795s1=50}% if you have Immolated the target.][] |cFF777777(Right-Click to toggle)|r
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:1.000000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
pet - infernal 136045 / 11522
Immolation 105894 0.7% 1.0 0.00sec 2647449 0 Periodic 47.9 48782 97570 55298 13.4% 8.2%

Stats details: immolation

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 23.94 47.87 0.0000 1.0260 2647448.94 2647448.94 0.00 107799.54 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 41.5 86.64% 48781.80 42163 50595 48784.51 47716 49993 2023420 2023420 0.00
crit 6.4 13.36% 97569.51 84325 101191 97418.20 0 101191 624029 624029 0.00
 
 

Action details: immolation

Static Values
  • id:19483
  • school:fire
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:!ticking
Spelldata
  • id:19483
  • name:Immolation
  • school:fire
  • tooltip:Burns nearby enemies for {$20153s1=0} fire damage every $t1 seconds.
  • description:Burns nearby enemies for {$20153s1=0} fire damage every $t1 seconds.
 

Action details: immolation_tick

Static Values
  • id:20153
  • school:fire
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:20153
  • name:Immolation
  • school:fire
  • tooltip:
  • description:Deals Fire damage to all enemies near the caster.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.650000
  • base_dd_min:0.00
  • base_dd_max:0.00
 
melee 30151 0.2% 22.8 1.08sec 33058 30627 Direct 22.8 29188 58385 33057 13.3%  

Stats details: melee

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 22.80 22.80 0.00 0.00 1.0794 0.0000 753816.29 1108181.35 31.98 30626.75 30626.75
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 19.78 86.75% 29188.29 25213 30256 29189.14 28365 29991 577370 848789 31.98
crit 3.02 13.25% 58385.17 50427 60512 55871.45 0 60512 176446 259392 30.62
 
 

Action details: melee

Static Values
  • id:0
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Weapon
  • normalized:false
  • weapon_power_mod:0.285714
  • weapon_multiplier:1.00
 
pet - doomguard 111031 / 9393
Doom Bolt 111031 0.7% 11.2 2.16sec 248082 117541 Direct 11.2 218861 437845 248107 13.4%  

Stats details: doom_bolt

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 11.19 11.19 0.00 0.00 2.1106 0.0000 2775844.78 2775844.78 0.00 117540.85 117540.85
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 9.70 86.65% 218860.58 211596 253915 218886.04 211596 253915 2121873 2121873 0.00
crit 1.49 13.35% 437844.92 423191 507829 348324.01 0 507829 653972 653972 0.00
 
 

Action details: doom_bolt

Static Values
  • id:85692
  • school:shadow
  • resource:energy
  • range:30.0
  • travel_speed:20.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:35.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:3.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:85692
  • name:Doom Bolt
  • school:shadow
  • tooltip:
  • description:Sends a shadowy bolt at the enemy, causing {$s1=1} Shadow damage. Deals {$s2=20}% additional damage to targets below 20% health.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:2.750000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
pet - lord_of_flames_infernal 136002 / 11517
Immolation 105821 0.7% 1.0 0.00sec 2645626 0 Periodic 47.9 48782 97562 55261 13.3% 8.2%

Stats details: immolation

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 23.94 47.87 0.0000 1.0260 2645626.49 2645626.49 0.00 107725.33 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 41.5 86.72% 48782.41 42163 50595 48784.98 47644 50051 2025243 2025243 0.00
crit 6.4 13.28% 97561.56 84325 101191 97402.58 0 101191 620384 620384 0.00
 
 

Action details: immolation

Static Values
  • id:19483
  • school:fire
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:!ticking
Spelldata
  • id:19483
  • name:Immolation
  • school:fire
  • tooltip:Burns nearby enemies for {$20153s1=0} fire damage every $t1 seconds.
  • description:Burns nearby enemies for {$20153s1=0} fire damage every $t1 seconds.
 

Action details: immolation_tick

Static Values
  • id:20153
  • school:fire
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:20153
  • name:Immolation
  • school:fire
  • tooltip:
  • description:Deals Fire damage to all enemies near the caster.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.650000
  • base_dd_min:0.00
  • base_dd_max:0.00
 
melee 30181 0.2% 22.8 1.08sec 33090 30657 Direct 22.8 29188 58387 33089 13.4%  

Stats details: melee

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 22.80 22.80 0.00 0.00 1.0794 0.0000 754555.12 1109267.49 31.98 30656.77 30656.77
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 19.76 86.64% 29188.14 25213 30256 29189.21 28476 30256 576631 847703 31.98
crit 3.05 13.36% 58387.08 50427 60512 56148.87 0 60512 177924 261565 30.75
 
 

Action details: melee

Static Values
  • id:0
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Weapon
  • normalized:false
  • weapon_power_mod:0.285714
  • weapon_multiplier:1.00
 
pet - lord_of_flames_infernal 136115 / 11528
Immolation 105918 0.7% 1.0 0.00sec 2648054 0 Periodic 47.9 48781 97581 55312 13.4% 8.2%

Stats details: immolation

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 23.94 47.87 0.0000 1.0260 2648054.46 2648054.46 0.00 107824.20 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 41.5 86.62% 48780.92 42163 50595 48783.83 47644 50113 2022815 2022815 0.00
crit 6.4 13.38% 97580.80 84325 101191 97489.02 0 101191 625240 625240 0.00
 
 

Action details: immolation

Static Values
  • id:19483
  • school:fire
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:!ticking
Spelldata
  • id:19483
  • name:Immolation
  • school:fire
  • tooltip:Burns nearby enemies for {$20153s1=0} fire damage every $t1 seconds.
  • description:Burns nearby enemies for {$20153s1=0} fire damage every $t1 seconds.
 

Action details: immolation_tick

Static Values
  • id:20153
  • school:fire
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:20153
  • name:Immolation
  • school:fire
  • tooltip:
  • description:Deals Fire damage to all enemies near the caster.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.650000
  • base_dd_min:0.00
  • base_dd_max:0.00
 
melee 30197 0.2% 22.8 1.08sec 33107 30673 Direct 22.8 29191 58356 33107 13.4%  

Stats details: melee

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 22.80 22.80 0.00 0.00 1.0794 0.0000 754945.46 1109841.34 31.98 30672.63 30672.63
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 19.74 86.57% 29190.55 25213 30256 29191.74 28365 30256 576241 847129 31.98
crit 3.06 13.43% 58355.95 50427 60512 56286.29 0 60512 178704 262712 30.83
 
 

Action details: melee

Static Values
  • id:0
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Weapon
  • normalized:false
  • weapon_power_mod:0.285714
  • weapon_multiplier:1.00
 
pet - lord_of_flames_infernal 136019 / 11518
Immolation 105867 0.7% 1.0 0.00sec 2646776 0 Periodic 47.9 48780 97597 55285 13.3% 8.2%

Stats details: immolation

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 23.94 47.87 0.0000 1.0260 2646775.96 2646775.96 0.00 107772.14 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 41.5 86.67% 48779.72 42163 50595 48782.71 47710 50099 2024093 2024093 0.00
crit 6.4 13.33% 97596.53 84325 101191 97444.58 0 101191 622683 622683 0.00
 
 

Action details: immolation

Static Values
  • id:19483
  • school:fire
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:!ticking
Spelldata
  • id:19483
  • name:Immolation
  • school:fire
  • tooltip:Burns nearby enemies for {$20153s1=0} fire damage every $t1 seconds.
  • description:Burns nearby enemies for {$20153s1=0} fire damage every $t1 seconds.
 

Action details: immolation_tick

Static Values
  • id:20153
  • school:fire
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:20153
  • name:Immolation
  • school:fire
  • tooltip:
  • description:Deals Fire damage to all enemies near the caster.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.650000
  • base_dd_min:0.00
  • base_dd_max:0.00
 
melee 30152 0.2% 22.8 1.08sec 33058 30627 Direct 22.8 29189 58378 33058 13.3%  

Stats details: melee

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 22.80 22.80 0.00 0.00 1.0794 0.0000 753825.37 1108194.69 31.98 30627.12 30627.12
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 19.78 86.74% 29188.86 25213 30256 29190.12 28455 30256 577361 848776 31.98
crit 3.02 13.26% 58377.75 50427 60512 56107.52 0 60512 176464 259419 30.72
 
 

Action details: melee

Static Values
  • id:0
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Weapon
  • normalized:false
  • weapon_power_mod:0.285714
  • weapon_multiplier:1.00
 
pet - shadowy_tear 135052 / 18577
Shadow Bolt 135052 1.4% 3.4 69.72sec 1634383 0 Periodic 37.9 129283 258491 146465 13.3% 15.4%

Stats details: shadow_bolt

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 3.40 0.00 38.14 37.93 0.0000 1.2144 5555420.51 5555420.51 0.00 119961.57 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 32.9 86.70% 129283.07 71 155679 128739.88 0 155679 4251618 4251618 0.00
crit 5.0 13.30% 258490.72 174 311358 247932.52 0 311358 1303802 1303802 0.00
 
 

Action details: shadow_bolt

Static Values
  • id:196657
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:20.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:196657
  • name:Shadow Bolt
  • school:shadow
  • tooltip:
  • description:Sends a shadowy bolt at the enemy, causing {$s1=1} Shadow damage.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • dot_duration:14.00
  • base_tick_time:2.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
 
pet - flame_rift 282718 / 79999
Searing Bolt 282718 5.9% 66.9 2.63sec 358346 1119829 Direct 66.5 66500 0 66500 0.0%  
Periodic 141.4 122032 244163 138241 13.3% 46.5%

Stats details: searing_bolt

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 66.88 66.51 141.37 141.37 0.3200 0.9908 23966580.64 23966580.64 0.00 148421.94 1119829.02
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 66.51 100.00% 66499.68 61655 77840 66510.91 0 77840 4423076 4423076 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 122.6 86.73% 122031.99 123 155707 121504.99 0 139269 14962423 14962423 0.00
crit 18.8 13.27% 244162.58 247 311414 242760.94 0 311414 4581081 4581081 0.00
 
 

Action details: searing_bolt

Static Values
  • id:243050
  • school:fire
  • resource:energy
  • range:100.0
  • travel_speed:20.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:1.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:243050
  • name:Searing Bolt
  • school:fire
  • tooltip:Burning for $w2 Fire damage every $t2 sec.
  • description:Sends a searing bolt at the enemy, causing {$s1=1} Fire damage, and an additional $o2 Fire damage over {$d=30 seconds}, stacking up to {$u=20} times.
Direct Damage
  • may_crit:false
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:1.000000
  • base_dd_min:1.00
  • base_dd_max:1.00
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.100000
  • base_td:1.00
  • dot_duration:30.00
  • base_tick_time:1.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
 
pet - chaos_tear 155624 / 8339
Chaos Bolt 155624 0.6% 3.3 69.84sec 749137 385106 Direct 3.3 0 753689 753689 100.0%  

Stats details: chaos_bolt

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 3.34 3.32 0.00 0.00 1.9455 0.0000 2500877.68 2500877.68 0.00 385105.90 385105.90
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
crit 3.32 100.00% 753689.12 698689 882112 753718.92 0 882112 2500878 2500878 0.00
 
 

Action details: chaos_bolt

Static Values
  • id:215279
  • school:chromatic
  • resource:none
  • range:100.0
  • travel_speed:16.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:5.500
  • base_execute_time:3.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:215279
  • name:Chaos Bolt
  • school:chromatic
  • tooltip:
  • description:Unleashes a devastating blast of chaos, causing {$s1=1} Chaos damage. Chaos Bolt always critically strikes and your critical strike chance increases its damage.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:5.000000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
pet - chaos_portal 285704 / 16651
Chaos Barrage 285704 1.2% 3.4 69.67sec 1484367 0 Periodic 120.0 36632 73210 41507 13.3% 6.1%

Stats details: chaos_barrage

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 3.36 0.00 120.53 120.00 0.0000 0.1513 4980915.77 4980915.77 0.00 273166.38 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 104.0 86.67% 36632.17 153 42813 36468.38 0 42813 3809948 3809948 0.00
crit 16.0 13.33% 73210.26 314 85626 72761.76 0 85626 1170967 1170967 0.00
 
 

Action details: chaos_barrage

Static Values
  • id:187394
  • school:magic
  • resource:none
  • range:100.0
  • travel_speed:24.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:187394
  • name:Chaos Barrage
  • school:magic
  • tooltip:
  • description:Deals {$s1=1} Chaos damage.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • dot_duration:5.50
  • base_tick_time:0.25
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
 
Simple Action Stats Execute Interval
Norgannon's
augmentation 1.0 0.00sec

Stats details: augmentation

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: augmentation

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Norgannon's
  • harmful:false
  • if_expr:
 
Berserking 2.1 180.74sec

Stats details: berserking

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.06 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: berserking

Static Values
  • id:26297
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:180.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:26297
  • name:Berserking
  • school:physical
  • tooltip:Haste increased by {$s1=15}%.
  • description:Increases your haste by {$s1=15}% for {$d=10 seconds}.
 
Dimensional Rift 13.1 23.26sec

Stats details: dimensional_rift

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 13.09 0.00 0.00 0.00 0.9918 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: dimensional_rift

Static Values
  • id:196586
  • school:none
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:45.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:charges=3
Spelldata
  • id:196586
  • name:Dimensional Rift
  • school:chaos
  • tooltip:
  • description:Rips a hole in time and space, opening a portal that damages your target.
 
flask 1.0 0.00sec

Stats details: flask

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: flask

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Norgannon's
  • harmful:false
  • if_expr:
 
food 1.0 0.00sec

Stats details: food

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: food

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Norgannon's
  • harmful:false
  • if_expr:
 
Havoc 14.9 20.90sec

Stats details: havoc

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 14.90 0.00 0.00 0.00 1.0488 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: havoc

Static Values
  • id:80240
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:88000.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:active_enemies>1&(active_enemies<4|talent.wreak_havoc.enabled&active_enemies<6)&!debuff.havoc.remains
Spelldata
  • id:80240
  • name:Havoc
  • school:shadow
  • tooltip:Spells cast by the Warlock also hit this target.
  • description:Marks a target with Havoc for {$d=8 seconds}, causing your single target spells to also strike the Havoc victim. Limit 1.
 
Life Tap 7.0 32.14sec

Stats details: life_tap

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 7.04 0.00 0.00 0.00 1.0209 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: life_tap

Static Values
  • id:1454
  • school:shadow
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:talent.empowered_life_tap.enabled&!buff.empowered_life_tap.remains
Spelldata
  • id:1454
  • name:Life Tap
  • school:shadow
  • tooltip:
  • description:Restores {$s1=30}% of your maximum mana, at the cost of {$s2=10}% of your maximum health.
 
potion 2.0 0.00sec

Stats details: potion

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: potion

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:60.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
 
Grimoire: Imp (service_imp) 3.7 91.52sec

Stats details: service_imp

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 3.68 0.00 0.00 0.00 0.9555 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: service_imp

Static Values
  • id:111859
  • school:shadow
  • resource:soul_shard
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:1.0
  • secondary_cost:0.0
  • cooldown:90.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:111859
  • name:Grimoire: Imp
  • school:shadow
  • tooltip:
  • description:Summons an Imp who attacks the target for {$108501s1=25} sec. Imps cast ranged Firebolts and cleanse a hostile magic effect from their master.
 
Soul Harvest 2.9 121.06sec

Stats details: soul_harvest

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.90 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: soul_harvest

Static Values
  • id:196098
  • school:shadow
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:120.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:196098
  • name:Soul Harvest
  • school:shadow
  • tooltip:Damage increased by {$s1=20}%.
  • description:Increases your damage and your pets' damage by {$s1=20}%. Lasts {$d=15 seconds}, increased by {$s2=2} sec for each target afflicted by your {$?s137043=false}[Agony][]{$?s137044=false}[Doom][]{$?s137046=false}[Immolate][], up to a maximum of {$s3=35} sec.
 
Summon Doomguard 1.0 0.00sec

Stats details: summon_doomguard

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 1.0593 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: summon_doomguard

Static Values
  • id:18540
  • school:shadow
  • resource:soul_shard
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:1.0
  • secondary_cost:0.0
  • cooldown:180.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:talent.grimoire_of_supremacy.enabled&active_enemies=1&artifact.lord_of_flames.rank=0
Spelldata
  • id:18540
  • name:Summon Doomguard
  • school:shadow
  • tooltip:
  • description:Summons a Doomguard for {$60478d=25 seconds} to assault the target with its Doom Bolts.
 
Summon Imp 1.0 0.00sec

Stats details: summon_imp

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: summon_imp

Static Values
  • id:688
  • school:shadow
  • resource:soul_shard
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:1.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:2.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:!talent.grimoire_of_supremacy.enabled&(!talent.grimoire_of_sacrifice.enabled|buff.demonic_power.down)
Spelldata
  • id:688
  • name:Summon Imp
  • school:shadow
  • tooltip:
  • description:Summons an Imp under your command that casts ranged Firebolts.$?s74434[ |cFFFFFFFFSoulburn:|r |cFF8282FFInstant cast.|r][]
 
Summon Infernal 1.0 0.00sec

Stats details: summon_infernal

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.7545 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: summon_infernal

Static Values
  • id:1122
  • school:shadow
  • resource:soul_shard
  • range:30.0
  • travel_speed:1.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:1.0
  • secondary_cost:0.0
  • cooldown:180.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:talent.grimoire_of_supremacy.enabled&artifact.lord_of_flames.rank>0
Spelldata
  • id:1122
  • name:Summon Infernal
  • school:shadow
  • tooltip:
  • description:Summons an Infernal from the Twisting Nether, impacting for {$22703s1=0} Fire damage and stunning all enemy targets in the area for {$22703d=2 seconds}. The Infernal will serve you for {$111685d=25 seconds}, dealing strong area-of-effect damage.
 

Buffs

Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit Overflow Expiry
Accelerando 20.1 0.0 15.4sec 15.4sec 78.44% 78.44% 1.5(1.5) 19.3

Buff details

  • buff initial source:Norgannon's
  • cooldown name:buff_accelerando
  • max_stacks:5
  • duration:12.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00

Stat Buff details

  • stat:haste_rating
  • amount:734.41

Stack Uptimes

  • accelerando_1:29.65%
  • accelerando_2:24.52%
  • accelerando_3:14.60%
  • accelerando_4:6.58%
  • accelerando_5:3.08%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:225719
  • name:Accelerando
  • tooltip:Haste increased by $w1.
  • description:{$@spelldesc225125=Your damaging spells have a chance to grant you {$225719s1=528} Haste for {$225719d=12 seconds}, stacking up to 5 times. Stacking does not refresh duration.}
  • max_stacks:5
  • duration:12.00
  • cooldown:0.00
  • default_chance:101.00%
Berserking 2.1 0.0 180.8sec 180.8sec 6.86% 8.48% 0.0(0.0) 2.0

Buff details

  • buff initial source:Norgannon's
  • cooldown name:buff_berserking
  • max_stacks:1
  • duration:10.00
  • cooldown:180.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • berserking_1:6.86%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:26297
  • name:Berserking
  • tooltip:Haste increased by {$s1=15}%.
  • description:Increases your haste by {$s1=15}% for {$d=10 seconds}.
  • max_stacks:0
  • duration:10.00
  • cooldown:180.00
  • default_chance:0.00%
Bloodlust 1.0 0.0 0.0sec 0.0sec 13.55% 13.55% 0.0(0.0) 1.0

Buff details

  • buff initial source:Norgannon's
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • duration:40.00
  • cooldown:300.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • bloodlust_1:13.55%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:2825
  • name:Bloodlust
  • tooltip:Haste increased by {$s1=30}%.
  • description:Increases Haste by {$s1=30}% for all party and raid members for {$d=40 seconds}. Allies receiving this effect will become Sated and unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.
  • max_stacks:0
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
Conflagration of Chaos 24.5 0.0 12.1sec 12.1sec 49.06% 47.72% 0.0(0.0) 0.5

Buff details

  • buff initial source:Norgannon's
  • cooldown name:buff_conflagration_of_chaos
  • max_stacks:1
  • duration:20.00
  • cooldown:0.00
  • default_chance:50.00%
  • default_value:-0.00

Stack Uptimes

  • conflagration_of_chaos_1:49.06%

Trigger Attempt Success

  • trigger_pct:49.86%

Spelldata details

  • id:196546
  • name:Conflagration of Chaos
  • tooltip:Your {$?s17877=false}[Shadowburn][Conflagrate] will always critically strike. Critical strike chance will increase the critical strike damage of {$?s17877=false}[Shadowburn][Conflagrate].
  • description:{$@spelldesc219195={$?s17877=false}[Shadowburn][Conflagrate] has a chance to guarantee your next {$?s17877=false}[Shadowburn][Conflagrate] critically strikes, and to increase its damage by your critical strike chance.}
  • max_stacks:0
  • duration:20.00
  • cooldown:0.00
  • default_chance:100.00%
Devil's Due 3.5 0.0 69.7sec 69.7sec 8.72% 8.72% 0.0(0.0) 3.2

Buff details

  • buff initial source:Norgannon's
  • cooldown name:buff_devils_due
  • max_stacks:1
  • duration:8.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.18

Stack Uptimes

  • devils_due_1:8.72%

Trigger Attempt Success

  • trigger_pct:99.99%

Spelldata details

  • id:225776
  • name:Devil's Due
  • tooltip:Cast speed slowed by {$s1=7}%.
  • description:{$@spelldesc225142=Your damaging spells have a chance to grant Nefarious Pact, increasing your casting speed by {$225774s1=17}% for {$225774d=12 seconds}. When Nefarious Pact expires, your casting speed is decreased by {$225776s1=7}% for {$225776d=8 seconds}.}
  • max_stacks:0
  • duration:8.00
  • cooldown:0.00
  • default_chance:0.00%
Embrace Chaos 33.7 28.8 9.1sec 4.8sec 67.56% 81.13% 28.8(28.8) 33.0

Buff details

  • buff initial source:Norgannon's
  • cooldown name:buff_embrace_chaos
  • max_stacks:1
  • duration:4.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • embrace_chaos_1:67.56%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:212019
  • name:Embrace Chaos
  • tooltip:Chaos Bolt has {$s1=40}% reduced cast time.
  • description:{$@spelldesc212018=Casting Chaos Bolt reduces the cast time of your next Chaos Bolt by {$212019s1=40}% for {$212019d=4 seconds}.}
  • max_stacks:0
  • duration:4.00
  • cooldown:0.00
  • default_chance:0.00%
Lord of Flames 1.0 0.0 0.0sec 0.0sec 97.91% 97.91% 0.0(0.0) 0.0

Buff details

  • buff initial source:Norgannon's
  • cooldown name:buff_lord_of_flames
  • max_stacks:1
  • duration:600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • lord_of_flames_1:97.91%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:226802
  • name:Lord of Flames
  • tooltip:Recently activated Lord of Flames.
  • description:{$@spelldesc224103=Once every {$s2=10} minutes, {$?s152107=false}[your Infernal's Meteor Strike][Summon Infernal] will summon {$s3=3} additional Infernals to serve you for {$226804d=25 seconds}.}
  • max_stacks:0
  • duration:600.00
  • cooldown:0.00
  • default_chance:0.00%
Nefarious Pact 3.5 0.0 70.1sec 69.3sec 13.56% 13.56% 0.0(0.0) 3.3

Buff details

  • buff initial source:Norgannon's
  • cooldown name:buff_nefarious_pact
  • max_stacks:1
  • duration:12.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.44

Stack Uptimes

  • nefarious_pact_1:13.56%

Trigger Attempt Success

  • trigger_pct:99.99%

Spelldata details

  • id:225774
  • name:Nefarious Pact
  • tooltip:Cast speed increased by {$s1=17}%.
  • description:{$@spelldesc225142=Your damaging spells have a chance to grant Nefarious Pact, increasing your casting speed by {$225774s1=17}% for {$225774d=12 seconds}. When Nefarious Pact expires, your casting speed is decreased by {$225776s1=7}% for {$225776d=8 seconds}.}
  • max_stacks:0
  • duration:12.00
  • cooldown:0.00
  • default_chance:0.00%
Potion of Deadly Grace 1.0 0.0 0.0sec 0.0sec 10.16% 10.16% 0.0(0.0) 1.0

Buff details

  • buff initial source:Norgannon's
  • cooldown name:buff_potion_of_deadly_grace
  • max_stacks:1
  • duration:30.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • potion_of_deadly_grace_1:10.16%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:188027
  • name:Potion of Deadly Grace
  • tooltip:Your attacks have a chance to unleash a bolt of energy at your target.
  • description:Grants your attacks a chance to unleash a bolt of energy at your target. Staying away from enemies for the entire duration of the effect will extend the effect by an additional 5 seconds.
  • max_stacks:0
  • duration:25.00
  • cooldown:1.00
  • default_chance:101.00%
Potion of Prolonged Power 1.0 0.0 0.0sec 0.0sec 19.64% 19.64% 0.0(0.0) 1.0

Buff details

  • buff initial source:Norgannon's
  • cooldown name:buff_potion_of_prolonged_power
  • max_stacks:1
  • duration:60.00
  • cooldown:1.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:all
  • amount:2500.00

Stack Uptimes

  • potion_of_prolonged_power_1:19.64%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:229206
  • name:Potion of Prolonged Power
  • tooltip:All stats increased by {$s1=2500}.
  • description:Drink to increase all stats by {$s1=2500} for {$d=60 seconds}.
  • max_stacks:0
  • duration:60.00
  • cooldown:1.00
  • default_chance:0.00%
Soul Harvest 2.9 0.0 121.1sec 121.1sec 17.77% 17.77% 0.0(0.0) 2.7

Buff details

  • buff initial source:Norgannon's
  • cooldown name:buff_soul_harvest
  • max_stacks:1
  • duration:15.00
  • cooldown:120.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • soul_harvest_1:17.77%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:196098
  • name:Soul Harvest
  • tooltip:Damage increased by {$s1=20}%.
  • description:Increases your damage and your pets' damage by {$s1=20}%. Lasts {$d=15 seconds}, increased by {$s2=2} sec for each target afflicted by your {$?s137043=false}[Agony][]{$?s137044=false}[Doom][]{$?s137046=false}[Immolate][], up to a maximum of {$s3=35} sec.
  • max_stacks:0
  • duration:15.00
  • cooldown:120.00
  • default_chance:0.00%
Constant Buffs
Well Fed (azshari_salad)

Buff details

  • buff initial source:Norgannon's
  • cooldown name:buff_azshari_salad
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:haste_rating
  • amount:375.00

Stack Uptimes

  • azshari_salad_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:225603
  • name:Well Fed
  • tooltip:Haste increased by $w1.
  • description:Increases haste by {$s1=375} for {$d=3600 seconds}.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Defiled Augmentation

Buff details

  • buff initial source:Norgannon's
  • cooldown name:buff_defiled_augmentation
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:agility
  • amount:325.00
  • stat:strength
  • amount:325.00
  • stat:intellect
  • amount:325.00

Stack Uptimes

  • defiled_augmentation_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:224001
  • name:Defiled Augmentation
  • tooltip:Agility, Intellect and Strength increased by $w1.
  • description:Increases Agility, Intellect and Strength by {$s1=325} for {$d=3600 seconds}. Augment Rune.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Flask of the Whispered Pact

Buff details

  • buff initial source:Norgannon's
  • cooldown name:buff_flask_of_the_whispered_pact
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:intellect
  • amount:1300.00

Stack Uptimes

  • flask_of_the_whispered_pact_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:188031
  • name:Flask of the Whispered Pact
  • tooltip:Intellect increased by $w1.
  • description:Increases Intellect by {$s1=1300} for {$d=3600 seconds}. Counts as both a Battle and Guardian elixir. This effect persists through death.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:101.00%
Norgannon's Foresight (_ready)

Buff details

  • buff initial source:Norgannon's
  • cooldown name:buff_norgannons_foresight_ready
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • norgannons_foresight_ready_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:236380
  • name:Norgannon's Foresight
  • tooltip:Your spells may be castable while moving.
  • description:{$@spelldesc236373=Standing still for {$234797d=6 seconds} grants you Foresight, allowing you to cast while moving for ${{$236380s1=4000}/1000} sec. This duration begins when you start moving.}
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
Tormented Souls

Buff details

  • buff initial source:Norgannon's
  • cooldown name:buff_tormented_souls
  • max_stacks:12
  • duration:0.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00

Stack Uptimes

  • tormented_souls_2:0.37%
  • tormented_souls_3:99.63%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:216695
  • name:Tormented Souls
  • tooltip:Activate Reap Souls to consume all Tormented Souls collected by |cFFFFCC99Ulthalesh|r, increasing your damage by 10% and doubling the effect of all of |cFFFFCC99Ulthalesh|r's other traits for {$216708d=5 seconds} per soul consumed.
  • description:Activate Reap Souls to consume all Tormented Souls collected by |cFFFFCC99Ulthalesh|r, increasing your damage by 10% and doubling the effect of all of |cFFFFCC99Ulthalesh|r's other traits for {$216708d=5 seconds} per soul consumed.
  • max_stacks:12
  • duration:-0.00
  • cooldown:0.00
  • default_chance:101.00%

Procs

Count Interval
shadowy_tear 3.3 69.8sec
flame_rift 3.3 70.2sec
chaos_tear 3.3 69.8sec
chaos_portal 3.3 69.5sec
dimension_ripper 3.9 54.7sec
t19_2pc_chaos_bolt 44.7 6.5sec

Resources

Resource Usage Type Count Total Average RPE APR
Norgannon's
chaos_bolt Soul Shard 62.5 125.1 2.0 2.0 950281.5
havoc Mana 14.9 1310841.9 88000.0 88000.2 0.0
immolate Mana 20.3 1342340.9 66000.0 65999.6 69.6
incinerate Mana 78.5 5180746.0 66000.0 65999.7 8.6
service_imp Soul Shard 3.7 3.7 1.0 1.0 0.0
summon_doomguard Soul Shard 1.0 1.0 1.0 1.0 0.0
summon_infernal Soul Shard 1.0 1.0 1.0 1.0 0.0
pet - imp
firebolt Energy 110.9 4434.7 40.0 40.0 3329.8
pet - service_imp
firebolt Energy 49.5 1978.8 40.0 40.0 6811.7
pet - doomguard
doom_bolt Energy 11.2 391.6 35.0 35.0 7088.1
pet - flame_rift
searing_bolt Energy 64.8 64.8 1.0 1.0 369776.7
Resource Gains Type Count Total Average Overflow
life_tap Mana 7.04 2323459.96 (33.34%) 330000.00 0.00 0.00%
immolate Soul Shard 72.65 71.54 (55.02%) 0.98 1.11 1.53%
conflagrate Soul Shard 49.17 49.07 (37.74%) 1.00 0.10 0.21%
mp5_regen Mana 531.63 4644943.92 (66.66%) 8737.21 78206.81 1.66%
soulsnatcher Soul Shard 9.41 9.41 (7.24%) 1.00 0.00 0.00%
pet - imp
energy_regen Energy 1907.52 4268.39 (100.00%) 2.24 21.59 0.50%
pet - service_imp
energy_regen Energy 452.68 1377.00 (100.00%) 3.04 61.94 4.30%
pet - doomguard
energy_regen Energy 16.22 350.62 (100.00%) 21.62 43.00 10.92%
Resource RPS-Gain RPS-Loss
Health 0.00 7686.07
Mana 23150.21 26025.71
Soul Shard 0.43 0.43
Combat End Resource Mean Min Max
Mana 232592.45 7435.38 476429.94
Soul Shard 2.21 0.00 5.00

Benefits & Uptimes

Benefits %
Uptimes %
Mana Cap 1.1%

Statistics & Data Analysis

Fight Length
Sample Data Norgannon's Fight Length
Count 9999
Mean 301.01
Minimum 217.68
Maximum 385.07
Spread ( max - min ) 167.39
Range [ ( max - min ) / 2 * 100% ] 27.80%
DPS
Sample Data Norgannon's Damage Per Second
Count 9999
Mean 1348622.39
Minimum 1185960.33
Maximum 1596722.84
Spread ( max - min ) 410762.51
Range [ ( max - min ) / 2 * 100% ] 15.23%
Standard Deviation 57776.5778
5th Percentile 1258667.30
95th Percentile 1448845.81
( 95th Percentile - 5th Percentile ) 190178.52
Mean Distribution
Standard Deviation 577.7947
95.00% Confidence Intervall ( 1347489.93 - 1349754.85 )
Normalized 95.00% Confidence Intervall ( 99.92% - 100.08% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 71
0.1% Error 7051
0.1 Scale Factor Error with Delta=300 28496223
0.05 Scale Factor Error with Delta=300 113984892
0.01 Scale Factor Error with Delta=300 2849622277
Priority Target DPS
Sample Data Norgannon's Priority Target Damage Per Second
Count 9999
Mean 805665.60
Minimum 683260.99
Maximum 1020653.85
Spread ( max - min ) 337392.86
Range [ ( max - min ) / 2 * 100% ] 20.94%
Standard Deviation 44426.8321
5th Percentile 737654.14
95th Percentile 883930.95
( 95th Percentile - 5th Percentile ) 146276.82
Mean Distribution
Standard Deviation 444.2905
95.00% Confidence Intervall ( 804794.81 - 806536.39 )
Normalized 95.00% Confidence Intervall ( 99.89% - 100.11% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 117
0.1% Error 11681
0.1 Scale Factor Error with Delta=300 16849009
0.05 Scale Factor Error with Delta=300 67396036
0.01 Scale Factor Error with Delta=300 1684900897
DPS(e)
Sample Data Norgannon's Damage Per Second (Effective)
Count 9999
Mean 1348622.39
Minimum 1185960.33
Maximum 1596722.84
Spread ( max - min ) 410762.51
Range [ ( max - min ) / 2 * 100% ] 15.23%
Damage
Sample Data Norgannon's Damage
Count 9999
Mean 324326306.28
Minimum 232631447.67
Maximum 427247608.45
Spread ( max - min ) 194616160.78
Range [ ( max - min ) / 2 * 100% ] 30.00%
DTPS
Sample Data Norgannon's Damage Taken Per Second
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HPS
Sample Data Norgannon's Healing Per Second
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
HPS(e)
Sample Data Norgannon's Healing Per Second (Effective)
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
Sample Data Norgannon's Heal
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
Sample Data Norgannon's Healing Taken Per Second
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
TMI
Sample Data Norgannon's Theck-Meloree Index
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
ETMI
Sample Data Norgannon'sTheck-Meloree Index (Effective)
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
MSD
Sample Data Norgannon's Max Spike Value
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 flask,type=whispered_pact
1 0.00 food,type=azshari_salad
2 0.00 summon_pet,if=!talent.grimoire_of_supremacy.enabled&(!talent.grimoire_of_sacrifice.enabled|buff.demonic_power.down)
3 0.00 summon_infernal,if=talent.grimoire_of_supremacy.enabled&artifact.lord_of_flames.rank>0
4 0.00 summon_infernal,if=talent.grimoire_of_supremacy.enabled&active_enemies>1
5 0.00 summon_doomguard,if=talent.grimoire_of_supremacy.enabled&active_enemies=1&artifact.lord_of_flames.rank=0
6 0.00 augmentation,type=defiled
7 0.00 snapshot_stats
8 0.00 grimoire_of_sacrifice,if=talent.grimoire_of_sacrifice.enabled
9 0.00 life_tap,if=talent.empowered_life_tap.enabled&!buff.empowered_life_tap.remains
A 0.00 potion,name=prolonged_power
B 0.00 chaos_bolt
Default action list Executed every time the actor is available.
# count action,conditions
C 14.90 havoc,target=2,if=active_enemies>1&(active_enemies<4|talent.wreak_havoc.enabled&active_enemies<6)&!debuff.havoc.remains
D 1.00 dimensional_rift,if=charges=3
E 10.37 immolate,if=remains<=tick_time
F 0.80 immolate,cycle_targets=1,if=active_enemies>1&remains<=tick_time&(!talent.roaring_blaze.enabled|(!debuff.roaring_blaze.remains&action.conflagrate.charges<2+set_bonus.tier19_4pc))
G 9.20 immolate,if=talent.roaring_blaze.enabled&remains<=duration&!debuff.roaring_blaze.remains&target.time_to_die>10&(action.conflagrate.charges=2+set_bonus.tier19_4pc|(action.conflagrate.charges>=1+set_bonus.tier19_4pc&action.conflagrate.recharge_time<cast_time+gcd)|target.time_to_die<24)
H 2.06 berserking
0.00 blood_fury
0.00 arcane_torrent
I 1.00 potion,name=deadly_grace,if=(buff.soul_harvest.remains|trinket.proc.any.react|target.time_to_die<=45)
0.00 shadowburn,if=buff.conflagration_of_chaos.remains<=action.chaos_bolt.cast_time
0.00 shadowburn,if=(charges=1+set_bonus.tier19_4pc&recharge_time<action.chaos_bolt.cast_time|charges=2+set_bonus.tier19_4pc)&soul_shard<5
J 14.15 conflagrate,if=talent.roaring_blaze.enabled&(charges=2+set_bonus.tier19_4pc|(charges>=1+set_bonus.tier19_4pc&recharge_time<gcd)|target.time_to_die<24)
K 35.02 conflagrate,if=talent.roaring_blaze.enabled&debuff.roaring_blaze.stack>0&dot.immolate.remains>dot.immolate.duration*0.3&(active_enemies=1|soul_shard<3)&soul_shard<5
0.00 conflagrate,if=!talent.roaring_blaze.enabled&buff.backdraft.stack<3&buff.conflagration_of_chaos.remains<=action.chaos_bolt.cast_time
0.00 conflagrate,if=!talent.roaring_blaze.enabled&buff.backdraft.stack<3&(charges=1+set_bonus.tier19_4pc&recharge_time<action.chaos_bolt.cast_time|charges=2+set_bonus.tier19_4pc)&soul_shard<5
0.00 life_tap,if=talent.empowered_life_tap.enabled&buff.empowered_life_tap.remains<=gcd
0.00 dimensional_rift,if=equipped.144369&!buff.lessons_of_spacetime.remains&((!talent.grimoire_of_supremacy.enabled&!cooldown.summon_doomguard.remains)|(talent.grimoire_of_service.enabled&!cooldown.service_pet.remains)|(talent.soul_harvest.enabled&!cooldown.soul_harvest.remains))
L 3.68 service_pet
M 1.00 summon_infernal,if=artifact.lord_of_flames.rank>0&!buff.lord_of_flames.remains
N 1.00 summon_doomguard,if=!talent.grimoire_of_supremacy.enabled&spell_targets.infernal_awakening<=2&(target.time_to_die>180|target.health.pct<=20|target.time_to_die<30)
0.00 summon_infernal,if=!talent.grimoire_of_supremacy.enabled&spell_targets.infernal_awakening>2
0.00 summon_doomguard,if=talent.grimoire_of_supremacy.enabled&spell_targets.summon_infernal=1&artifact.lord_of_flames.rank>0&buff.lord_of_flames.remains&!pet.doomguard.active
0.00 summon_doomguard,if=talent.grimoire_of_supremacy.enabled&spell_targets.summon_infernal=1&equipped.132379&!cooldown.sindorei_spite_icd.remains
0.00 summon_infernal,if=talent.grimoire_of_supremacy.enabled&spell_targets.summon_infernal>1&equipped.132379&!cooldown.sindorei_spite_icd.remains
O 2.90 soul_harvest
0.00 channel_demonfire,if=dot.immolate.remains>cast_time
0.00 havoc,if=active_enemies=1&talent.wreak_havoc.enabled&equipped.132375&!debuff.havoc.remains
0.00 rain_of_fire,if=active_enemies>=3&cooldown.havoc.remains<=12&!talent.wreak_havoc.enabled
0.00 rain_of_fire,if=active_enemies>=6&talent.wreak_havoc.enabled
P 12.09 dimensional_rift,if=!equipped.144369|charges>1|((!talent.grimoire_of_service.enabled|recharge_time<cooldown.service_pet.remains)&(!talent.soul_harvest.enabled|recharge_time<cooldown.soul_harvest.remains)&(!talent.grimoire_of_supremacy.enabled|recharge_time<cooldown.summon_doomguard.remains))
0.00 life_tap,if=talent.empowered_life_tap.enabled&buff.empowered_life_tap.remains<duration*0.3
0.00 cataclysm
Q 61.85 chaos_bolt,if=(cooldown.havoc.remains>12&cooldown.havoc.remains|active_enemies<3|talent.wreak_havoc.enabled&active_enemies<6)&(set_bonus.tier19_4pc=0|!talent.eradication.enabled|buff.embrace_chaos.remains<=cast_time|soul_shard>=3)
0.00 shadowburn
0.00 conflagrate,if=!talent.roaring_blaze.enabled&buff.backdraft.stack<3
0.00 immolate,if=!talent.roaring_blaze.enabled&remains<=duration*0.3
R 78.85 incinerate
S 7.04 life_tap

Sample Sequence

0126ABCDEGHJKLMOPPQQKQKQKQRRKQRCRRRRRPEQRRRPGJQKQQKQKCQQKQPQKRREQRRQRCPRRGJKQQKQKRRQRCKQRRERPQRRSRGJLCKQKQKQQRKRRPQRRRERSCFOIRRRRGJKKPQQRSQKQRCRQKQRRQERRQRRSRCGJQKQKQKQPRHQKRRCQRERRLRSGJKQKQRCKQRQKQRRQREPQPRCNRGJQKQKKQRRRSQRKORCQRRQERRSRRRGJKQCJPJQQRRRRJQRSRQJELQCJRQR

Sample Sequence Table

time list # name target resources buffs
Pre precombat 0 flask Norgannon's 1100000.0/1100000: 100% mana | 3.0/5: 60% soul_shard
Pre precombat 1 food Norgannon's 1100000.0/1100000: 100% mana | 3.0/5: 60% soul_shard
Pre precombat 2 summon_imp Fluffy_Pillow 1100000.0/1100000: 100% mana | 3.0/5: 60% soul_shard
Pre precombat 6 augmentation Norgannon's 1100000.0/1100000: 100% mana | 3.0/5: 60% soul_shard
Pre precombat A potion Fluffy_Pillow 1100000.0/1100000: 100% mana | 3.0/5: 60% soul_shard potion_of_prolonged_power
0:00.000 precombat B chaos_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 1.0/5: 20% soul_shard embrace_chaos, nefarious_pact, accelerando, potion_of_prolonged_power
0:00.000 default C havoc enemy2 1100000.0/1100000: 100% mana | 1.0/5: 20% soul_shard embrace_chaos, nefarious_pact, accelerando, potion_of_prolonged_power
0:00.777 default D dimensional_rift Fluffy_Pillow 1023481.2/1100000: 93% mana | 1.0/5: 20% soul_shard embrace_chaos, nefarious_pact, accelerando, potion_of_prolonged_power
0:01.555 default E immolate Fluffy_Pillow 1038426.1/1100000: 94% mana | 1.0/5: 20% soul_shard bloodlust, embrace_chaos, nefarious_pact, accelerando, potion_of_prolonged_power
0:02.310 default G immolate Fluffy_Pillow 986929.1/1100000: 90% mana | 1.0/5: 20% soul_shard bloodlust, embrace_chaos, nefarious_pact, accelerando, potion_of_prolonged_power
0:03.064 default H berserking Fluffy_Pillow 935412.9/1100000: 85% mana | 1.0/5: 20% soul_shard bloodlust, embrace_chaos, nefarious_pact, accelerando, potion_of_prolonged_power
0:03.064 default J conflagrate Fluffy_Pillow 935412.9/1100000: 85% mana | 1.0/5: 20% soul_shard bloodlust, berserking, embrace_chaos, nefarious_pact, accelerando, potion_of_prolonged_power
0:03.819 default K conflagrate Fluffy_Pillow 952091.3/1100000: 87% mana | 2.0/5: 40% soul_shard bloodlust, berserking, embrace_chaos, nefarious_pact, accelerando, potion_of_prolonged_power
0:04.573 default L service_imp Fluffy_Pillow 968747.7/1100000: 88% mana | 5.0/5: 100% soul_shard bloodlust, berserking, nefarious_pact, accelerando, potion_of_prolonged_power
0:05.327 default M summon_infernal Fluffy_Pillow 985404.1/1100000: 90% mana | 4.0/5: 80% soul_shard bloodlust, berserking, nefarious_pact, accelerando, potion_of_prolonged_power
0:06.082 default O soul_harvest Fluffy_Pillow 1002325.9/1100000: 91% mana | 4.0/5: 80% soul_shard bloodlust, berserking, lord_of_flames, nefarious_pact, accelerando(2), potion_of_prolonged_power
0:06.082 default P dimensional_rift Fluffy_Pillow 1002325.9/1100000: 91% mana | 4.0/5: 80% soul_shard bloodlust, berserking, soul_harvest, lord_of_flames, nefarious_pact, accelerando(2), potion_of_prolonged_power
0:06.837 default P dimensional_rift Fluffy_Pillow 1019490.7/1100000: 93% mana | 4.0/5: 80% soul_shard bloodlust, berserking, soul_harvest, lord_of_flames, nefarious_pact, accelerando(3), potion_of_prolonged_power
0:07.591 default Q chaos_bolt Fluffy_Pillow 1036632.8/1100000: 94% mana | 5.0/5: 100% soul_shard bloodlust, berserking, soul_harvest, lord_of_flames, nefarious_pact, accelerando(3), potion_of_prolonged_power
0:08.599 default Q chaos_bolt Fluffy_Pillow 1059549.6/1100000: 96% mana | 3.0/5: 60% soul_shard bloodlust, berserking, soul_harvest, lord_of_flames, embrace_chaos, nefarious_pact, accelerando(3), potion_of_prolonged_power
0:09.353 default K conflagrate Fluffy_Pillow 1076691.7/1100000: 98% mana | 1.0/5: 20% soul_shard bloodlust, berserking, soul_harvest, lord_of_flames, embrace_chaos, nefarious_pact, accelerando(3), potion_of_prolonged_power
0:10.107 default Q chaos_bolt Fluffy_Pillow 1093833.8/1100000: 99% mana | 4.0/5: 80% soul_shard bloodlust, berserking, soul_harvest, lord_of_flames, embrace_chaos, nefarious_pact, accelerando(3), potion_of_prolonged_power
0:10.860 default K conflagrate Fluffy_Pillow 1100000.0/1100000: 100% mana | 2.0/5: 40% soul_shard bloodlust, berserking, soul_harvest, lord_of_flames, embrace_chaos, nefarious_pact, accelerando(3), potion_of_prolonged_power
0:11.613 default Q chaos_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 3.0/5: 60% soul_shard bloodlust, berserking, soul_harvest, lord_of_flames, conflagration_of_chaos, embrace_chaos, nefarious_pact, accelerando(3), potion_of_prolonged_power
0:12.368 default K conflagrate Fluffy_Pillow 1100000.0/1100000: 100% mana | 1.0/5: 20% soul_shard bloodlust, berserking, soul_harvest, lord_of_flames, conflagration_of_chaos, embrace_chaos, devils_due, potion_of_prolonged_power
0:13.264 default Q chaos_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 3.0/5: 60% soul_shard bloodlust, soul_harvest, lord_of_flames, conflagration_of_chaos, embrace_chaos, devils_due, potion_of_prolonged_power
0:14.500 default R incinerate Fluffy_Pillow 1100000.0/1100000: 100% mana | 1.0/5: 20% soul_shard bloodlust, soul_harvest, lord_of_flames, conflagration_of_chaos, embrace_chaos, devils_due, accelerando, potion_of_prolonged_power
0:15.772 default R incinerate Fluffy_Pillow 1034076.8/1100000: 94% mana | 1.0/5: 20% soul_shard bloodlust, soul_harvest, lord_of_flames, conflagration_of_chaos, embrace_chaos, devils_due, accelerando, potion_of_prolonged_power
0:17.045 default K conflagrate Fluffy_Pillow 992544.0/1100000: 90% mana | 1.0/5: 20% soul_shard bloodlust, soul_harvest, lord_of_flames, conflagration_of_chaos, embrace_chaos, devils_due, accelerando(2), potion_of_prolonged_power
0:18.060 default Q chaos_bolt Fluffy_Pillow 1012325.9/1100000: 92% mana | 2.0/5: 40% soul_shard bloodlust, soul_harvest, lord_of_flames, embrace_chaos, devils_due, accelerando(2), potion_of_prolonged_power
0:19.262 default R incinerate Fluffy_Pillow 1035752.4/1100000: 94% mana | 0.0/5: 0% soul_shard bloodlust, soul_harvest, lord_of_flames, embrace_chaos, devils_due, accelerando(2), potion_of_prolonged_power
0:20.517 default C havoc enemy2 994211.8/1100000: 90% mana | 0.0/5: 0% soul_shard bloodlust, soul_harvest, lord_of_flames, embrace_chaos, nefarious_pact, accelerando(2), potion_of_prolonged_power
0:21.269 default R incinerate Fluffy_Pillow 920867.9/1100000: 84% mana | 0.0/5: 0% soul_shard bloodlust, soul_harvest, lord_of_flames, embrace_chaos, nefarious_pact, accelerando(2), potion_of_prolonged_power
0:22.024 default R incinerate Fluffy_Pillow 869731.4/1100000: 79% mana | 1.0/5: 20% soul_shard bloodlust, soul_harvest, lord_of_flames, embrace_chaos, nefarious_pact, accelerando(3), potion_of_prolonged_power
0:22.778 default R incinerate Fluffy_Pillow 818637.6/1100000: 74% mana | 1.0/5: 20% soul_shard bloodlust, soul_harvest, lord_of_flames, embrace_chaos, nefarious_pact, accelerando(3), potion_of_prolonged_power
0:23.532 default R incinerate Fluffy_Pillow 767543.8/1100000: 70% mana | 1.0/5: 20% soul_shard bloodlust, soul_harvest, lord_of_flames, nefarious_pact, accelerando(3), potion_of_prolonged_power
0:24.288 default R incinerate Fluffy_Pillow 716489.5/1100000: 65% mana | 1.0/5: 20% soul_shard bloodlust, soul_harvest, lord_of_flames, nefarious_pact, accelerando(3), potion_of_prolonged_power
0:25.042 default P dimensional_rift Fluffy_Pillow 665395.7/1100000: 60% mana | 1.0/5: 20% soul_shard bloodlust, soul_harvest, lord_of_flames, nefarious_pact, accelerando(3), potion_of_prolonged_power
0:25.795 default E immolate Fluffy_Pillow 680282.1/1100000: 62% mana | 1.0/5: 20% soul_shard bloodlust, lord_of_flames, nefarious_pact, accelerando(3), potion_of_prolonged_power
0:26.549 default Q chaos_bolt Fluffy_Pillow 628933.7/1100000: 57% mana | 2.0/5: 40% soul_shard bloodlust, lord_of_flames, nefarious_pact, potion_of_prolonged_power
0:27.760 default R incinerate Fluffy_Pillow 651857.2/1100000: 59% mana | 1.0/5: 20% soul_shard bloodlust, lord_of_flames, embrace_chaos, nefarious_pact, potion_of_prolonged_power
0:28.521 default R incinerate Fluffy_Pillow 600262.5/1100000: 55% mana | 1.0/5: 20% soul_shard bloodlust, lord_of_flames, embrace_chaos, nefarious_pact, potion_of_prolonged_power
0:29.284 default R incinerate Fluffy_Pillow 548705.6/1100000: 50% mana | 1.0/5: 20% soul_shard bloodlust, lord_of_flames, embrace_chaos, nefarious_pact, potion_of_prolonged_power
0:30.044 default P dimensional_rift Fluffy_Pillow 497091.9/1100000: 45% mana | 2.0/5: 40% soul_shard bloodlust, lord_of_flames, embrace_chaos, nefarious_pact, potion_of_prolonged_power
0:30.799 default G immolate Fluffy_Pillow 511383.6/1100000: 46% mana | 2.0/5: 40% soul_shard bloodlust, lord_of_flames, embrace_chaos, nefarious_pact, potion_of_prolonged_power
0:31.554 default J conflagrate Fluffy_Pillow 459774.1/1100000: 42% mana | 3.0/5: 60% soul_shard bloodlust, lord_of_flames, embrace_chaos, nefarious_pact, accelerando, potion_of_prolonged_power
0:32.307 default Q chaos_bolt Fluffy_Pillow 474238.7/1100000: 43% mana | 4.0/5: 80% soul_shard bloodlust, lord_of_flames, conflagration_of_chaos, devils_due, accelerando, potion_of_prolonged_power
0:34.336 default K conflagrate Fluffy_Pillow 513215.7/1100000: 47% mana | 2.0/5: 40% soul_shard bloodlust, lord_of_flames, conflagration_of_chaos, embrace_chaos, devils_due, accelerando(2), potion_of_prolonged_power
0:35.338 default Q chaos_bolt Fluffy_Pillow 532744.3/1100000: 48% mana | 4.0/5: 80% soul_shard bloodlust, lord_of_flames, conflagration_of_chaos, embrace_chaos, devils_due, accelerando(2), potion_of_prolonged_power
0:36.538 default Q chaos_bolt Fluffy_Pillow 556131.8/1100000: 51% mana | 4.0/5: 80% soul_shard bloodlust, lord_of_flames, conflagration_of_chaos, embrace_chaos, devils_due, accelerando(2), potion_of_prolonged_power
0:37.739 default K conflagrate Fluffy_Pillow 579538.7/1100000: 53% mana | 2.0/5: 40% soul_shard bloodlust, lord_of_flames, conflagration_of_chaos, embrace_chaos, devils_due, accelerando(2), potion_of_prolonged_power
0:38.741 default Q chaos_bolt Fluffy_Pillow 599161.3/1100000: 54% mana | 4.0/5: 80% soul_shard bloodlust, lord_of_flames, conflagration_of_chaos, embrace_chaos, devils_due, accelerando(3), potion_of_prolonged_power
0:39.924 default K conflagrate Fluffy_Pillow 622548.6/1100000: 57% mana | 2.0/5: 40% soul_shard bloodlust, lord_of_flames, conflagration_of_chaos, embrace_chaos, devils_due, accelerando(3), potion_of_prolonged_power
0:40.913 default C havoc enemy2 642100.6/1100000: 58% mana | 3.0/5: 60% soul_shard bloodlust, lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(3), potion_of_prolonged_power
0:41.753 default Q chaos_bolt Fluffy_Pillow 566874.7/1100000: 52% mana | 3.0/5: 60% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(3), potion_of_prolonged_power
0:43.058 default Q chaos_bolt Fluffy_Pillow 586857.8/1100000: 53% mana | 3.0/5: 60% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(4), potion_of_prolonged_power
0:44.344 default K conflagrate Fluffy_Pillow 605706.5/1100000: 55% mana | 2.0/5: 40% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, potion_of_prolonged_power
0:45.481 default Q chaos_bolt Fluffy_Pillow 622262.5/1100000: 57% mana | 3.0/5: 60% soul_shard lord_of_flames, embrace_chaos, potion_of_prolonged_power
0:46.843 default P dimensional_rift Fluffy_Pillow 642094.6/1100000: 58% mana | 3.0/5: 60% soul_shard lord_of_flames, embrace_chaos, potion_of_prolonged_power
0:47.980 default Q chaos_bolt Fluffy_Pillow 658650.6/1100000: 60% mana | 3.0/5: 60% soul_shard lord_of_flames, embrace_chaos, potion_of_prolonged_power
0:49.344 default K conflagrate Fluffy_Pillow 678511.9/1100000: 62% mana | 1.0/5: 20% soul_shard lord_of_flames, embrace_chaos, potion_of_prolonged_power
0:50.481 default R incinerate Fluffy_Pillow 695067.8/1100000: 63% mana | 2.0/5: 40% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, potion_of_prolonged_power
0:51.905 default R incinerate Fluffy_Pillow 649992.2/1100000: 59% mana | 2.0/5: 40% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando, potion_of_prolonged_power
0:53.308 default E immolate Fluffy_Pillow 604723.5/1100000: 55% mana | 3.0/5: 60% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando, potion_of_prolonged_power
0:54.428 default Q chaos_bolt Fluffy_Pillow 555273.0/1100000: 50% mana | 3.0/5: 60% soul_shard lord_of_flames, conflagration_of_chaos, accelerando, potion_of_prolonged_power
0:56.665 default R incinerate Fluffy_Pillow 588328.6/1100000: 53% mana | 1.0/5: 20% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(2), potion_of_prolonged_power
0:58.049 default R incinerate Fluffy_Pillow 543077.5/1100000: 49% mana | 2.0/5: 40% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(2)
0:59.434 default Q chaos_bolt Fluffy_Pillow 497841.4/1100000: 45% mana | 2.0/5: 40% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(2)
1:00.759 default R incinerate Fluffy_Pillow 517705.8/1100000: 47% mana | 0.0/5: 0% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(2)
1:02.143 default C havoc enemy2 472454.7/1100000: 43% mana | 0.0/5: 0% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(2)
1:03.247 default P dimensional_rift Fluffy_Pillow 400910.1/1100000: 36% mana | 0.0/5: 0% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos
1:04.385 default R incinerate Fluffy_Pillow 417725.7/1100000: 38% mana | 0.0/5: 0% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando
1:05.789 default R incinerate Fluffy_Pillow 372471.7/1100000: 34% mana | 0.0/5: 0% soul_shard lord_of_flames, conflagration_of_chaos, accelerando
1:07.192 default G immolate Fluffy_Pillow 327203.8/1100000: 30% mana | 0.0/5: 0% soul_shard lord_of_flames, conflagration_of_chaos, accelerando(2)
1:08.297 default J conflagrate Fluffy_Pillow 277811.5/1100000: 25% mana | 0.0/5: 0% soul_shard lord_of_flames, conflagration_of_chaos, accelerando(3)
1:09.389 default K conflagrate Fluffy_Pillow 294417.8/1100000: 27% mana | 1.0/5: 20% soul_shard lord_of_flames, conflagration_of_chaos, accelerando(3)
1:10.476 default Q chaos_bolt Fluffy_Pillow 310948.1/1100000: 28% mana | 3.0/5: 60% soul_shard lord_of_flames, conflagration_of_chaos, accelerando(3)
1:12.652 default Q chaos_bolt Fluffy_Pillow 344084.0/1100000: 31% mana | 3.0/5: 60% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(4)
1:13.940 default K conflagrate Fluffy_Pillow 363948.7/1100000: 33% mana | 2.0/5: 40% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(4)
1:15.013 default Q chaos_bolt Fluffy_Pillow 380497.4/1100000: 35% mana | 3.0/5: 60% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(4)
1:16.300 default K conflagrate Fluffy_Pillow 399439.2/1100000: 36% mana | 1.0/5: 20% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos
1:17.437 default R incinerate Fluffy_Pillow 415995.1/1100000: 38% mana | 2.0/5: 40% soul_shard lord_of_flames, embrace_chaos
1:18.860 default R incinerate Fluffy_Pillow 370715.5/1100000: 34% mana | 2.0/5: 40% soul_shard lord_of_flames, embrace_chaos
1:20.284 default Q chaos_bolt Fluffy_Pillow 325450.5/1100000: 30% mana | 2.0/5: 40% soul_shard lord_of_flames, embrace_chaos
1:21.646 default R incinerate Fluffy_Pillow 345282.7/1100000: 31% mana | 1.0/5: 20% soul_shard lord_of_flames, embrace_chaos
1:23.070 default C havoc enemy2 300018.5/1100000: 27% mana | 1.0/5: 20% soul_shard lord_of_flames, embrace_chaos, accelerando
1:24.190 default K conflagrate Fluffy_Pillow 228568.0/1100000: 21% mana | 2.0/5: 40% soul_shard lord_of_flames, embrace_chaos, accelerando
1:25.309 default Q chaos_bolt Fluffy_Pillow 245102.8/1100000: 22% mana | 3.0/5: 60% soul_shard lord_of_flames, embrace_chaos, accelerando
1:26.651 default R incinerate Fluffy_Pillow 264933.3/1100000: 24% mana | 1.0/5: 20% soul_shard lord_of_flames, embrace_chaos, accelerando(2)
1:28.032 default R incinerate Fluffy_Pillow 219637.2/1100000: 20% mana | 1.0/5: 20% soul_shard lord_of_flames, embrace_chaos, accelerando(2)
1:29.415 default E immolate Fluffy_Pillow 174428.6/1100000: 16% mana | 1.0/5: 20% soul_shard lord_of_flames, embrace_chaos, accelerando(3)
1:30.505 default R incinerate Fluffy_Pillow 125004.6/1100000: 11% mana | 1.0/5: 20% soul_shard lord_of_flames, embrace_chaos, accelerando(3)
1:31.868 default P dimensional_rift Fluffy_Pillow 79732.1/1100000: 7% mana | 2.0/5: 40% soul_shard lord_of_flames, accelerando(3)
1:32.957 default Q chaos_bolt Fluffy_Pillow 96292.8/1100000: 9% mana | 2.0/5: 40% soul_shard lord_of_flames, accelerando(3)
1:35.132 default R incinerate Fluffy_Pillow 129782.0/1100000: 12% mana | 0.0/5: 0% soul_shard lord_of_flames, embrace_chaos, accelerando
1:36.537 default R incinerate Fluffy_Pillow 84542.8/1100000: 8% mana | 0.0/5: 0% soul_shard lord_of_flames, embrace_chaos, accelerando
1:37.940 default S life_tap Fluffy_Pillow 39274.9/1100000: 4% mana | 0.0/5: 0% soul_shard lord_of_flames, embrace_chaos, accelerando(2)
1:39.044 default R incinerate Fluffy_Pillow 385826.0/1100000: 35% mana | 0.0/5: 0% soul_shard lord_of_flames, embrace_chaos, accelerando(2)
1:40.427 default G immolate Fluffy_Pillow 340559.9/1100000: 31% mana | 1.0/5: 20% soul_shard lord_of_flames, accelerando(2)
1:41.531 default J conflagrate Fluffy_Pillow 291111.9/1100000: 26% mana | 1.0/5: 20% soul_shard lord_of_flames, accelerando(3)
1:42.621 default L service_imp Fluffy_Pillow 307687.9/1100000: 28% mana | 3.0/5: 60% soul_shard lord_of_flames, accelerando(3)
1:43.709 default C havoc enemy2 324233.4/1100000: 29% mana | 2.0/5: 40% soul_shard lord_of_flames, accelerando(3)
1:44.798 default K conflagrate Fluffy_Pillow 252794.1/1100000: 23% mana | 2.0/5: 40% soul_shard lord_of_flames, accelerando(3)
1:45.886 default Q chaos_bolt Fluffy_Pillow 269339.6/1100000: 24% mana | 3.0/5: 60% soul_shard lord_of_flames, conflagration_of_chaos, accelerando(3)
1:48.059 default K conflagrate Fluffy_Pillow 301773.1/1100000: 27% mana | 1.0/5: 20% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando
1:49.182 default Q chaos_bolt Fluffy_Pillow 318367.0/1100000: 29% mana | 4.0/5: 80% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando
1:50.525 default K conflagrate Fluffy_Pillow 338212.5/1100000: 31% mana | 2.0/5: 40% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(2)
1:51.630 default Q chaos_bolt Fluffy_Pillow 354778.6/1100000: 32% mana | 5.0/5: 100% soul_shard lord_of_flames, embrace_chaos, accelerando(2)
1:52.955 default Q chaos_bolt Fluffy_Pillow 374686.5/1100000: 34% mana | 3.0/5: 60% soul_shard lord_of_flames, embrace_chaos, accelerando(3)
1:54.261 default R incinerate Fluffy_Pillow 394547.2/1100000: 36% mana | 1.0/5: 20% soul_shard lord_of_flames, embrace_chaos, accelerando(3)
1:55.625 default K conflagrate Fluffy_Pillow 349289.9/1100000: 32% mana | 1.0/5: 20% soul_shard lord_of_flames, embrace_chaos, nefarious_pact, accelerando(3)
1:56.380 default R incinerate Fluffy_Pillow 360771.4/1100000: 33% mana | 2.0/5: 40% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, nefarious_pact, accelerando(3)
1:57.326 default R incinerate Fluffy_Pillow 309157.5/1100000: 28% mana | 2.0/5: 40% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, nefarious_pact, accelerando(3)
1:58.271 default P dimensional_rift Fluffy_Pillow 257528.4/1100000: 23% mana | 2.0/5: 40% soul_shard lord_of_flames, conflagration_of_chaos, nefarious_pact, accelerando(3)
1:59.025 default Q chaos_bolt Fluffy_Pillow 268994.7/1100000: 24% mana | 2.0/5: 40% soul_shard lord_of_flames, conflagration_of_chaos, nefarious_pact, accelerando(3)
2:00.531 default R incinerate Fluffy_Pillow 291717.7/1100000: 27% mana | 0.0/5: 0% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, nefarious_pact
2:01.520 default R incinerate Fluffy_Pillow 240118.6/1100000: 22% mana | 0.0/5: 0% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, nefarious_pact
2:02.507 default R incinerate Fluffy_Pillow 188490.4/1100000: 17% mana | 0.0/5: 0% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, nefarious_pact
2:03.492 default E immolate Fluffy_Pillow 136833.1/1100000: 12% mana | 0.0/5: 0% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, nefarious_pact
2:04.280 default R incinerate Fluffy_Pillow 82307.2/1100000: 7% mana | 0.0/5: 0% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, nefarious_pact
2:05.269 default S life_tap Fluffy_Pillow 30708.1/1100000: 3% mana | 0.0/5: 0% soul_shard lord_of_flames, conflagration_of_chaos, nefarious_pact
2:06.060 default C havoc enemy2 372225.9/1100000: 34% mana | 0.0/5: 0% soul_shard lord_of_flames, conflagration_of_chaos, nefarious_pact
2:06.849 default F immolate enemy2 295714.6/1100000: 27% mana | 0.0/5: 0% soul_shard lord_of_flames, conflagration_of_chaos, nefarious_pact
2:07.637 default O soul_harvest Fluffy_Pillow 241189.3/1100000: 22% mana | 0.0/5: 0% soul_shard lord_of_flames, conflagration_of_chaos, devils_due, accelerando
2:07.637 default I potion Fluffy_Pillow 241189.3/1100000: 22% mana | 0.0/5: 0% soul_shard soul_harvest, lord_of_flames, conflagration_of_chaos, devils_due, accelerando
2:07.637 default R incinerate Fluffy_Pillow 241189.3/1100000: 22% mana | 0.0/5: 0% soul_shard soul_harvest, lord_of_flames, conflagration_of_chaos, devils_due, accelerando, potion_of_deadly_grace
2:09.291 default R incinerate Fluffy_Pillow 199629.4/1100000: 18% mana | 0.0/5: 0% soul_shard soul_harvest, lord_of_flames, conflagration_of_chaos, devils_due, accelerando, potion_of_deadly_grace
2:10.943 default R incinerate Fluffy_Pillow 158040.0/1100000: 14% mana | 0.0/5: 0% soul_shard soul_harvest, lord_of_flames, conflagration_of_chaos, devils_due, accelerando, potion_of_deadly_grace
2:12.596 default R incinerate Fluffy_Pillow 116465.4/1100000: 11% mana | 0.0/5: 0% soul_shard soul_harvest, lord_of_flames, conflagration_of_chaos, devils_due, accelerando, potion_of_deadly_grace
2:14.249 default G immolate Fluffy_Pillow 74890.7/1100000: 7% mana | 0.0/5: 0% soul_shard soul_harvest, lord_of_flames, conflagration_of_chaos, devils_due, accelerando, potion_of_deadly_grace
2:15.569 default J conflagrate Fluffy_Pillow 28395.5/1100000: 3% mana | 0.0/5: 0% soul_shard soul_harvest, lord_of_flames, conflagration_of_chaos, nefarious_pact, accelerando, potion_of_deadly_grace
2:16.345 default K conflagrate Fluffy_Pillow 39862.0/1100000: 4% mana | 1.0/5: 20% soul_shard soul_harvest, lord_of_flames, conflagration_of_chaos, nefarious_pact, accelerando, potion_of_deadly_grace
2:17.124 default K conflagrate Fluffy_Pillow 51372.8/1100000: 5% mana | 2.0/5: 40% soul_shard soul_harvest, lord_of_flames, conflagration_of_chaos, nefarious_pact, accelerando, potion_of_deadly_grace
2:17.902 default P dimensional_rift Fluffy_Pillow 62868.8/1100000: 6% mana | 4.0/5: 80% soul_shard soul_harvest, lord_of_flames, nefarious_pact, accelerando, potion_of_deadly_grace
2:18.679 default Q chaos_bolt Fluffy_Pillow 74350.0/1100000: 7% mana | 4.0/5: 80% soul_shard soul_harvest, lord_of_flames, nefarious_pact, accelerando, potion_of_deadly_grace
2:20.230 default Q chaos_bolt Fluffy_Pillow 97139.9/1100000: 9% mana | 3.0/5: 60% soul_shard soul_harvest, lord_of_flames, embrace_chaos, nefarious_pact, potion_of_deadly_grace
2:21.175 default R incinerate Fluffy_Pillow 110960.8/1100000: 10% mana | 2.0/5: 40% soul_shard soul_harvest, lord_of_flames, embrace_chaos, nefarious_pact, accelerando, potion_of_deadly_grace
2:22.148 default S life_tap Fluffy_Pillow 59338.2/1100000: 5% mana | 2.0/5: 40% soul_shard soul_harvest, lord_of_flames, embrace_chaos, nefarious_pact, accelerando, potion_of_deadly_grace
2:22.926 default Q chaos_bolt Fluffy_Pillow 400834.2/1100000: 36% mana | 3.0/5: 60% soul_shard soul_harvest, lord_of_flames, embrace_chaos, nefarious_pact, accelerando, potion_of_deadly_grace
2:23.859 default K conflagrate Fluffy_Pillow 414620.6/1100000: 38% mana | 2.0/5: 40% soul_shard soul_harvest, lord_of_flames, embrace_chaos, nefarious_pact, accelerando, potion_of_deadly_grace
2:24.637 default Q chaos_bolt Fluffy_Pillow 426251.8/1100000: 39% mana | 3.0/5: 60% soul_shard soul_harvest, lord_of_flames, conflagration_of_chaos, embrace_chaos, nefarious_pact, accelerando(2), potion_of_deadly_grace
2:25.555 default R incinerate Fluffy_Pillow 440014.4/1100000: 40% mana | 1.0/5: 20% soul_shard soul_harvest, lord_of_flames, conflagration_of_chaos, embrace_chaos, nefarious_pact, accelerando(2), potion_of_deadly_grace
2:26.513 default C havoc enemy2 388376.7/1100000: 35% mana | 1.0/5: 20% soul_shard soul_harvest, lord_of_flames, conflagration_of_chaos, embrace_chaos, nefarious_pact, accelerando(2), potion_of_deadly_grace
2:27.281 default R incinerate Fluffy_Pillow 311890.6/1100000: 28% mana | 2.0/5: 40% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, nefarious_pact, accelerando(2), potion_of_deadly_grace
2:28.241 default Q chaos_bolt Fluffy_Pillow 260282.9/1100000: 24% mana | 2.0/5: 40% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, devils_due, accelerando(2), potion_of_deadly_grace
2:29.801 default K conflagrate Fluffy_Pillow 283670.3/1100000: 26% mana | 1.0/5: 20% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, devils_due, accelerando(2), potion_of_deadly_grace
2:31.101 default Q chaos_bolt Fluffy_Pillow 303159.9/1100000: 28% mana | 3.0/5: 60% soul_shard lord_of_flames, embrace_chaos, devils_due, accelerando(2), potion_of_deadly_grace
2:32.661 default R incinerate Fluffy_Pillow 326547.4/1100000: 30% mana | 1.0/5: 20% soul_shard lord_of_flames, embrace_chaos, devils_due, accelerando(2), potion_of_deadly_grace
2:34.291 default R incinerate Fluffy_Pillow 284381.9/1100000: 26% mana | 2.0/5: 40% soul_shard lord_of_flames, embrace_chaos, devils_due, potion_of_deadly_grace
2:35.967 default Q chaos_bolt Fluffy_Pillow 242960.8/1100000: 22% mana | 2.0/5: 40% soul_shard lord_of_flames, embrace_chaos, accelerando, potion_of_deadly_grace
2:37.310 default E immolate Fluffy_Pillow 262805.5/1100000: 24% mana | 1.0/5: 20% soul_shard lord_of_flames, embrace_chaos, accelerando, potion_of_deadly_grace
2:38.430 default R incinerate Fluffy_Pillow 213355.1/1100000: 19% mana | 2.0/5: 40% soul_shard lord_of_flames, embrace_chaos, accelerando
2:39.835 default R incinerate Fluffy_Pillow 168115.9/1100000: 15% mana | 2.0/5: 40% soul_shard lord_of_flames, embrace_chaos, accelerando
2:41.238 default Q chaos_bolt Fluffy_Pillow 122847.1/1100000: 11% mana | 2.0/5: 40% soul_shard lord_of_flames, embrace_chaos, accelerando
2:42.583 default R incinerate Fluffy_Pillow 142721.3/1100000: 13% mana | 0.0/5: 0% soul_shard lord_of_flames, embrace_chaos, accelerando
2:43.985 default R incinerate Fluffy_Pillow 97438.5/1100000: 9% mana | 0.0/5: 0% soul_shard lord_of_flames, embrace_chaos, accelerando(2)
2:45.368 default S life_tap Fluffy_Pillow 52172.4/1100000: 5% mana | 0.0/5: 0% soul_shard lord_of_flames, embrace_chaos, accelerando(2)
2:46.471 default R incinerate Fluffy_Pillow 398708.5/1100000: 36% mana | 1.0/5: 20% soul_shard lord_of_flames, embrace_chaos, accelerando(2)
2:47.854 default C havoc enemy2 353197.2/1100000: 32% mana | 1.0/5: 20% soul_shard lord_of_flames, accelerando
2:48.974 default G immolate Fluffy_Pillow 281746.7/1100000: 26% mana | 2.0/5: 40% soul_shard lord_of_flames, accelerando
2:50.095 default J conflagrate Fluffy_Pillow 232361.3/1100000: 21% mana | 3.0/5: 60% soul_shard lord_of_flames, accelerando(2)
2:51.201 default Q chaos_bolt Fluffy_Pillow 248942.4/1100000: 23% mana | 4.0/5: 80% soul_shard lord_of_flames, accelerando(2)
2:53.407 default K conflagrate Fluffy_Pillow 282015.8/1100000: 26% mana | 2.0/5: 40% soul_shard lord_of_flames, embrace_chaos, accelerando(3)
2:54.497 default Q chaos_bolt Fluffy_Pillow 298591.7/1100000: 27% mana | 3.0/5: 60% soul_shard lord_of_flames, embrace_chaos, accelerando(3)
2:55.804 default K conflagrate Fluffy_Pillow 318467.6/1100000: 29% mana | 1.0/5: 20% soul_shard lord_of_flames, embrace_chaos, accelerando(3)
2:56.893 default Q chaos_bolt Fluffy_Pillow 335028.3/1100000: 30% mana | 3.0/5: 60% soul_shard lord_of_flames, embrace_chaos, accelerando(3)
2:58.200 default K conflagrate Fluffy_Pillow 354904.3/1100000: 32% mana | 1.0/5: 20% soul_shard lord_of_flames, embrace_chaos, accelerando(3)
2:59.290 default Q chaos_bolt Fluffy_Pillow 371621.2/1100000: 34% mana | 3.0/5: 60% soul_shard lord_of_flames, embrace_chaos, accelerando(4)
3:00.577 default P dimensional_rift Fluffy_Pillow 390625.0/1100000: 36% mana | 2.0/5: 40% soul_shard lord_of_flames, embrace_chaos
3:01.915 default R incinerate Fluffy_Pillow 410107.7/1100000: 37% mana | 2.0/5: 40% soul_shard lord_of_flames, embrace_chaos
3:03.338 default H berserking Fluffy_Pillow 364828.1/1100000: 33% mana | 3.0/5: 60% soul_shard lord_of_flames, embrace_chaos
3:03.338 default Q chaos_bolt Fluffy_Pillow 364828.1/1100000: 33% mana | 3.0/5: 60% soul_shard berserking, lord_of_flames, embrace_chaos
3:04.523 default K conflagrate Fluffy_Pillow 384671.9/1100000: 35% mana | 1.0/5: 20% soul_shard berserking, lord_of_flames, embrace_chaos, accelerando
3:05.497 default R incinerate Fluffy_Pillow 401223.0/1100000: 36% mana | 2.0/5: 40% soul_shard berserking, lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando
3:06.716 default R incinerate Fluffy_Pillow 355938.0/1100000: 32% mana | 2.0/5: 40% soul_shard berserking, lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(2)
3:07.921 default C havoc enemy2 310872.0/1100000: 28% mana | 2.0/5: 40% soul_shard berserking, lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(3)
3:08.868 default Q chaos_bolt Fluffy_Pillow 239433.5/1100000: 22% mana | 2.0/5: 40% soul_shard berserking, lord_of_flames, conflagration_of_chaos, accelerando(3)
3:10.759 default R incinerate Fluffy_Pillow 272504.0/1100000: 25% mana | 0.0/5: 0% soul_shard berserking, lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(3)
3:11.945 default E immolate Fluffy_Pillow 227246.2/1100000: 21% mana | 0.0/5: 0% soul_shard berserking, lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(4)
3:12.879 default R incinerate Fluffy_Pillow 177812.0/1100000: 16% mana | 0.0/5: 0% soul_shard berserking, lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(4)
3:14.050 default R incinerate Fluffy_Pillow 130934.0/1100000: 12% mana | 0.0/5: 0% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(4)
3:15.394 default L service_imp Fluffy_Pillow 85662.4/1100000: 8% mana | 1.0/5: 20% soul_shard lord_of_flames, conflagration_of_chaos, accelerando(4)
3:16.467 default R incinerate Fluffy_Pillow 102211.1/1100000: 9% mana | 0.0/5: 0% soul_shard lord_of_flames, conflagration_of_chaos, accelerando(4)
3:17.811 default S life_tap Fluffy_Pillow 55826.9/1100000: 5% mana | 1.0/5: 20% soul_shard lord_of_flames, conflagration_of_chaos
3:18.947 default G immolate Fluffy_Pillow 402368.2/1100000: 37% mana | 1.0/5: 20% soul_shard lord_of_flames, conflagration_of_chaos
3:20.085 default J conflagrate Fluffy_Pillow 352939.8/1100000: 32% mana | 1.0/5: 20% soul_shard lord_of_flames, conflagration_of_chaos, accelerando
3:21.204 default K conflagrate Fluffy_Pillow 369474.6/1100000: 34% mana | 2.0/5: 40% soul_shard lord_of_flames, conflagration_of_chaos, accelerando
3:22.324 default Q chaos_bolt Fluffy_Pillow 386412.9/1100000: 35% mana | 4.0/5: 80% soul_shard lord_of_flames, conflagration_of_chaos, accelerando(3)
3:24.497 default K conflagrate Fluffy_Pillow 419458.3/1100000: 38% mana | 2.0/5: 40% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(3)
3:25.586 default Q chaos_bolt Fluffy_Pillow 436019.0/1100000: 40% mana | 3.0/5: 60% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(3)
3:26.893 default R incinerate Fluffy_Pillow 455894.9/1100000: 41% mana | 1.0/5: 20% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(3)
3:28.257 default C havoc enemy2 410637.6/1100000: 37% mana | 2.0/5: 40% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(3)
3:29.348 default K conflagrate Fluffy_Pillow 339228.8/1100000: 31% mana | 2.0/5: 40% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(3)
3:30.438 default Q chaos_bolt Fluffy_Pillow 355804.7/1100000: 32% mana | 4.0/5: 80% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(3)
3:31.744 default R incinerate Fluffy_Pillow 375665.4/1100000: 34% mana | 2.0/5: 40% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(3)
3:33.107 default Q chaos_bolt Fluffy_Pillow 329730.2/1100000: 30% mana | 3.0/5: 60% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando
3:34.450 default K conflagrate Fluffy_Pillow 349620.1/1100000: 32% mana | 1.0/5: 20% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(2)
3:35.554 default Q chaos_bolt Fluffy_Pillow 366171.2/1100000: 33% mana | 3.0/5: 60% soul_shard lord_of_flames, embrace_chaos, accelerando(2)
3:36.877 default R incinerate Fluffy_Pillow 386012.7/1100000: 35% mana | 1.0/5: 20% soul_shard lord_of_flames, embrace_chaos, accelerando(3)
3:38.240 default R incinerate Fluffy_Pillow 340740.2/1100000: 31% mana | 2.0/5: 40% soul_shard lord_of_flames, embrace_chaos, accelerando(3)
3:39.604 default Q chaos_bolt Fluffy_Pillow 295483.0/1100000: 27% mana | 3.0/5: 60% soul_shard lord_of_flames, embrace_chaos, accelerando(3)
3:40.910 default R incinerate Fluffy_Pillow 315343.7/1100000: 29% mana | 2.0/5: 40% soul_shard lord_of_flames, embrace_chaos, accelerando(3)
3:42.274 default E immolate Fluffy_Pillow 270086.4/1100000: 25% mana | 2.0/5: 40% soul_shard lord_of_flames, embrace_chaos, accelerando(3)
3:43.362 default P dimensional_rift Fluffy_Pillow 220631.9/1100000: 20% mana | 2.0/5: 40% soul_shard lord_of_flames, embrace_chaos, accelerando(3)
3:44.451 default Q chaos_bolt Fluffy_Pillow 237192.7/1100000: 22% mana | 3.0/5: 60% soul_shard lord_of_flames, embrace_chaos, accelerando(3)
3:45.757 default P dimensional_rift Fluffy_Pillow 256674.2/1100000: 23% mana | 1.0/5: 20% soul_shard lord_of_flames, embrace_chaos, accelerando
3:46.897 default R incinerate Fluffy_Pillow 273519.3/1100000: 25% mana | 1.0/5: 20% soul_shard lord_of_flames, embrace_chaos, accelerando
3:48.302 default C havoc enemy2 228383.8/1100000: 21% mana | 2.0/5: 40% soul_shard lord_of_flames, embrace_chaos, accelerando(2)
3:49.407 default N summon_doomguard Fluffy_Pillow 156949.9/1100000: 14% mana | 2.0/5: 40% soul_shard lord_of_flames, embrace_chaos, accelerando(2)
3:50.509 default R incinerate Fluffy_Pillow 173569.1/1100000: 16% mana | 1.0/5: 20% soul_shard lord_of_flames, accelerando(3)
3:51.873 default G immolate Fluffy_Pillow 128311.8/1100000: 12% mana | 1.0/5: 20% soul_shard lord_of_flames, accelerando(3)
3:52.963 default J conflagrate Fluffy_Pillow 78887.7/1100000: 7% mana | 2.0/5: 40% soul_shard lord_of_flames, accelerando(3)
3:54.051 default Q chaos_bolt Fluffy_Pillow 95433.2/1100000: 9% mana | 3.0/5: 60% soul_shard lord_of_flames, conflagration_of_chaos, accelerando(3)
3:56.226 default K conflagrate Fluffy_Pillow 128509.1/1100000: 12% mana | 1.0/5: 20% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(3)
3:57.315 default Q chaos_bolt Fluffy_Pillow 145069.8/1100000: 13% mana | 3.0/5: 60% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(3)
3:58.620 default K conflagrate Fluffy_Pillow 164227.7/1100000: 15% mana | 1.0/5: 20% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando
3:59.741 default K conflagrate Fluffy_Pillow 180792.1/1100000: 16% mana | 2.0/5: 40% soul_shard lord_of_flames, embrace_chaos, nefarious_pact, accelerando
4:00.744 default Q chaos_bolt Fluffy_Pillow 195873.3/1100000: 18% mana | 3.0/5: 60% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, nefarious_pact, accelerando(3)
4:01.649 default R incinerate Fluffy_Pillow 209635.9/1100000: 19% mana | 1.0/5: 20% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, nefarious_pact, accelerando(3)
4:02.596 default R incinerate Fluffy_Pillow 158037.2/1100000: 14% mana | 2.0/5: 40% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, nefarious_pact, accelerando(3)
4:03.542 default R incinerate Fluffy_Pillow 106423.3/1100000: 10% mana | 2.0/5: 40% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, nefarious_pact, accelerando(3)
4:04.488 default S life_tap Fluffy_Pillow 54809.3/1100000: 5% mana | 2.0/5: 40% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, nefarious_pact, accelerando(3)
4:05.244 default Q chaos_bolt Fluffy_Pillow 396306.0/1100000: 36% mana | 2.0/5: 40% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, nefarious_pact, accelerando(3)
4:06.150 default R incinerate Fluffy_Pillow 410083.8/1100000: 37% mana | 1.0/5: 20% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, nefarious_pact, accelerando(3)
4:07.095 default K conflagrate Fluffy_Pillow 358634.7/1100000: 33% mana | 1.0/5: 20% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, nefarious_pact, accelerando(5)
4:07.850 default O soul_harvest Fluffy_Pillow 370441.6/1100000: 34% mana | 2.0/5: 40% soul_shard lord_of_flames, embrace_chaos, nefarious_pact, accelerando(5)
4:07.850 default R incinerate Fluffy_Pillow 370441.6/1100000: 34% mana | 2.0/5: 40% soul_shard soul_harvest, lord_of_flames, embrace_chaos, nefarious_pact, accelerando(5)
4:08.771 default C havoc enemy2 318844.3/1100000: 29% mana | 3.0/5: 60% soul_shard soul_harvest, lord_of_flames, embrace_chaos, nefarious_pact, accelerando(5)
4:09.526 default Q chaos_bolt Fluffy_Pillow 242651.2/1100000: 22% mana | 3.0/5: 60% soul_shard soul_harvest, lord_of_flames, embrace_chaos, nefarious_pact, accelerando(5)
4:10.406 default R incinerate Fluffy_Pillow 256412.8/1100000: 23% mana | 1.0/5: 20% soul_shard soul_harvest, lord_of_flames, embrace_chaos, nefarious_pact, accelerando(5)
4:11.326 default R incinerate Fluffy_Pillow 204155.3/1100000: 19% mana | 1.0/5: 20% soul_shard soul_harvest, lord_of_flames, embrace_chaos, devils_due, accelerando
4:12.980 default Q chaos_bolt Fluffy_Pillow 162612.0/1100000: 15% mana | 2.0/5: 40% soul_shard soul_harvest, lord_of_flames, embrace_chaos, devils_due, accelerando(2)
4:14.540 default E immolate Fluffy_Pillow 185999.5/1100000: 17% mana | 0.0/5: 0% soul_shard soul_harvest, lord_of_flames, embrace_chaos, devils_due, accelerando(2)
4:15.841 default R incinerate Fluffy_Pillow 139504.0/1100000: 13% mana | 0.0/5: 0% soul_shard soul_harvest, lord_of_flames, embrace_chaos, devils_due, accelerando(2)
4:17.471 default R incinerate Fluffy_Pillow 98034.8/1100000: 9% mana | 0.0/5: 0% soul_shard soul_harvest, lord_of_flames, embrace_chaos, devils_due, accelerando(3)
4:19.078 default S life_tap Fluffy_Pillow 56474.0/1100000: 5% mana | 0.0/5: 0% soul_shard soul_harvest, lord_of_flames, accelerando(4)
4:20.153 default R incinerate Fluffy_Pillow 403053.6/1100000: 37% mana | 0.0/5: 0% soul_shard soul_harvest, lord_of_flames, accelerando(4)
4:21.497 default R incinerate Fluffy_Pillow 357862.9/1100000: 33% mana | 0.0/5: 0% soul_shard soul_harvest, lord_of_flames, accelerando(5)
4:22.823 default R incinerate Fluffy_Pillow 312546.1/1100000: 28% mana | 0.0/5: 0% soul_shard soul_harvest, lord_of_flames, accelerando
4:24.228 default G immolate Fluffy_Pillow 267308.2/1100000: 24% mana | 0.0/5: 0% soul_shard soul_harvest, lord_of_flames, accelerando(2)
4:25.333 default J conflagrate Fluffy_Pillow 217874.4/1100000: 20% mana | 0.0/5: 0% soul_shard soul_harvest, lord_of_flames, accelerando(2)
4:26.437 default K conflagrate Fluffy_Pillow 234425.5/1100000: 21% mana | 2.0/5: 40% soul_shard soul_harvest, lord_of_flames, conflagration_of_chaos, accelerando(2)
4:27.539 default Q chaos_bolt Fluffy_Pillow 251183.9/1100000: 23% mana | 3.0/5: 60% soul_shard lord_of_flames, conflagration_of_chaos, accelerando(3)
4:29.714 default C havoc enemy2 284260.8/1100000: 26% mana | 1.0/5: 20% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(4)
4:30.789 default J conflagrate Fluffy_Pillow 212840.4/1100000: 19% mana | 2.0/5: 40% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(4)
4:31.864 default P dimensional_rift Fluffy_Pillow 229420.0/1100000: 21% mana | 3.0/5: 60% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(4)
4:32.937 default J conflagrate Fluffy_Pillow 245968.8/1100000: 22% mana | 4.0/5: 80% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, nefarious_pact, accelerando(4)
4:33.693 default Q chaos_bolt Fluffy_Pillow 257628.5/1100000: 23% mana | 5.0/5: 100% soul_shard lord_of_flames, embrace_chaos, nefarious_pact, accelerando(4)
4:34.589 default Q chaos_bolt Fluffy_Pillow 271448.9/1100000: 25% mana | 3.0/5: 60% soul_shard lord_of_flames, embrace_chaos, nefarious_pact, accelerando(5)
4:35.472 default R incinerate Fluffy_Pillow 284554.1/1100000: 26% mana | 1.0/5: 20% soul_shard lord_of_flames, embrace_chaos, nefarious_pact
4:36.461 default R incinerate Fluffy_Pillow 232956.2/1100000: 21% mana | 1.0/5: 20% soul_shard lord_of_flames, embrace_chaos, nefarious_pact, accelerando
4:37.437 default R incinerate Fluffy_Pillow 181454.5/1100000: 16% mana | 2.0/5: 40% soul_shard lord_of_flames, embrace_chaos, nefarious_pact, accelerando(2)
4:38.397 default R incinerate Fluffy_Pillow 129999.5/1100000: 12% mana | 2.0/5: 40% soul_shard lord_of_flames, embrace_chaos, nefarious_pact, accelerando(4)
4:39.331 default J conflagrate Fluffy_Pillow 78404.5/1100000: 7% mana | 2.0/5: 40% soul_shard lord_of_flames, embrace_chaos, nefarious_pact, accelerando(4)
4:40.149 default Q chaos_bolt Fluffy_Pillow 91020.4/1100000: 8% mana | 3.0/5: 60% soul_shard lord_of_flames, nefarious_pact, accelerando(4)
4:41.637 default R incinerate Fluffy_Pillow 113969.7/1100000: 10% mana | 2.0/5: 40% soul_shard lord_of_flames, embrace_chaos, nefarious_pact, accelerando(4)
4:42.570 default S life_tap Fluffy_Pillow 62359.2/1100000: 6% mana | 2.0/5: 40% soul_shard lord_of_flames, embrace_chaos, nefarious_pact, accelerando(4)
4:43.326 default R incinerate Fluffy_Pillow 404018.9/1100000: 37% mana | 2.0/5: 40% soul_shard lord_of_flames, embrace_chaos, nefarious_pact, accelerando(4)
4:44.261 default Q chaos_bolt Fluffy_Pillow 352439.3/1100000: 32% mana | 3.0/5: 60% soul_shard lord_of_flames, embrace_chaos, devils_due, accelerando(4)
4:45.779 default J conflagrate Fluffy_Pillow 375852.5/1100000: 34% mana | 1.0/5: 20% soul_shard lord_of_flames, embrace_chaos, devils_due, accelerando(5)
4:47.061 default E immolate Fluffy_Pillow 395900.7/1100000: 36% mana | 3.0/5: 60% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, devils_due, accelerando(5)
4:48.307 default L service_imp Fluffy_Pillow 349385.9/1100000: 32% mana | 3.0/5: 60% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, devils_due, accelerando(5)
4:49.551 default Q chaos_bolt Fluffy_Pillow 367659.3/1100000: 33% mana | 3.0/5: 60% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, devils_due
4:51.158 default C havoc enemy2 391060.0/1100000: 36% mana | 1.0/5: 20% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, devils_due, accelerando
4:52.478 default J conflagrate Fluffy_Pillow 322564.8/1100000: 29% mana | 1.0/5: 20% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando
4:53.598 default R incinerate Fluffy_Pillow 339114.3/1100000: 31% mana | 2.0/5: 40% soul_shard lord_of_flames, embrace_chaos, accelerando
4:55.001 default Q chaos_bolt Fluffy_Pillow 294055.1/1100000: 27% mana | 3.0/5: 60% soul_shard lord_of_flames, embrace_chaos, accelerando(2)
4:56.324 default R incinerate Fluffy_Pillow 313902.9/1100000: 29% mana | 1.0/5: 20% soul_shard lord_of_flames, embrace_chaos, accelerando(3)

Stats

Raid-Buffed Unbuffed Gear Amount
Strength 4201 3876 0
Agility 7254 6929 0
Stamina 54760 54760 34229
Intellect 50379 48673 39032 (1278)
Spirit 1 1 0
Health 3285600 3285600 0
Mana 1100000 1100000 0
Soul Shard 5 5 0
Spell Power 50379 48673 0
Crit 13.33% 13.33% 3330
Haste 32.37% 31.37% 11765
Damage / Heal Versatility 5.96% 5.96% 2829
ManaReg per Second 14561 14451 0
Mastery 67.59% 67.59% 5813
Armor 1979 1979 1979
Run Speed 7 0 0

Gear

Source Slot Average Item Level: 906.00
Local Head Eyes of Azj'Aqir
ilevel: 900, stats: { 253 Armor, +3255 Sta, +2170 Int, +1074 Haste, +578 Vers }
Local Neck Radiant String of Scorpid Eyes
ilevel: 900, stats: { +1831 Sta, +2011 Haste, +922 Crit }, enchant: mark_of_the_hidden_satyr
Local Shoulders Pauldrons of Azj'Aqir
ilevel: 900, stats: { 233 Armor, +2442 Sta, +1628 Int, +752 Mastery, +487 Vers }
Local Chest Robes of Fluctuating Energy
ilevel: 900, stats: { 311 Armor, +3255 Sta, +2170 Int, +1145 Haste, +507 Mastery }
Local Waist Man'ari Skullbuckled Cinch
ilevel: 900, stats: { 175 Armor, +2442 Sta, +1628 Int, +699 Haste, +540 Mastery }
Local Legs Leggings of Azj'Aqir
ilevel: 900, stats: { 272 Armor, +3255 Sta, +2170 Int, +932 Crit, +720 Haste }
Local Feet Norgannon's Foresight
ilevel: 940, stats: { 247 Armor, +3544 Sta, +2362 Int, +822 Haste, +617 Mastery, +617 Crit }
Local Wrists Woven Lasher Tendril Bracers
ilevel: 900, stats: { 136 Armor, +1831 Sta, +1221 Int, +644 Haste, +285 Vers }
Local Hands Clutch of Azj'Aqir
ilevel: 900, stats: { 194 Armor, +2442 Sta, +1628 Int, +859 Crit, +380 Mastery }
Local Finger1 Ring of the Scoured Clan
ilevel: 900, stats: { +1831 Sta, +2095 Mastery, +838 Haste }, enchant: { +200 Haste }
Local Finger2 Ring of Braided Stems
ilevel: 905, stats: { +1918 Sta, +1814 Haste, +1209 Vers }, enchant: { +200 Haste }
Local Trinket1 Whispers in the Dark
ilevel: 905, stats: { +2162 Int }
Local Trinket2 Erratic Metronome
ilevel: 900, stats: { +2063 Int }
Local Back Astromancer's Greatcloak
ilevel: 905, stats: { 158 Armor, +1918 Sta, +1278 StrAgiInt, +676 Haste, +270 Vers }, enchant: { +200 Int }
Local Main Hand Scepter of Sargeras
ilevel: 929, weapon: { 7005 - 10509, 3.6 }, stats: { +2843 Int, +4265 Sta, +922 Haste, +922 Mastery, +15509 Int }, relics: { +61 ilevels, +59 ilevels, +61 ilevels }

Talents

Level
15 Backdraft (Destruction Warlock) Roaring Blaze (Destruction Warlock) Shadowburn (Destruction Warlock)
30 Reverse Entropy (Destruction Warlock) Eradication (Destruction Warlock) Empowered Life Tap
45 Demonic Circle Mortal Coil Shadowfury
60 Cataclysm (Destruction Warlock) Fire and Brimstone (Destruction Warlock) Soul Harvest
75 Demon Skin Burning Rush Dark Pact
90 Grimoire of Supremacy Grimoire of Service Grimoire of Sacrifice
100 Wreak Havoc (Destruction Warlock) Channel Demonfire (Destruction Warlock) Soul Conduit

Profile

warlock="Norgannon's"
level=110
race=troll
role=spell
position=back
talents=2203021
artifact=38:0:0:0:0:803:1:804:3:805:3:806:3:807:3:808:3:809:3:810:3:811:3:812:3:813:1:814:1:815:1:816:1:817:1:818:1:1355:1:1392:1:1609:4:1610:1:1611:1:1713:1
spec=destruction

# This default action priority list is automatically created based on your character.
# It is a attempt to provide you with a action list that is both simple and practicable,
# while resulting in a meaningful and good simulation. It may not result in the absolutely highest possible dps.
# Feel free to edit, adapt and improve it to your own needs.
# SimulationCraft is always looking for updates and improvements to the default action lists.

# Executed before combat begins. Accepts non-harmful actions only.
actions.precombat=flask,type=whispered_pact
actions.precombat+=/food,type=azshari_salad
actions.precombat+=/summon_pet,if=!talent.grimoire_of_supremacy.enabled&(!talent.grimoire_of_sacrifice.enabled|buff.demonic_power.down)
actions.precombat+=/summon_infernal,if=talent.grimoire_of_supremacy.enabled&artifact.lord_of_flames.rank>0
actions.precombat+=/summon_infernal,if=talent.grimoire_of_supremacy.enabled&active_enemies>1
actions.precombat+=/summon_doomguard,if=talent.grimoire_of_supremacy.enabled&active_enemies=1&artifact.lord_of_flames.rank=0
actions.precombat+=/augmentation,type=defiled
actions.precombat+=/snapshot_stats
actions.precombat+=/grimoire_of_sacrifice,if=talent.grimoire_of_sacrifice.enabled
actions.precombat+=/life_tap,if=talent.empowered_life_tap.enabled&!buff.empowered_life_tap.remains
actions.precombat+=/potion,name=prolonged_power
actions.precombat+=/chaos_bolt

# Executed every time the actor is available.
actions=havoc,target=2,if=active_enemies>1&(active_enemies<4|talent.wreak_havoc.enabled&active_enemies<6)&!debuff.havoc.remains
actions+=/dimensional_rift,if=charges=3
actions+=/immolate,if=remains<=tick_time
actions+=/immolate,cycle_targets=1,if=active_enemies>1&remains<=tick_time&(!talent.roaring_blaze.enabled|(!debuff.roaring_blaze.remains&action.conflagrate.charges<2+set_bonus.tier19_4pc))
actions+=/immolate,if=talent.roaring_blaze.enabled&remains<=duration&!debuff.roaring_blaze.remains&target.time_to_die>10&(action.conflagrate.charges=2+set_bonus.tier19_4pc|(action.conflagrate.charges>=1+set_bonus.tier19_4pc&action.conflagrate.recharge_time<cast_time+gcd)|target.time_to_die<24)
actions+=/berserking
actions+=/blood_fury
actions+=/arcane_torrent
actions+=/potion,name=deadly_grace,if=(buff.soul_harvest.remains|trinket.proc.any.react|target.time_to_die<=45)
actions+=/shadowburn,if=buff.conflagration_of_chaos.remains<=action.chaos_bolt.cast_time
actions+=/shadowburn,if=(charges=1+set_bonus.tier19_4pc&recharge_time<action.chaos_bolt.cast_time|charges=2+set_bonus.tier19_4pc)&soul_shard<5
actions+=/conflagrate,if=talent.roaring_blaze.enabled&(charges=2+set_bonus.tier19_4pc|(charges>=1+set_bonus.tier19_4pc&recharge_time<gcd)|target.time_to_die<24)
actions+=/conflagrate,if=talent.roaring_blaze.enabled&debuff.roaring_blaze.stack>0&dot.immolate.remains>dot.immolate.duration*0.3&(active_enemies=1|soul_shard<3)&soul_shard<5
actions+=/conflagrate,if=!talent.roaring_blaze.enabled&buff.backdraft.stack<3&buff.conflagration_of_chaos.remains<=action.chaos_bolt.cast_time
actions+=/conflagrate,if=!talent.roaring_blaze.enabled&buff.backdraft.stack<3&(charges=1+set_bonus.tier19_4pc&recharge_time<action.chaos_bolt.cast_time|charges=2+set_bonus.tier19_4pc)&soul_shard<5
actions+=/life_tap,if=talent.empowered_life_tap.enabled&buff.empowered_life_tap.remains<=gcd
actions+=/dimensional_rift,if=equipped.144369&!buff.lessons_of_spacetime.remains&((!talent.grimoire_of_supremacy.enabled&!cooldown.summon_doomguard.remains)|(talent.grimoire_of_service.enabled&!cooldown.service_pet.remains)|(talent.soul_harvest.enabled&!cooldown.soul_harvest.remains))
actions+=/service_pet
actions+=/summon_infernal,if=artifact.lord_of_flames.rank>0&!buff.lord_of_flames.remains
actions+=/summon_doomguard,if=!talent.grimoire_of_supremacy.enabled&spell_targets.infernal_awakening<=2&(target.time_to_die>180|target.health.pct<=20|target.time_to_die<30)
actions+=/summon_infernal,if=!talent.grimoire_of_supremacy.enabled&spell_targets.infernal_awakening>2
actions+=/summon_doomguard,if=talent.grimoire_of_supremacy.enabled&spell_targets.summon_infernal=1&artifact.lord_of_flames.rank>0&buff.lord_of_flames.remains&!pet.doomguard.active
actions+=/summon_doomguard,if=talent.grimoire_of_supremacy.enabled&spell_targets.summon_infernal=1&equipped.132379&!cooldown.sindorei_spite_icd.remains
actions+=/summon_infernal,if=talent.grimoire_of_supremacy.enabled&spell_targets.summon_infernal>1&equipped.132379&!cooldown.sindorei_spite_icd.remains
actions+=/soul_harvest
actions+=/channel_demonfire,if=dot.immolate.remains>cast_time
actions+=/havoc,if=active_enemies=1&talent.wreak_havoc.enabled&equipped.132375&!debuff.havoc.remains
actions+=/rain_of_fire,if=active_enemies>=3&cooldown.havoc.remains<=12&!talent.wreak_havoc.enabled
actions+=/rain_of_fire,if=active_enemies>=6&talent.wreak_havoc.enabled
actions+=/dimensional_rift,if=!equipped.144369|charges>1|((!talent.grimoire_of_service.enabled|recharge_time<cooldown.service_pet.remains)&(!talent.soul_harvest.enabled|recharge_time<cooldown.soul_harvest.remains)&(!talent.grimoire_of_supremacy.enabled|recharge_time<cooldown.summon_doomguard.remains))
actions+=/life_tap,if=talent.empowered_life_tap.enabled&buff.empowered_life_tap.remains<duration*0.3
actions+=/cataclysm
actions+=/chaos_bolt,if=(cooldown.havoc.remains>12&cooldown.havoc.remains|active_enemies<3|talent.wreak_havoc.enabled&active_enemies<6)&(set_bonus.tier19_4pc=0|!talent.eradication.enabled|buff.embrace_chaos.remains<=cast_time|soul_shard>=3)
actions+=/shadowburn
actions+=/conflagrate,if=!talent.roaring_blaze.enabled&buff.backdraft.stack<3
actions+=/immolate,if=!talent.roaring_blaze.enabled&remains<=duration*0.3
actions+=/incinerate
actions+=/life_tap

head=eyes_of_azjaqir,id=138314,bonus_id=3445
neck=radiant_string_of_scorpid_eyes,id=140898,bonus_id=3445,enchant_id=5439
shoulders=pauldrons_of_azjaqir,id=138323,bonus_id=3445
back=astromancers_greatcloak,id=140909,bonus_id=3518,enchant_id=5436
chest=robes_of_fluctuating_energy,id=140848,bonus_id=3445
wrists=woven_lasher_tendril_bracers,id=140886,bonus_id=3445
hands=clutch_of_azjaqir,id=138311,bonus_id=3445
waist=manari_skullbuckled_cinch,id=140887,bonus_id=3445
legs=leggings_of_azjaqir,id=138317,bonus_id=3445
feet=norgannons_foresight,id=132455,ilevel=940
finger1=ring_of_the_scoured_clan,id=140897,bonus_id=3445,enchant=binding_of_haste
finger2=ring_of_braided_stems,id=140896,bonus_id=3518,enchant=binding_of_haste
trinket1=whispers_in_the_dark,id=140809,ilevel=905
trinket2=erratic_metronome,id=140792,ilevel=900
main_hand=scepter_of_sargeras,id=128941,ilevel=929,gem_id=140826/140837/140826,relic_id=3519/3518:3518/3519

# Gear Summary
# gear_ilvl=905.60
# gear_stamina=34229
# gear_intellect=39032
# gear_crit_rating=3330
# gear_haste_rating=11765
# gear_mastery_rating=5813
# gear_versatility_rating=2829
# gear_armor=1979
# set_bonus=tier19_2pc=1
# set_bonus=tier19_4pc=1
default_pet=imp

Portal_Pants : 1362070 dps, 813225 dps to main target

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR
1362070.0 1362070.0 1162.0 / 0.085% 234547.8 / 17.2% 44.1
RPS Out RPS In Primary Resource Waiting APM Active Skill
24747.6 24747.6 Mana 0.00% 49.1 100.0% 100%
Talents
  • 15: Roaring Blaze (Destruction Warlock)
  • 30: Eradication (Destruction Warlock)
  • 60: Soul Harvest
  • 90: Grimoire of Service
  • 100: Wreak Havoc (Destruction Warlock)
  • Talent Calculator
Artifact

Charts

Abilities

Damage Stats DPS DPS% Execute Interval DPE DPET Type Count Hit Crit Avg Crit% Up%
Portal_Pants 1362070
Chaos Bolt 405171 29.8% 59.5 4.91sec 2046433 1335782 Direct 113.6 0 1072925 1072925 100.0%  

Stats details: chaos_bolt

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 59.54 113.57 0.00 0.00 1.5320 0.0000 121852714.72 121852714.72 0.00 1335782.10 1335782.10
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
crit 113.57 100.00% 1072924.56 671809 1675210 1073089.87 993190 1157866 121852715 121852715 0.00
 
 

Action details: chaos_bolt

Static Values
  • id:116858
  • school:chromatic
  • resource:soul_shard
  • range:40.0
  • travel_speed:16.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:2.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:3.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:116858
  • name:Chaos Bolt
  • school:chromatic
  • tooltip:
  • description:Unleashes a devastating blast of chaos, causing {$s1=1} Chaos damage. Chaos Bolt always critically strikes and your critical strike chance increases its damage.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:4.000000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
Conflagrate 170032 12.5% 47.5 6.32sec 1074535 1016704 Direct 94.6 317775 723045 539798 54.8%  

Stats details: conflagrate

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 47.51 94.58 0.00 0.00 1.0569 0.0000 51051772.23 51051772.23 0.00 1016704.28 1016704.28
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 42.76 45.22% 317775.28 201529 502522 317897.48 280404 355170 13589502 13589502 0.00
crit 51.81 54.78% 723045.13 403061 1164977 723240.45 638457 812663 37462270 37462270 0.00
 
 

Action details: conflagrate

Static Values
  • id:17962
  • school:fire
  • resource:chi
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:9.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:talent.roaring_blaze.enabled&(charges=2+set_bonus.tier19_4pc|(charges>=1+set_bonus.tier19_4pc&recharge_time<gcd)|target.time_to_die<24)
Spelldata
  • id:17962
  • name:Conflagrate
  • school:fire
  • tooltip:
  • description:Triggers an explosion on the target, dealing {$s1=1} Fire damage.{$?s196406=false}[ Reduces the cast time of Incinerate and Chaos Bolt by {$117828s1=30}% for {$117828d=10 seconds}.][] |cFFFFFFFFGenerates 1 Soul Shard.|r
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:2.265510
  • base_dd_min:1.00
  • base_dd_max:1.00
 
Cry Havoc 41452 3.0% 51.0 5.66sec 244288 0 Direct 102.1 105383 210627 122144 15.9%  

Stats details: cry_havoc

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 51.04 102.07 0.00 0.00 0.0000 0.0000 12467248.61 12467248.61 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 85.82 84.07% 105383.23 72574 161579 105423.33 97653 115015 9043463 9043463 0.00
crit 16.26 15.93% 210627.35 145147 323162 210707.27 170877 257311 3423785 3423785 0.00
 
 

Action details: cry_havoc

Static Values
  • id:243011
  • school:chromatic
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:243011
  • name:Cry Havoc
  • school:chromatic
  • tooltip:
  • description:Deals {$s2=0} Chaos damage to enemies within $A2 yards.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:1.000000
  • base_dd_min:0.00
  • base_dd_max:0.00
 
Deadly Grace 6046 0.4% 14.1 2.10sec 126388 0 Direct 14.1 109267 218251 126390 15.7%  

Stats details: deadly_grace

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 14.12 14.12 0.00 0.00 0.0000 0.0000 1784667.92 1784667.92 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 11.90 84.29% 109266.88 96891 116269 109282.09 101736 116269 1300525 1300525 0.00
crit 2.22 15.71% 218250.52 193782 232539 197593.39 0 232539 484143 484143 0.00
 
 

Action details: deadly_grace

Static Values
  • id:188091
  • school:arcane
  • resource:none
  • range:40.0
  • travel_speed:25.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:188091
  • name:Deadly Grace
  • school:arcane
  • tooltip:
  • description:Deal {$s1=63339 to 95008} Arcane damage.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:63338.72
  • base_dd_max:95008.08
 
Immolate 311037 22.8% 19.7 15.52sec 4747383 4421902 Direct 38.1 166302 332426 272322 63.8%  
Periodic 287.5 176242 352419 288775 63.9% 195.8%

Stats details: immolate

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 19.68 38.10 287.55 287.55 1.0737 2.0498 93412680.58 93412680.58 0.00 152999.85 4421902.04
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 13.78 36.18% 166301.67 105927 264092 166341.12 133466 198820 2292352 2292352 0.00
crit 24.32 63.82% 332425.65 211852 528188 332423.39 286037 383857 8083374 8083374 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 103.9 36.13% 176242.11 93 524767 176524.48 146433 213142 18307445 18307445 0.00
crit 183.7 63.87% 352419.47 193 1049536 352986.91 306839 401842 64729509 64729509 0.00
 
 

Action details: immolate

Static Values
  • id:348
  • school:fire
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:66000.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:1.50
  • base_crit:0.48
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:remains<=tick_time
Spelldata
  • id:348
  • name:Immolate
  • school:fire
  • tooltip:
  • description:Burns the enemy, causing {$s1=1} Fire damage immediately and an additional $157736o1 Fire damage over {$157736d=18 seconds}. |cFFFFFFFFPeriodic damage has a {$193541s1=15}% chance to generate 1 Soul Shard. Chance doubled on critical strikes.|r
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:1.332000
  • base_dd_min:1.00
  • base_dd_max:1.00
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.721500
  • base_td:0.00
  • dot_duration:18.00
  • base_tick_time:3.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
 
Incinerate 149636 11.0% 73.4 3.92sec 613648 469805 Direct 140.8 275931 551944 319786 15.9%  

Stats details: incinerate

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 73.36 140.77 0.00 0.00 1.3062 0.0000 45014881.92 45014881.92 0.00 469805.48 469805.48
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 118.40 84.11% 275930.97 171224 426964 276003.30 256716 299579 32670103 32670103 0.00
crit 22.37 15.89% 551943.93 342446 853863 552158.32 466283 661078 12344779 12344779 0.00
 
 

Action details: incinerate

Static Values
  • id:29722
  • school:fire
  • resource:mana
  • range:40.0
  • travel_speed:20.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:66000.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:1.88
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:29722
  • name:Incinerate
  • school:fire
  • tooltip:
  • description:Draws fire toward the enemy, dealing {$s2=0} Fire damage.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:2.331000
  • base_dd_min:0.00
  • base_dd_max:0.00
 
Mark of the Hidden Satyr 10273 0.8% 19.6 15.31sec 157639 0 Direct 19.6 136006 271869 157637 15.9%  

Stats details: mark_of_the_hidden_satyr

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 19.58 19.58 0.00 0.00 0.0000 0.0000 3087052.67 3087052.67 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 16.47 84.08% 136006.08 129596 163533 136046.33 129596 149459 2239350 2239350 0.00
crit 3.12 15.92% 271868.68 259191 327066 259850.84 0 327066 847702 847702 0.00
 
 

Action details: mark_of_the_hidden_satyr

Static Values
  • id:191259
  • school:fire
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:191259
  • name:Mark of the Hidden Satyr
  • school:fire
  • tooltip:
  • description:Deals fire damage.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:2.500000
  • spell_power_mod.direct:2.000000
  • base_dd_min:0.00
  • base_dd_max:0.00
 
pet - imp 48789 / 48789
Firebolt 48789 3.6% 106.6 2.82sec 137516 110769 Direct 105.8 119568 239116 138582 15.9%  

Stats details: firebolt

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 106.61 105.79 0.00 0.00 1.2415 0.0000 14660796.70 14660796.70 0.00 110768.74 110768.74
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 88.96 84.09% 119568.21 76463 144729 119599.45 116899 122090 10637309 10637309 0.00
crit 16.83 15.91% 239116.29 152926 289459 239161.26 211484 266282 4023488 4023488 0.00
 
 

Action details: firebolt

Static Values
  • id:3110
  • school:fire
  • resource:energy
  • range:40.0
  • travel_speed:16.0000
  • trigger_gcd:0.5000
  • min_gcd:0.7500
  • base_cost:40.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:1.75
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:3110
  • name:Firebolt
  • school:fire
  • tooltip:
  • description:Deals {$s1=1} Fire damage to a target.$?a231795[ Damage increased by {$231795s1=50}% if you have Immolated the target.][] |cFF777777(Right-Click to toggle)|r
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:1.000000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
pet - service_imp 141126 / 45152
Firebolt 141126 3.3% 48.1 5.65sec 281458 242596 Direct 47.8 244211 488117 283105 15.9%  

Stats details: firebolt

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 48.06 47.78 0.00 0.00 1.1602 0.0000 13525477.09 13525477.09 0.00 242596.40 242596.40
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 40.16 84.05% 244211.34 152926 289459 244446.64 234806 255648 9807027 9807027 0.00
crit 7.62 15.95% 488117.22 305852 578917 488305.76 0 578917 3718450 3718450 0.00
 
 

Action details: firebolt

Static Values
  • id:3110
  • school:fire
  • resource:energy
  • range:40.0
  • travel_speed:16.0000
  • trigger_gcd:0.5000
  • min_gcd:0.7500
  • base_cost:40.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:1.75
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:3110
  • name:Firebolt
  • school:fire
  • tooltip:
  • description:Deals {$s1=1} Fire damage to a target.$?a231795[ Damage increased by {$231795s1=50}% if you have Immolated the target.][] |cFF777777(Right-Click to toggle)|r
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:1.000000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
pet - infernal 134744 / 11411
Immolation 104885 0.6% 1.0 0.00sec 2622235 0 Periodic 45.9 49221 98444 57068 15.9% 8.2%

Stats details: immolation

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 22.97 45.95 0.0000 1.0685 2622234.66 2622234.66 0.00 106820.70 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 38.6 84.06% 49220.81 42587 51104 49221.69 48076 50603 1901154 1901154 0.00
crit 7.3 15.94% 98443.64 85173 102208 98423.56 0 102208 721080 721080 0.00
 
 

Action details: immolation

Static Values
  • id:19483
  • school:fire
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:!ticking
Spelldata
  • id:19483
  • name:Immolation
  • school:fire
  • tooltip:Burns nearby enemies for {$20153s1=0} fire damage every $t1 seconds.
  • description:Burns nearby enemies for {$20153s1=0} fire damage every $t1 seconds.
 

Action details: immolation_tick

Static Values
  • id:20153
  • school:fire
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:20153
  • name:Immolation
  • school:fire
  • tooltip:
  • description:Deals Fire damage to all enemies near the caster.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.650000
  • base_dd_min:0.00
  • base_dd_max:0.00
 
melee 29859 0.2% 21.9 1.13sec 34134 30324 Direct 21.9 29435 58908 34134 15.9%  

Stats details: melee

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 21.87 21.87 0.00 0.00 1.1257 0.0000 746505.03 1097433.10 31.98 30323.54 30323.54
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 18.38 84.06% 29434.77 25467 30560 29435.80 28741 30560 541092 795457 31.98
crit 3.49 15.94% 58907.50 50934 61121 57644.54 0 61121 205413 301976 31.28
 
 

Action details: melee

Static Values
  • id:0
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Weapon
  • normalized:false
  • weapon_power_mod:0.285714
  • weapon_multiplier:1.00
 
pet - doomguard 108095 / 9151
Doom Bolt 108095 0.7% 10.5 2.24sec 256749 116838 Direct 10.5 221279 442563 256752 16.0%  

Stats details: doom_bolt

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 10.53 10.53 0.00 0.00 2.1975 0.0000 2702454.84 2702454.84 0.00 116837.65 116837.65
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 8.84 83.97% 221279.05 213834 256601 221304.98 213834 256601 1955517 1955517 0.00
crit 1.69 16.03% 442562.60 427668 513202 372326.16 0 513202 746938 746938 0.00
 
 

Action details: doom_bolt

Static Values
  • id:85692
  • school:shadow
  • resource:energy
  • range:30.0
  • travel_speed:20.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:35.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:3.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:85692
  • name:Doom Bolt
  • school:shadow
  • tooltip:
  • description:Sends a shadowy bolt at the enemy, causing {$s1=1} Shadow damage. Deals {$s2=20}% additional damage to targets below 20% health.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:2.750000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
pet - lord_of_flames_infernal 134763 / 11410
Immolation 104896 0.6% 1.0 0.00sec 2622512 0 Periodic 45.9 49224 98411 57074 16.0% 8.2%

Stats details: immolation

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 22.97 45.95 0.0000 1.0685 2622511.51 2622511.51 0.00 106831.98 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 38.6 84.04% 49223.88 42587 51104 49224.16 48076 50678 1900877 1900877 0.00
crit 7.3 15.96% 98411.34 85173 102208 98388.49 0 102208 721634 721634 0.00
 
 

Action details: immolation

Static Values
  • id:19483
  • school:fire
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:!ticking
Spelldata
  • id:19483
  • name:Immolation
  • school:fire
  • tooltip:Burns nearby enemies for {$20153s1=0} fire damage every $t1 seconds.
  • description:Burns nearby enemies for {$20153s1=0} fire damage every $t1 seconds.
 

Action details: immolation_tick

Static Values
  • id:20153
  • school:fire
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:20153
  • name:Immolation
  • school:fire
  • tooltip:
  • description:Deals Fire damage to all enemies near the caster.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.650000
  • base_dd_min:0.00
  • base_dd_max:0.00
 
melee 29867 0.2% 21.9 1.13sec 34143 30332 Direct 21.9 29436 58895 34143 16.0%  

Stats details: melee

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 21.87 21.87 0.00 0.00 1.1257 0.0000 746708.28 1097731.90 31.98 30331.80 30331.80
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 18.38 84.02% 29435.92 25467 30560 29436.41 28601 30560 540889 795158 31.98
crit 3.49 15.98% 58895.31 50934 61121 57551.59 0 61121 205819 302574 31.25
 
 

Action details: melee

Static Values
  • id:0
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Weapon
  • normalized:false
  • weapon_power_mod:0.285714
  • weapon_multiplier:1.00
 
pet - lord_of_flames_infernal 134716 / 11407
Immolation 104887 0.6% 1.0 0.00sec 2622280 0 Periodic 45.9 49225 98399 57068 16.0% 8.2%

Stats details: immolation

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 22.97 45.95 0.0000 1.0685 2622279.81 2622279.81 0.00 106822.54 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 38.6 84.05% 49225.07 42587 51104 49225.76 47966 50510 1901109 1901109 0.00
crit 7.3 15.95% 98398.70 85173 102208 98372.12 0 102208 721171 721171 0.00
 
 

Action details: immolation

Static Values
  • id:19483
  • school:fire
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:!ticking
Spelldata
  • id:19483
  • name:Immolation
  • school:fire
  • tooltip:Burns nearby enemies for {$20153s1=0} fire damage every $t1 seconds.
  • description:Burns nearby enemies for {$20153s1=0} fire damage every $t1 seconds.
 

Action details: immolation_tick

Static Values
  • id:20153
  • school:fire
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:20153
  • name:Immolation
  • school:fire
  • tooltip:
  • description:Deals Fire damage to all enemies near the caster.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.650000
  • base_dd_min:0.00
  • base_dd_max:0.00
 
melee 29829 0.2% 21.9 1.13sec 34099 30293 Direct 21.9 29438 58875 34099 15.8%  

Stats details: melee

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 21.87 21.87 0.00 0.00 1.1257 0.0000 745747.57 1096319.56 31.98 30292.78 30292.78
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 18.41 84.16% 29437.88 25467 30560 29438.59 28523 30560 541850 796571 31.98
crit 3.46 15.84% 58874.75 50934 61121 57619.39 0 61121 203898 299749 31.29
 
 

Action details: melee

Static Values
  • id:0
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Weapon
  • normalized:false
  • weapon_power_mod:0.285714
  • weapon_multiplier:1.00
 
pet - lord_of_flames_infernal 134650 / 11403
Immolation 104843 0.6% 1.0 0.00sec 2621176 0 Periodic 45.9 49217 98484 57044 15.9% 8.2%

Stats details: immolation

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 22.97 45.95 0.0000 1.0685 2621175.85 2621175.85 0.00 106777.57 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 38.6 84.11% 49217.03 42587 51104 49217.62 47881 50689 1902213 1902213 0.00
crit 7.3 15.89% 98483.71 85173 102208 98427.31 0 102208 718963 718963 0.00
 
 

Action details: immolation

Static Values
  • id:19483
  • school:fire
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:!ticking
Spelldata
  • id:19483
  • name:Immolation
  • school:fire
  • tooltip:Burns nearby enemies for {$20153s1=0} fire damage every $t1 seconds.
  • description:Burns nearby enemies for {$20153s1=0} fire damage every $t1 seconds.
 

Action details: immolation_tick

Static Values
  • id:20153
  • school:fire
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:20153
  • name:Immolation
  • school:fire
  • tooltip:
  • description:Deals Fire damage to all enemies near the caster.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.650000
  • base_dd_min:0.00
  • base_dd_max:0.00
 
melee 29807 0.2% 21.9 1.13sec 34075 30271 Direct 21.9 29439 58858 34076 15.8%  

Stats details: melee

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 21.87 21.87 0.00 0.00 1.1257 0.0000 745216.78 1095539.26 31.98 30271.22 30271.22
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 18.42 84.24% 29439.41 25467 30560 29440.29 28601 30560 542381 797351 31.98
crit 3.45 15.76% 58858.38 50934 61121 57380.42 0 61121 202836 298188 31.18
 
 

Action details: melee

Static Values
  • id:0
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Weapon
  • normalized:false
  • weapon_power_mod:0.285714
  • weapon_multiplier:1.00
 
pet - shadowy_tear 134707 / 18058
Shadow Bolt 134707 1.3% 3.3 70.76sec 1630586 0 Periodic 36.2 128998 258011 149462 15.9% 15.0%

Stats details: shadow_bolt

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 3.31 0.00 36.36 36.16 0.0000 1.2424 5404751.62 5404751.62 0.00 119653.57 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 30.4 84.14% 128997.51 68 157245 128376.57 0 157245 3924891 3924891 0.00
crit 5.7 15.86% 258011.30 277 314489 249981.15 0 314489 1479861 1479861 0.00
 
 

Action details: shadow_bolt

Static Values
  • id:196657
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:20.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:196657
  • name:Shadow Bolt
  • school:shadow
  • tooltip:
  • description:Sends a shadowy bolt at the enemy, causing {$s1=1} Shadow damage.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • dot_duration:14.00
  • base_tick_time:2.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
 
pet - flame_rift 290007 / 80659
Searing Bolt 290007 5.9% 65.3 2.63sec 369894 1112735 Direct 65.0 67193 0 67193 0.0%  
Periodic 138.9 122958 245965 142567 15.9% 45.7%

Stats details: searing_bolt

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 65.32 64.97 138.86 138.86 0.3324 0.9902 24161938.56 24161938.56 0.00 151756.67 1112735.50
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 64.97 100.00% 67193.35 62307 78623 67215.48 0 78623 4365332 4365332 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 116.7 84.06% 122957.77 125 157273 122381.52 0 141300 14352169 14352169 0.00
crit 22.1 15.94% 245965.15 499 314545 244562.72 0 314545 5444437 5444437 0.00
 
 

Action details: searing_bolt

Static Values
  • id:243050
  • school:fire
  • resource:energy
  • range:100.0
  • travel_speed:20.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:1.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:243050
  • name:Searing Bolt
  • school:fire
  • tooltip:Burning for $w2 Fire damage every $t2 sec.
  • description:Sends a searing bolt at the enemy, causing {$s1=1} Fire damage, and an additional $o2 Fire damage over {$d=30 seconds}, stacking up to {$u=20} times.
Direct Damage
  • may_crit:false
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:1.000000
  • base_dd_min:1.00
  • base_dd_max:1.00
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.100000
  • base_td:1.00
  • dot_duration:30.00
  • base_tick_time:1.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
 
pet - chaos_tear 160895 / 8467
Chaos Bolt 160895 0.6% 3.3 70.62sec 774600 383532 Direct 3.2 0 779734 779734 100.0%  

Stats details: chaos_bolt

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 3.27 3.25 0.00 0.00 2.0199 0.0000 2533994.51 2533994.51 0.00 383531.79 383531.79
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
crit 3.25 100.00% 779733.72 722233 911365 779680.57 0 911365 2533995 2533995 0.00
 
 

Action details: chaos_bolt

Static Values
  • id:215279
  • school:chromatic
  • resource:none
  • range:100.0
  • travel_speed:16.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:5.500
  • base_execute_time:3.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:215279
  • name:Chaos Bolt
  • school:chromatic
  • tooltip:
  • description:Unleashes a devastating blast of chaos, causing {$s1=1} Chaos damage. Chaos Bolt always critically strikes and your critical strike chance increases its damage.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:5.000000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
pet - chaos_portal 283557 / 16371
Chaos Barrage 283557 1.2% 3.3 70.60sec 1477520 0 Periodic 114.3 36969 73867 42851 15.9% 6.0%

Stats details: chaos_barrage

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 3.31 0.00 114.75 114.25 0.0000 0.1570 4896019.60 4896019.60 0.00 271789.70 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 96.0 84.06% 36969.37 148 43243 36800.78 0 43243 3550524 3550524 0.00
crit 18.2 15.94% 73866.79 301 86487 73474.74 0 86487 1345495 1345495 0.00
 
 

Action details: chaos_barrage

Static Values
  • id:187394
  • school:magic
  • resource:none
  • range:100.0
  • travel_speed:24.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:187394
  • name:Chaos Barrage
  • school:magic
  • tooltip:
  • description:Deals {$s1=1} Chaos damage.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • dot_duration:5.50
  • base_tick_time:0.25
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
 
Simple Action Stats Execute Interval
Portal_Pants
augmentation 1.0 0.00sec

Stats details: augmentation

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: augmentation

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Portal_Pants
  • harmful:false
  • if_expr:
 
Berserking 2.1 180.57sec

Stats details: berserking

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.06 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: berserking

Static Values
  • id:26297
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:180.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:26297
  • name:Berserking
  • school:physical
  • tooltip:Haste increased by {$s1=15}%.
  • description:Increases your haste by {$s1=15}% for {$d=10 seconds}.
 
Dimensional Rift 12.8 23.91sec

Stats details: dimensional_rift

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 12.81 0.00 0.00 0.00 1.0276 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: dimensional_rift

Static Values
  • id:196586
  • school:none
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:45.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:charges=3
Spelldata
  • id:196586
  • name:Dimensional Rift
  • school:chaos
  • tooltip:
  • description:Rips a hole in time and space, opening a portal that damages your target.
 
flask 1.0 0.00sec

Stats details: flask

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: flask

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Portal_Pants
  • harmful:false
  • if_expr:
 
food 1.0 0.00sec

Stats details: food

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: food

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Portal_Pants
  • harmful:false
  • if_expr:
 
Havoc 14.9 20.92sec

Stats details: havoc

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 14.88 0.00 0.00 0.00 1.0915 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: havoc

Static Values
  • id:80240
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:88000.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:active_enemies>1&(active_enemies<4|talent.wreak_havoc.enabled&active_enemies<6)&!debuff.havoc.remains
Spelldata
  • id:80240
  • name:Havoc
  • school:shadow
  • tooltip:Spells cast by the Warlock also hit this target.
  • description:Marks a target with Havoc for {$d=8 seconds}, causing your single target spells to also strike the Havoc victim. Limit 1.
 
Life Tap 6.4 34.38sec

Stats details: life_tap

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 6.43 0.00 0.00 0.00 1.0654 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: life_tap

Static Values
  • id:1454
  • school:shadow
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:talent.empowered_life_tap.enabled&!buff.empowered_life_tap.remains
Spelldata
  • id:1454
  • name:Life Tap
  • school:shadow
  • tooltip:
  • description:Restores {$s1=30}% of your maximum mana, at the cost of {$s2=10}% of your maximum health.
 
potion 2.0 0.00sec

Stats details: potion

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: potion

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:60.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
 
Grimoire: Imp (service_imp) 3.7 91.33sec

Stats details: service_imp

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 3.69 0.00 0.00 0.00 0.9891 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: service_imp

Static Values
  • id:111859
  • school:shadow
  • resource:soul_shard
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:1.0
  • secondary_cost:0.0
  • cooldown:90.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:111859
  • name:Grimoire: Imp
  • school:shadow
  • tooltip:
  • description:Summons an Imp who attacks the target for {$108501s1=25} sec. Imps cast ranged Firebolts and cleanse a hostile magic effect from their master.
 
Soul Harvest 2.9 120.87sec

Stats details: soul_harvest

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.90 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: soul_harvest

Static Values
  • id:196098
  • school:shadow
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:120.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:196098
  • name:Soul Harvest
  • school:shadow
  • tooltip:Damage increased by {$s1=20}%.
  • description:Increases your damage and your pets' damage by {$s1=20}%. Lasts {$d=15 seconds}, increased by {$s2=2} sec for each target afflicted by your {$?s137043=false}[Agony][]{$?s137044=false}[Doom][]{$?s137046=false}[Immolate][], up to a maximum of {$s3=35} sec.
 
Summon Doomguard 1.0 0.00sec

Stats details: summon_doomguard

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 1.1022 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: summon_doomguard

Static Values
  • id:18540
  • school:shadow
  • resource:soul_shard
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:1.0
  • secondary_cost:0.0
  • cooldown:180.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:talent.grimoire_of_supremacy.enabled&active_enemies=1&artifact.lord_of_flames.rank=0
Spelldata
  • id:18540
  • name:Summon Doomguard
  • school:shadow
  • tooltip:
  • description:Summons a Doomguard for {$60478d=25 seconds} to assault the target with its Doom Bolts.
 
Summon Imp 1.0 0.00sec

Stats details: summon_imp

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: summon_imp

Static Values
  • id:688
  • school:shadow
  • resource:soul_shard
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:1.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:2.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:!talent.grimoire_of_supremacy.enabled&(!talent.grimoire_of_sacrifice.enabled|buff.demonic_power.down)
Spelldata
  • id:688
  • name:Summon Imp
  • school:shadow
  • tooltip:
  • description:Summons an Imp under your command that casts ranged Firebolts.$?s74434[ |cFFFFFFFFSoulburn:|r |cFF8282FFInstant cast.|r][]
 
Summon Infernal 1.0 0.00sec

Stats details: summon_infernal

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.7672 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: summon_infernal

Static Values
  • id:1122
  • school:shadow
  • resource:soul_shard
  • range:30.0
  • travel_speed:1.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:1.0
  • secondary_cost:0.0
  • cooldown:180.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:talent.grimoire_of_supremacy.enabled&artifact.lord_of_flames.rank>0
Spelldata
  • id:1122
  • name:Summon Infernal
  • school:shadow
  • tooltip:
  • description:Summons an Infernal from the Twisting Nether, impacting for {$22703s1=0} Fire damage and stunning all enemy targets in the area for {$22703d=2 seconds}. The Infernal will serve you for {$111685d=25 seconds}, dealing strong area-of-effect damage.
 

Buffs

Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit Overflow Expiry
Accelerando 20.1 0.0 15.4sec 15.4sec 78.46% 78.46% 1.5(1.5) 19.3

Buff details

  • buff initial source:Portal_Pants
  • cooldown name:buff_accelerando
  • max_stacks:5
  • duration:12.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00

Stat Buff details

  • stat:haste_rating
  • amount:734.41

Stack Uptimes

  • accelerando_1:29.69%
  • accelerando_2:24.58%
  • accelerando_3:14.61%
  • accelerando_4:6.58%
  • accelerando_5:3.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:225719
  • name:Accelerando
  • tooltip:Haste increased by $w1.
  • description:{$@spelldesc225125=Your damaging spells have a chance to grant you {$225719s1=528} Haste for {$225719d=12 seconds}, stacking up to 5 times. Stacking does not refresh duration.}
  • max_stacks:5
  • duration:12.00
  • cooldown:0.00
  • default_chance:101.00%
Berserking 2.1 0.0 180.6sec 180.6sec 6.86% 8.46% 0.0(0.0) 2.0

Buff details

  • buff initial source:Portal_Pants
  • cooldown name:buff_berserking
  • max_stacks:1
  • duration:10.00
  • cooldown:180.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • berserking_1:6.86%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:26297
  • name:Berserking
  • tooltip:Haste increased by {$s1=15}%.
  • description:Increases your haste by {$s1=15}% for {$d=10 seconds}.
  • max_stacks:0
  • duration:10.00
  • cooldown:180.00
  • default_chance:0.00%
Bloodlust 1.0 0.0 0.0sec 0.0sec 13.55% 13.55% 0.0(0.0) 1.0

Buff details

  • buff initial source:Portal_Pants
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • duration:40.00
  • cooldown:300.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • bloodlust_1:13.55%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:2825
  • name:Bloodlust
  • tooltip:Haste increased by {$s1=30}%.
  • description:Increases Haste by {$s1=30}% for all party and raid members for {$d=40 seconds}. Allies receiving this effect will become Sated and unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.
  • max_stacks:0
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
Conflagration of Chaos 23.8 0.0 12.5sec 12.5sec 49.02% 46.26% 0.0(0.0) 1.3

Buff details

  • buff initial source:Portal_Pants
  • cooldown name:buff_conflagration_of_chaos
  • max_stacks:1
  • duration:20.00
  • cooldown:0.00
  • default_chance:50.00%
  • default_value:-0.00

Stack Uptimes

  • conflagration_of_chaos_1:49.02%

Trigger Attempt Success

  • trigger_pct:50.00%

Spelldata details

  • id:196546
  • name:Conflagration of Chaos
  • tooltip:Your {$?s17877=false}[Shadowburn][Conflagrate] will always critically strike. Critical strike chance will increase the critical strike damage of {$?s17877=false}[Shadowburn][Conflagrate].
  • description:{$@spelldesc219195={$?s17877=false}[Shadowburn][Conflagrate] has a chance to guarantee your next {$?s17877=false}[Shadowburn][Conflagrate] critically strikes, and to increase its damage by your critical strike chance.}
  • max_stacks:0
  • duration:20.00
  • cooldown:0.00
  • default_chance:100.00%
Devil's Due 3.5 0.0 69.8sec 69.8sec 8.70% 8.70% 0.0(0.0) 3.2

Buff details

  • buff initial source:Portal_Pants
  • cooldown name:buff_devils_due
  • max_stacks:1
  • duration:8.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.18

Stack Uptimes

  • devils_due_1:8.70%

Trigger Attempt Success

  • trigger_pct:99.93%

Spelldata details

  • id:225776
  • name:Devil's Due
  • tooltip:Cast speed slowed by {$s1=7}%.
  • description:{$@spelldesc225142=Your damaging spells have a chance to grant Nefarious Pact, increasing your casting speed by {$225774s1=17}% for {$225774d=12 seconds}. When Nefarious Pact expires, your casting speed is decreased by {$225776s1=7}% for {$225776d=8 seconds}.}
  • max_stacks:0
  • duration:8.00
  • cooldown:0.00
  • default_chance:0.00%
Embrace Chaos 33.9 26.7 9.0sec 4.9sec 66.21% 78.75% 26.7(26.7) 33.2

Buff details

  • buff initial source:Portal_Pants
  • cooldown name:buff_embrace_chaos
  • max_stacks:1
  • duration:4.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • embrace_chaos_1:66.21%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:212019
  • name:Embrace Chaos
  • tooltip:Chaos Bolt has {$s1=40}% reduced cast time.
  • description:{$@spelldesc212018=Casting Chaos Bolt reduces the cast time of your next Chaos Bolt by {$212019s1=40}% for {$212019d=4 seconds}.}
  • max_stacks:0
  • duration:4.00
  • cooldown:0.00
  • default_chance:0.00%
Lord of Flames 1.0 0.0 0.0sec 0.0sec 97.85% 97.85% 0.0(0.0) 0.0

Buff details

  • buff initial source:Portal_Pants
  • cooldown name:buff_lord_of_flames
  • max_stacks:1
  • duration:600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • lord_of_flames_1:97.85%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:226802
  • name:Lord of Flames
  • tooltip:Recently activated Lord of Flames.
  • description:{$@spelldesc224103=Once every {$s2=10} minutes, {$?s152107=false}[your Infernal's Meteor Strike][Summon Infernal] will summon {$s3=3} additional Infernals to serve you for {$226804d=25 seconds}.}
  • max_stacks:0
  • duration:600.00
  • cooldown:0.00
  • default_chance:0.00%
Nefarious Pact 3.5 0.0 70.2sec 69.5sec 13.54% 13.54% 0.0(0.0) 3.3

Buff details

  • buff initial source:Portal_Pants
  • cooldown name:buff_nefarious_pact
  • max_stacks:1
  • duration:12.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.44

Stack Uptimes

  • nefarious_pact_1:13.54%

Trigger Attempt Success

  • trigger_pct:99.93%

Spelldata details

  • id:225774
  • name:Nefarious Pact
  • tooltip:Cast speed increased by {$s1=17}%.
  • description:{$@spelldesc225142=Your damaging spells have a chance to grant Nefarious Pact, increasing your casting speed by {$225774s1=17}% for {$225774d=12 seconds}. When Nefarious Pact expires, your casting speed is decreased by {$225776s1=7}% for {$225776d=8 seconds}.}
  • max_stacks:0
  • duration:12.00
  • cooldown:0.00
  • default_chance:0.00%
Potion of Deadly Grace 1.0 0.0 0.0sec 0.0sec 10.16% 10.16% 0.0(0.0) 1.0

Buff details

  • buff initial source:Portal_Pants
  • cooldown name:buff_potion_of_deadly_grace
  • max_stacks:1
  • duration:30.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • potion_of_deadly_grace_1:10.16%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:188027
  • name:Potion of Deadly Grace
  • tooltip:Your attacks have a chance to unleash a bolt of energy at your target.
  • description:Grants your attacks a chance to unleash a bolt of energy at your target. Staying away from enemies for the entire duration of the effect will extend the effect by an additional 5 seconds.
  • max_stacks:0
  • duration:25.00
  • cooldown:1.00
  • default_chance:101.00%
Potion of Prolonged Power 1.0 0.0 0.0sec 0.0sec 19.64% 19.64% 0.0(0.0) 1.0

Buff details

  • buff initial source:Portal_Pants
  • cooldown name:buff_potion_of_prolonged_power
  • max_stacks:1
  • duration:60.00
  • cooldown:1.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:all
  • amount:2500.00

Stack Uptimes

  • potion_of_prolonged_power_1:19.64%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:229206
  • name:Potion of Prolonged Power
  • tooltip:All stats increased by {$s1=2500}.
  • description:Drink to increase all stats by {$s1=2500} for {$d=60 seconds}.
  • max_stacks:0
  • duration:60.00
  • cooldown:1.00
  • default_chance:0.00%
Soul Harvest 2.9 0.0 120.9sec 120.9sec 17.79% 17.79% 0.0(0.0) 2.7

Buff details

  • buff initial source:Portal_Pants
  • cooldown name:buff_soul_harvest
  • max_stacks:1
  • duration:15.00
  • cooldown:120.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • soul_harvest_1:17.79%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:196098
  • name:Soul Harvest
  • tooltip:Damage increased by {$s1=20}%.
  • description:Increases your damage and your pets' damage by {$s1=20}%. Lasts {$d=15 seconds}, increased by {$s2=2} sec for each target afflicted by your {$?s137043=false}[Agony][]{$?s137044=false}[Doom][]{$?s137046=false}[Immolate][], up to a maximum of {$s3=35} sec.
  • max_stacks:0
  • duration:15.00
  • cooldown:120.00
  • default_chance:0.00%
Constant Buffs
Well Fed (azshari_salad)

Buff details

  • buff initial source:Portal_Pants
  • cooldown name:buff_azshari_salad
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:haste_rating
  • amount:375.00

Stack Uptimes

  • azshari_salad_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:225603
  • name:Well Fed
  • tooltip:Haste increased by $w1.
  • description:Increases haste by {$s1=375} for {$d=3600 seconds}.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Defiled Augmentation

Buff details

  • buff initial source:Portal_Pants
  • cooldown name:buff_defiled_augmentation
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:agility
  • amount:325.00
  • stat:strength
  • amount:325.00
  • stat:intellect
  • amount:325.00

Stack Uptimes

  • defiled_augmentation_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:224001
  • name:Defiled Augmentation
  • tooltip:Agility, Intellect and Strength increased by $w1.
  • description:Increases Agility, Intellect and Strength by {$s1=325} for {$d=3600 seconds}. Augment Rune.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Flask of the Whispered Pact

Buff details

  • buff initial source:Portal_Pants
  • cooldown name:buff_flask_of_the_whispered_pact
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:intellect
  • amount:1300.00

Stack Uptimes

  • flask_of_the_whispered_pact_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:188031
  • name:Flask of the Whispered Pact
  • tooltip:Intellect increased by $w1.
  • description:Increases Intellect by {$s1=1300} for {$d=3600 seconds}. Counts as both a Battle and Guardian elixir. This effect persists through death.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:101.00%
Tormented Souls

Buff details

  • buff initial source:Portal_Pants
  • cooldown name:buff_tormented_souls
  • max_stacks:12
  • duration:0.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00

Stack Uptimes

  • tormented_souls_2:0.38%
  • tormented_souls_3:99.62%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:216695
  • name:Tormented Souls
  • tooltip:Activate Reap Souls to consume all Tormented Souls collected by |cFFFFCC99Ulthalesh|r, increasing your damage by 10% and doubling the effect of all of |cFFFFCC99Ulthalesh|r's other traits for {$216708d=5 seconds} per soul consumed.
  • description:Activate Reap Souls to consume all Tormented Souls collected by |cFFFFCC99Ulthalesh|r, increasing your damage by 10% and doubling the effect of all of |cFFFFCC99Ulthalesh|r's other traits for {$216708d=5 seconds} per soul consumed.
  • max_stacks:12
  • duration:-0.00
  • cooldown:0.00
  • default_chance:101.00%

Procs

Count Interval
shadowy_tear 3.2 71.0sec
flame_rift 3.2 71.5sec
chaos_tear 3.2 71.5sec
chaos_portal 3.2 70.8sec
dimension_ripper 3.7 56.9sec
t19_2pc_chaos_bolt 41.7 6.9sec

Resources

Resource Usage Type Count Total Average RPE APR
Portal_Pants
chaos_bolt Soul Shard 60.5 121.1 2.0 2.0 1006323.1
havoc Mana 14.9 1309073.7 88000.0 88000.3 0.0
immolate Mana 19.7 1298662.0 66000.0 66000.1 71.9
incinerate Mana 73.4 4841489.0 66000.0 65999.8 9.3
service_imp Soul Shard 3.7 3.7 1.0 1.0 0.0
summon_doomguard Soul Shard 1.0 1.0 1.0 1.0 0.0
summon_infernal Soul Shard 1.0 1.0 1.0 1.0 0.0
pet - imp
firebolt Energy 106.6 4264.4 40.0 40.0 3437.9
pet - service_imp
firebolt Energy 48.1 1922.3 40.0 40.0 7036.3
pet - doomguard
doom_bolt Energy 10.5 368.4 35.0 35.0 7335.8
pet - flame_rift
searing_bolt Energy 63.3 63.3 1.0 1.0 381658.1
Resource Gains Type Count Total Average Overflow
life_tap Mana 6.43 2122517.24 (32.24%) 330000.00 0.00 0.00%
immolate Soul Shard 70.66 69.59 (55.22%) 0.98 1.07 1.51%
conflagrate Soul Shard 47.51 47.40 (37.61%) 1.00 0.11 0.22%
mp5_regen Mana 510.10 4461104.17 (67.76%) 8745.54 73492.07 1.62%
soulsnatcher Soul Shard 9.03 9.03 (7.17%) 1.00 0.00 0.00%
pet - imp
energy_regen Energy 1896.69 4098.11 (100.00%) 2.16 21.61 0.52%
pet - service_imp
energy_regen Energy 437.83 1307.35 (100.00%) 2.99 61.92 4.52%
pet - doomguard
energy_regen Energy 15.16 327.17 (100.00%) 21.58 42.46 11.49%
Resource RPS-Gain RPS-Loss
Health 0.00 7153.21
Mana 21871.90 24747.59
Soul Shard 0.42 0.42
Combat End Resource Mean Min Max
Mana 235182.58 7118.57 492132.45
Soul Shard 2.25 0.00 5.00

Benefits & Uptimes

Benefits %
Uptimes %
Mana Cap 1.2%

Statistics & Data Analysis

Fight Length
Sample Data Portal_Pants Fight Length
Count 9999
Mean 301.01
Minimum 217.68
Maximum 385.07
Spread ( max - min ) 167.39
Range [ ( max - min ) / 2 * 100% ] 27.80%
DPS
Sample Data Portal_Pants Damage Per Second
Count 9999
Mean 1362069.96
Minimum 1177171.95
Maximum 1621550.16
Spread ( max - min ) 444378.21
Range [ ( max - min ) / 2 * 100% ] 16.31%
Standard Deviation 59284.0755
5th Percentile 1268124.33
95th Percentile 1463348.00
( 95th Percentile - 5th Percentile ) 195223.68
Mean Distribution
Standard Deviation 592.8704
95.00% Confidence Intervall ( 1360907.95 - 1363231.96 )
Normalized 95.00% Confidence Intervall ( 99.91% - 100.09% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 73
0.1% Error 7278
0.1 Scale Factor Error with Delta=300 30002661
0.05 Scale Factor Error with Delta=300 120010644
0.01 Scale Factor Error with Delta=300 3000266076
Priority Target DPS
Sample Data Portal_Pants Priority Target Damage Per Second
Count 9999
Mean 813225.43
Minimum 677417.49
Maximum 1013898.47
Spread ( max - min ) 336480.98
Range [ ( max - min ) / 2 * 100% ] 20.69%
Standard Deviation 45138.6213
5th Percentile 743674.46
95th Percentile 891352.02
( 95th Percentile - 5th Percentile ) 147677.56
Mean Distribution
Standard Deviation 451.4088
95.00% Confidence Intervall ( 812340.69 - 814110.18 )
Normalized 95.00% Confidence Intervall ( 99.89% - 100.11% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 119
0.1% Error 11836
0.1 Scale Factor Error with Delta=300 17393231
0.05 Scale Factor Error with Delta=300 69572922
0.01 Scale Factor Error with Delta=300 1739323039
DPS(e)
Sample Data Portal_Pants Damage Per Second (Effective)
Count 9999
Mean 1362069.96
Minimum 1177171.95
Maximum 1621550.16
Spread ( max - min ) 444378.21
Range [ ( max - min ) / 2 * 100% ] 16.31%
Damage
Sample Data Portal_Pants Damage
Count 9999
Mean 328671018.64
Minimum 227467075.74
Maximum 436590071.68
Spread ( max - min ) 209122995.94
Range [ ( max - min ) / 2 * 100% ] 31.81%
DTPS
Sample Data Portal_Pants Damage Taken Per Second
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HPS
Sample Data Portal_Pants Healing Per Second
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
HPS(e)
Sample Data Portal_Pants Healing Per Second (Effective)
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
Sample Data Portal_Pants Heal
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
Sample Data Portal_Pants Healing Taken Per Second
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
TMI
Sample Data Portal_Pants Theck-Meloree Index
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
ETMI
Sample Data Portal_PantsTheck-Meloree Index (Effective)
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
MSD
Sample Data Portal_Pants Max Spike Value
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 flask,type=whispered_pact
1 0.00 food,type=azshari_salad
2 0.00 summon_pet,if=!talent.grimoire_of_supremacy.enabled&(!talent.grimoire_of_sacrifice.enabled|buff.demonic_power.down)
3 0.00 summon_infernal,if=talent.grimoire_of_supremacy.enabled&artifact.lord_of_flames.rank>0
4 0.00 summon_infernal,if=talent.grimoire_of_supremacy.enabled&active_enemies>1
5 0.00 summon_doomguard,if=talent.grimoire_of_supremacy.enabled&active_enemies=1&artifact.lord_of_flames.rank=0
6 0.00 augmentation,type=defiled
7 0.00 snapshot_stats
8 0.00 grimoire_of_sacrifice,if=talent.grimoire_of_sacrifice.enabled
9 0.00 life_tap,if=talent.empowered_life_tap.enabled&!buff.empowered_life_tap.remains
A 0.00 potion,name=prolonged_power
B 0.00 chaos_bolt
Default action list Executed every time the actor is available.
# count action,conditions
C 14.88 havoc,target=2,if=active_enemies>1&(active_enemies<4|talent.wreak_havoc.enabled&active_enemies<6)&!debuff.havoc.remains
D 1.00 dimensional_rift,if=charges=3
E 10.25 immolate,if=remains<=tick_time
F 0.62 immolate,cycle_targets=1,if=active_enemies>1&remains<=tick_time&(!talent.roaring_blaze.enabled|(!debuff.roaring_blaze.remains&action.conflagrate.charges<2+set_bonus.tier19_4pc))
G 8.86 immolate,if=talent.roaring_blaze.enabled&remains<=duration&!debuff.roaring_blaze.remains&target.time_to_die>10&(action.conflagrate.charges=2+set_bonus.tier19_4pc|(action.conflagrate.charges>=1+set_bonus.tier19_4pc&action.conflagrate.recharge_time<cast_time+gcd)|target.time_to_die<24)
H 2.06 berserking
0.00 blood_fury
0.00 arcane_torrent
I 1.00 potion,name=deadly_grace,if=(buff.soul_harvest.remains|trinket.proc.any.react|target.time_to_die<=45)
0.00 shadowburn,if=buff.conflagration_of_chaos.remains<=action.chaos_bolt.cast_time
0.00 shadowburn,if=(charges=1+set_bonus.tier19_4pc&recharge_time<action.chaos_bolt.cast_time|charges=2+set_bonus.tier19_4pc)&soul_shard<5
J 13.86 conflagrate,if=talent.roaring_blaze.enabled&(charges=2+set_bonus.tier19_4pc|(charges>=1+set_bonus.tier19_4pc&recharge_time<gcd)|target.time_to_die<24)
K 33.66 conflagrate,if=talent.roaring_blaze.enabled&debuff.roaring_blaze.stack>0&dot.immolate.remains>dot.immolate.duration*0.3&(active_enemies=1|soul_shard<3)&soul_shard<5
0.00 conflagrate,if=!talent.roaring_blaze.enabled&buff.backdraft.stack<3&buff.conflagration_of_chaos.remains<=action.chaos_bolt.cast_time
0.00 conflagrate,if=!talent.roaring_blaze.enabled&buff.backdraft.stack<3&(charges=1+set_bonus.tier19_4pc&recharge_time<action.chaos_bolt.cast_time|charges=2+set_bonus.tier19_4pc)&soul_shard<5
0.00 life_tap,if=talent.empowered_life_tap.enabled&buff.empowered_life_tap.remains<=gcd
0.00 dimensional_rift,if=equipped.144369&!buff.lessons_of_spacetime.remains&((!talent.grimoire_of_supremacy.enabled&!cooldown.summon_doomguard.remains)|(talent.grimoire_of_service.enabled&!cooldown.service_pet.remains)|(talent.soul_harvest.enabled&!cooldown.soul_harvest.remains))
L 3.69 service_pet
M 1.00 summon_infernal,if=artifact.lord_of_flames.rank>0&!buff.lord_of_flames.remains
N 1.00 summon_doomguard,if=!talent.grimoire_of_supremacy.enabled&spell_targets.infernal_awakening<=2&(target.time_to_die>180|target.health.pct<=20|target.time_to_die<30)
0.00 summon_infernal,if=!talent.grimoire_of_supremacy.enabled&spell_targets.infernal_awakening>2
0.00 summon_doomguard,if=talent.grimoire_of_supremacy.enabled&spell_targets.summon_infernal=1&artifact.lord_of_flames.rank>0&buff.lord_of_flames.remains&!pet.doomguard.active
0.00 summon_doomguard,if=talent.grimoire_of_supremacy.enabled&spell_targets.summon_infernal=1&equipped.132379&!cooldown.sindorei_spite_icd.remains
0.00 summon_infernal,if=talent.grimoire_of_supremacy.enabled&spell_targets.summon_infernal>1&equipped.132379&!cooldown.sindorei_spite_icd.remains
O 2.90 soul_harvest
0.00 channel_demonfire,if=dot.immolate.remains>cast_time
0.00 havoc,if=active_enemies=1&talent.wreak_havoc.enabled&equipped.132375&!debuff.havoc.remains
0.00 rain_of_fire,if=active_enemies>=3&cooldown.havoc.remains<=12&!talent.wreak_havoc.enabled
0.00 rain_of_fire,if=active_enemies>=6&talent.wreak_havoc.enabled
P 11.80 dimensional_rift,if=!equipped.144369|charges>1|((!talent.grimoire_of_service.enabled|recharge_time<cooldown.service_pet.remains)&(!talent.soul_harvest.enabled|recharge_time<cooldown.soul_harvest.remains)&(!talent.grimoire_of_supremacy.enabled|recharge_time<cooldown.summon_doomguard.remains))
0.00 life_tap,if=talent.empowered_life_tap.enabled&buff.empowered_life_tap.remains<duration*0.3
0.00 cataclysm
Q 59.87 chaos_bolt,if=(cooldown.havoc.remains>12&cooldown.havoc.remains|active_enemies<3|talent.wreak_havoc.enabled&active_enemies<6)&(set_bonus.tier19_4pc=0|!talent.eradication.enabled|buff.embrace_chaos.remains<=cast_time|soul_shard>=3)
0.00 shadowburn
0.00 conflagrate,if=!talent.roaring_blaze.enabled&buff.backdraft.stack<3
0.00 immolate,if=!talent.roaring_blaze.enabled&remains<=duration*0.3
R 73.67 incinerate
S 6.43 life_tap

Sample Sequence

0126ABCDEGHJKLKMOPPQKQRKRQRRKRCRRQERRPQQGJQKQKRKQCQRRKPQQRREQRRRCRGJQKQKKQRRQKRCQRRREQSPQRRQLRGJKKCQQKRRQRKQRREQCSROIQRRRGJKPQQKQCQKQKQRRQERRQRRRSCGJKKQQKQRPRHQKLRCRREQRRQGJQKQKRKCQSQKRRQERQRPNCRRRGJKQKQKRQROPCKQRSEQQRQRRQRGCJJJPLFJQQRRJQRCJEQ

Sample Sequence Table

time list # name target resources buffs
Pre precombat 0 flask Portal_Pants 1100000.0/1100000: 100% mana | 3.0/5: 60% soul_shard
Pre precombat 1 food Portal_Pants 1100000.0/1100000: 100% mana | 3.0/5: 60% soul_shard
Pre precombat 2 summon_imp Fluffy_Pillow 1100000.0/1100000: 100% mana | 3.0/5: 60% soul_shard
Pre precombat 6 augmentation Portal_Pants 1100000.0/1100000: 100% mana | 3.0/5: 60% soul_shard
Pre precombat A potion Fluffy_Pillow 1100000.0/1100000: 100% mana | 3.0/5: 60% soul_shard potion_of_prolonged_power
0:00.000 precombat B chaos_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 1.0/5: 20% soul_shard embrace_chaos, accelerando, potion_of_prolonged_power
0:00.000 default C havoc enemy2 1100000.0/1100000: 100% mana | 1.0/5: 20% soul_shard embrace_chaos, accelerando, potion_of_prolonged_power
0:01.167 default D dimensional_rift Fluffy_Pillow 1033514.3/1100000: 94% mana | 1.0/5: 20% soul_shard bloodlust, embrace_chaos, accelerando, potion_of_prolonged_power
0:02.065 default E immolate Fluffy_Pillow 1050069.4/1100000: 95% mana | 1.0/5: 20% soul_shard bloodlust, embrace_chaos, accelerando, potion_of_prolonged_power
0:02.964 default G immolate Fluffy_Pillow 1000643.0/1100000: 91% mana | 1.0/5: 20% soul_shard bloodlust, embrace_chaos, accelerando, potion_of_prolonged_power
0:03.863 default H berserking Fluffy_Pillow 951216.6/1100000: 86% mana | 1.0/5: 20% soul_shard bloodlust, embrace_chaos, accelerando, potion_of_prolonged_power
0:03.863 default J conflagrate Fluffy_Pillow 951216.6/1100000: 86% mana | 1.0/5: 20% soul_shard bloodlust, berserking, embrace_chaos, accelerando, potion_of_prolonged_power
0:04.646 default K conflagrate Fluffy_Pillow 967816.9/1100000: 88% mana | 2.0/5: 40% soul_shard bloodlust, berserking, conflagration_of_chaos, accelerando, potion_of_prolonged_power
0:05.429 default L service_imp Fluffy_Pillow 984417.2/1100000: 89% mana | 3.0/5: 60% soul_shard bloodlust, berserking, conflagration_of_chaos, accelerando, potion_of_prolonged_power
0:06.212 default K conflagrate Fluffy_Pillow 1001017.5/1100000: 91% mana | 2.0/5: 40% soul_shard bloodlust, berserking, conflagration_of_chaos, accelerando, potion_of_prolonged_power
0:06.996 default M summon_infernal Fluffy_Pillow 1017891.7/1100000: 93% mana | 4.0/5: 80% soul_shard bloodlust, berserking, conflagration_of_chaos, accelerando(2), potion_of_prolonged_power
0:07.765 default O soul_harvest Fluffy_Pillow 1034443.0/1100000: 94% mana | 3.0/5: 60% soul_shard bloodlust, berserking, lord_of_flames, conflagration_of_chaos, accelerando(2), potion_of_prolonged_power
0:07.765 default P dimensional_rift Fluffy_Pillow 1034443.0/1100000: 94% mana | 3.0/5: 60% soul_shard bloodlust, berserking, soul_harvest, lord_of_flames, conflagration_of_chaos, accelerando(2), potion_of_prolonged_power
0:08.538 default P dimensional_rift Fluffy_Pillow 1051080.5/1100000: 96% mana | 3.0/5: 60% soul_shard bloodlust, berserking, soul_harvest, lord_of_flames, conflagration_of_chaos, accelerando(2), potion_of_prolonged_power
0:09.310 default Q chaos_bolt Fluffy_Pillow 1067696.4/1100000: 97% mana | 3.0/5: 60% soul_shard bloodlust, berserking, soul_harvest, lord_of_flames, conflagration_of_chaos, accelerando(2), potion_of_prolonged_power
0:10.847 default K conflagrate Fluffy_Pillow 1100000.0/1100000: 100% mana | 1.0/5: 20% soul_shard bloodlust, berserking, soul_harvest, lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(2), potion_of_prolonged_power
0:11.617 default Q chaos_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 3.0/5: 60% soul_shard bloodlust, berserking, soul_harvest, lord_of_flames, embrace_chaos, accelerando(2), potion_of_prolonged_power
0:12.541 default R incinerate Fluffy_Pillow 1100000.0/1100000: 100% mana | 1.0/5: 20% soul_shard bloodlust, berserking, soul_harvest, lord_of_flames, embrace_chaos, potion_of_prolonged_power
0:13.536 default K conflagrate Fluffy_Pillow 1034104.4/1100000: 94% mana | 1.0/5: 20% soul_shard bloodlust, berserking, soul_harvest, lord_of_flames, embrace_chaos, potion_of_prolonged_power
0:14.332 default R incinerate Fluffy_Pillow 1049446.8/1100000: 95% mana | 2.0/5: 40% soul_shard bloodlust, soul_harvest, lord_of_flames, conflagration_of_chaos, embrace_chaos, potion_of_prolonged_power
0:15.475 default Q chaos_bolt Fluffy_Pillow 1004199.9/1100000: 91% mana | 2.0/5: 40% soul_shard bloodlust, soul_harvest, lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando, potion_of_prolonged_power
0:16.554 default R incinerate Fluffy_Pillow 1024091.8/1100000: 93% mana | 0.0/5: 0% soul_shard bloodlust, soul_harvest, lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando, potion_of_prolonged_power
0:17.679 default R incinerate Fluffy_Pillow 978831.9/1100000: 89% mana | 0.0/5: 0% soul_shard bloodlust, soul_harvest, lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando, potion_of_prolonged_power
0:18.806 default K conflagrate Fluffy_Pillow 933610.4/1100000: 85% mana | 0.0/5: 0% soul_shard bloodlust, soul_harvest, lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(2), potion_of_prolonged_power
0:19.692 default R incinerate Fluffy_Pillow 950192.6/1100000: 86% mana | 1.0/5: 20% soul_shard bloodlust, soul_harvest, lord_of_flames, embrace_chaos, accelerando(2), potion_of_prolonged_power
0:20.801 default C havoc enemy2 904948.5/1100000: 82% mana | 1.0/5: 20% soul_shard bloodlust, soul_harvest, lord_of_flames, accelerando(2), potion_of_prolonged_power
0:21.685 default R incinerate Fluffy_Pillow 833493.3/1100000: 76% mana | 1.0/5: 20% soul_shard bloodlust, soul_harvest, lord_of_flames, accelerando(2), potion_of_prolonged_power
0:22.794 default R incinerate Fluffy_Pillow 788249.2/1100000: 72% mana | 1.0/5: 20% soul_shard bloodlust, soul_harvest, lord_of_flames, accelerando(2), potion_of_prolonged_power
0:23.903 default Q chaos_bolt Fluffy_Pillow 743005.0/1100000: 68% mana | 2.0/5: 40% soul_shard bloodlust, soul_harvest, lord_of_flames, accelerando(2), potion_of_prolonged_power
0:25.670 default E immolate Fluffy_Pillow 776075.9/1100000: 71% mana | 1.0/5: 20% soul_shard bloodlust, soul_harvest, lord_of_flames, embrace_chaos, accelerando(2), potion_of_prolonged_power
0:26.556 default R incinerate Fluffy_Pillow 726658.2/1100000: 66% mana | 2.0/5: 40% soul_shard bloodlust, soul_harvest, lord_of_flames, embrace_chaos, accelerando(2), potion_of_prolonged_power
0:27.666 default R incinerate Fluffy_Pillow 681323.5/1100000: 62% mana | 2.0/5: 40% soul_shard bloodlust, lord_of_flames, embrace_chaos, potion_of_prolonged_power
0:28.809 default P dimensional_rift Fluffy_Pillow 636075.4/1100000: 58% mana | 2.0/5: 40% soul_shard bloodlust, lord_of_flames, embrace_chaos, potion_of_prolonged_power
0:29.720 default Q chaos_bolt Fluffy_Pillow 652615.2/1100000: 59% mana | 3.0/5: 60% soul_shard bloodlust, lord_of_flames, potion_of_prolonged_power
0:31.541 default Q chaos_bolt Fluffy_Pillow 685873.2/1100000: 62% mana | 3.0/5: 60% soul_shard bloodlust, lord_of_flames, embrace_chaos, accelerando, potion_of_prolonged_power
0:32.620 default G immolate Fluffy_Pillow 705765.2/1100000: 64% mana | 1.0/5: 20% soul_shard bloodlust, lord_of_flames, embrace_chaos, accelerando, potion_of_prolonged_power
0:33.520 default J conflagrate Fluffy_Pillow 656357.2/1100000: 60% mana | 1.0/5: 20% soul_shard bloodlust, lord_of_flames, embrace_chaos, accelerando, potion_of_prolonged_power
0:34.420 default Q chaos_bolt Fluffy_Pillow 672949.2/1100000: 61% mana | 3.0/5: 60% soul_shard bloodlust, lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando, potion_of_prolonged_power
0:35.498 default K conflagrate Fluffy_Pillow 692822.7/1100000: 63% mana | 1.0/5: 20% soul_shard bloodlust, lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando, potion_of_prolonged_power
0:36.395 default Q chaos_bolt Fluffy_Pillow 709359.4/1100000: 64% mana | 3.0/5: 60% soul_shard bloodlust, lord_of_flames, embrace_chaos, accelerando, potion_of_prolonged_power
0:37.473 default K conflagrate Fluffy_Pillow 729232.9/1100000: 66% mana | 1.0/5: 20% soul_shard bloodlust, lord_of_flames, embrace_chaos, accelerando, potion_of_prolonged_power
0:38.374 default R incinerate Fluffy_Pillow 745843.4/1100000: 68% mana | 2.0/5: 40% soul_shard bloodlust, lord_of_flames, embrace_chaos, accelerando, potion_of_prolonged_power
0:39.500 default K conflagrate Fluffy_Pillow 700603.2/1100000: 64% mana | 2.0/5: 40% soul_shard bloodlust, lord_of_flames, embrace_chaos, accelerando(2), potion_of_prolonged_power
0:40.626 default Q chaos_bolt Fluffy_Pillow 721677.3/1100000: 66% mana | 5.0/5: 100% soul_shard bloodlust, lord_of_flames, embrace_chaos, accelerando(2), potion_of_prolonged_power
0:41.687 default C havoc enemy2 736952.3/1100000: 67% mana | 3.0/5: 60% soul_shard lord_of_flames, embrace_chaos, accelerando(2), potion_of_prolonged_power
0:42.838 default Q chaos_bolt Fluffy_Pillow 665523.0/1100000: 61% mana | 3.0/5: 60% soul_shard lord_of_flames, embrace_chaos, accelerando(2), potion_of_prolonged_power
0:44.216 default R incinerate Fluffy_Pillow 684848.5/1100000: 62% mana | 2.0/5: 40% soul_shard lord_of_flames, embrace_chaos, accelerando, potion_of_prolonged_power
0:45.679 default R incinerate Fluffy_Pillow 639595.6/1100000: 58% mana | 2.0/5: 40% soul_shard lord_of_flames, embrace_chaos, accelerando, potion_of_prolonged_power
0:47.141 default K conflagrate Fluffy_Pillow 594328.5/1100000: 54% mana | 2.0/5: 40% soul_shard lord_of_flames, embrace_chaos, accelerando, potion_of_prolonged_power
0:48.310 default P dimensional_rift Fluffy_Pillow 610906.3/1100000: 56% mana | 3.0/5: 60% soul_shard lord_of_flames, accelerando, potion_of_prolonged_power
0:49.477 default Q chaos_bolt Fluffy_Pillow 627707.4/1100000: 57% mana | 5.0/5: 100% soul_shard lord_of_flames, accelerando(2), potion_of_prolonged_power
0:51.775 default Q chaos_bolt Fluffy_Pillow 660997.5/1100000: 60% mana | 4.0/5: 80% soul_shard lord_of_flames, embrace_chaos, accelerando(3), potion_of_prolonged_power
0:53.134 default R incinerate Fluffy_Pillow 680866.4/1100000: 62% mana | 2.0/5: 40% soul_shard lord_of_flames, embrace_chaos, accelerando(4), potion_of_prolonged_power
0:54.532 default R incinerate Fluffy_Pillow 635595.5/1100000: 58% mana | 2.0/5: 40% soul_shard lord_of_flames, embrace_chaos, accelerando(4), potion_of_prolonged_power
0:55.931 default E immolate Fluffy_Pillow 590264.5/1100000: 54% mana | 3.0/5: 60% soul_shard lord_of_flames, embrace_chaos, potion_of_prolonged_power
0:57.117 default Q chaos_bolt Fluffy_Pillow 540828.0/1100000: 49% mana | 3.0/5: 60% soul_shard lord_of_flames, embrace_chaos, potion_of_prolonged_power
0:58.538 default R incinerate Fluffy_Pillow 560673.6/1100000: 51% mana | 1.0/5: 20% soul_shard lord_of_flames, embrace_chaos
1:00.023 default R incinerate Fluffy_Pillow 515412.9/1100000: 47% mana | 1.0/5: 20% soul_shard lord_of_flames, embrace_chaos
1:01.508 default R incinerate Fluffy_Pillow 470152.3/1100000: 43% mana | 1.0/5: 20% soul_shard lord_of_flames, embrace_chaos
1:02.992 default C havoc enemy2 425127.4/1100000: 39% mana | 1.0/5: 20% soul_shard lord_of_flames, accelerando(2)
1:04.143 default R incinerate Fluffy_Pillow 353698.1/1100000: 32% mana | 1.0/5: 20% soul_shard lord_of_flames, accelerando(2)
1:05.583 default G immolate Fluffy_Pillow 308430.4/1100000: 28% mana | 2.0/5: 40% soul_shard lord_of_flames, accelerando(3)
1:06.717 default J conflagrate Fluffy_Pillow 259057.0/1100000: 24% mana | 2.0/5: 40% soul_shard lord_of_flames, accelerando(4)
1:07.834 default Q chaos_bolt Fluffy_Pillow 275619.5/1100000: 25% mana | 3.0/5: 60% soul_shard lord_of_flames, conflagration_of_chaos, accelerando(4)
1:10.064 default K conflagrate Fluffy_Pillow 308685.3/1100000: 28% mana | 1.0/5: 20% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(4)
1:11.179 default Q chaos_bolt Fluffy_Pillow 325218.2/1100000: 30% mana | 3.0/5: 60% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(4)
1:12.519 default K conflagrate Fluffy_Pillow 345087.3/1100000: 31% mana | 1.0/5: 20% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(4)
1:13.636 default K conflagrate Fluffy_Pillow 361649.9/1100000: 33% mana | 2.0/5: 40% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(4)
1:14.751 default Q chaos_bolt Fluffy_Pillow 377394.2/1100000: 34% mana | 3.0/5: 60% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos
1:16.174 default R incinerate Fluffy_Pillow 397269.0/1100000: 36% mana | 1.0/5: 20% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando
1:17.638 default R incinerate Fluffy_Pillow 352031.6/1100000: 32% mana | 1.0/5: 20% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(2)
1:19.079 default Q chaos_bolt Fluffy_Pillow 306777.3/1100000: 28% mana | 2.0/5: 40% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(2)
1:20.459 default K conflagrate Fluffy_Pillow 326644.9/1100000: 30% mana | 0.0/5: 0% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(2)
1:21.609 default R incinerate Fluffy_Pillow 343201.2/1100000: 31% mana | 1.0/5: 20% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(2)
1:23.051 default C havoc enemy2 297961.4/1100000: 27% mana | 2.0/5: 40% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(2)
1:24.201 default Q chaos_bolt Fluffy_Pillow 226517.8/1100000: 21% mana | 2.0/5: 40% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(2)
1:25.579 default R incinerate Fluffy_Pillow 246356.5/1100000: 22% mana | 0.0/5: 0% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, nefarious_pact, accelerando(2)
1:26.580 default R incinerate Fluffy_Pillow 194767.7/1100000: 18% mana | 1.0/5: 20% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, nefarious_pact, accelerando(2)
1:27.578 default R incinerate Fluffy_Pillow 143135.7/1100000: 13% mana | 1.0/5: 20% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, nefarious_pact, accelerando(2)
1:28.576 default E immolate Fluffy_Pillow 91327.9/1100000: 8% mana | 1.0/5: 20% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, nefarious_pact
1:29.397 default Q chaos_bolt Fluffy_Pillow 36793.9/1100000: 3% mana | 2.0/5: 40% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, nefarious_pact
1:30.384 default S life_tap Fluffy_Pillow 50636.8/1100000: 5% mana | 1.0/5: 20% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, nefarious_pact, accelerando
1:31.195 default P dimensional_rift Fluffy_Pillow 392137.8/1100000: 36% mana | 1.0/5: 20% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, nefarious_pact, accelerando
1:32.006 default Q chaos_bolt Fluffy_Pillow 403638.7/1100000: 37% mana | 3.0/5: 60% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, nefarious_pact, accelerando
1:32.978 default R incinerate Fluffy_Pillow 417422.9/1100000: 38% mana | 1.0/5: 20% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, nefarious_pact, accelerando
1:33.992 default R incinerate Fluffy_Pillow 365803.5/1100000: 33% mana | 2.0/5: 40% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, nefarious_pact, accelerando(2)
1:34.990 default Q chaos_bolt Fluffy_Pillow 314171.5/1100000: 29% mana | 3.0/5: 60% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, nefarious_pact, accelerando(2)
1:35.946 default L service_imp Fluffy_Pillow 327934.8/1100000: 30% mana | 1.0/5: 20% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, nefarious_pact, accelerando(2)
1:36.743 default R incinerate Fluffy_Pillow 339453.6/1100000: 31% mana | 0.0/5: 0% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, devils_due, accelerando(3)
1:38.416 default G immolate Fluffy_Pillow 297899.7/1100000: 27% mana | 0.0/5: 0% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, devils_due, accelerando(3)
1:39.751 default J conflagrate Fluffy_Pillow 251406.9/1100000: 23% mana | 0.0/5: 0% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, devils_due, accelerando(3)
1:41.086 default K conflagrate Fluffy_Pillow 270914.0/1100000: 25% mana | 1.0/5: 20% soul_shard lord_of_flames, devils_due, accelerando(3)
1:42.421 default K conflagrate Fluffy_Pillow 290221.5/1100000: 26% mana | 2.0/5: 40% soul_shard lord_of_flames, conflagration_of_chaos, devils_due
1:43.819 default C havoc enemy2 309745.8/1100000: 28% mana | 4.0/5: 80% soul_shard lord_of_flames, conflagration_of_chaos, devils_due
1:45.214 default Q chaos_bolt Fluffy_Pillow 241228.2/1100000: 22% mana | 4.0/5: 80% soul_shard lord_of_flames, conflagration_of_chaos
1:47.581 default Q chaos_bolt Fluffy_Pillow 274577.5/1100000: 25% mana | 3.0/5: 60% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(2)
1:48.961 default K conflagrate Fluffy_Pillow 294531.8/1100000: 27% mana | 1.0/5: 20% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(3)
1:50.096 default R incinerate Fluffy_Pillow 311116.6/1100000: 28% mana | 2.0/5: 40% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(3)
1:51.515 default R incinerate Fluffy_Pillow 265994.5/1100000: 24% mana | 2.0/5: 40% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(4)
1:52.913 default Q chaos_bolt Fluffy_Pillow 220723.6/1100000: 20% mana | 2.0/5: 40% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(4)
1:54.252 default R incinerate Fluffy_Pillow 240577.9/1100000: 22% mana | 1.0/5: 20% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(4)
1:55.651 default K conflagrate Fluffy_Pillow 195321.9/1100000: 18% mana | 2.0/5: 40% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(4)
1:56.767 default Q chaos_bolt Fluffy_Pillow 211869.6/1100000: 19% mana | 3.0/5: 60% soul_shard lord_of_flames, embrace_chaos, accelerando(4)
1:58.106 default R incinerate Fluffy_Pillow 231723.9/1100000: 21% mana | 1.0/5: 20% soul_shard lord_of_flames, embrace_chaos, accelerando(4)
1:59.505 default R incinerate Fluffy_Pillow 185369.1/1100000: 17% mana | 1.0/5: 20% soul_shard lord_of_flames, embrace_chaos
2:00.989 default E immolate Fluffy_Pillow 140178.7/1100000: 13% mana | 1.0/5: 20% soul_shard lord_of_flames, embrace_chaos, accelerando(2)
2:02.140 default Q chaos_bolt Fluffy_Pillow 90755.4/1100000: 8% mana | 2.0/5: 40% soul_shard lord_of_flames, accelerando(3)
2:04.404 default C havoc enemy2 123837.2/1100000: 11% mana | 0.0/5: 0% soul_shard lord_of_flames, embrace_chaos, accelerando(3)
2:05.540 default S life_tap Fluffy_Pillow 52465.9/1100000: 5% mana | 1.0/5: 20% soul_shard lord_of_flames, embrace_chaos, accelerando(4)
2:06.657 default R incinerate Fluffy_Pillow 399028.4/1100000: 36% mana | 1.0/5: 20% soul_shard lord_of_flames, embrace_chaos, accelerando(4)
2:08.054 default O soul_harvest Fluffy_Pillow 354042.7/1100000: 32% mana | 3.0/5: 60% soul_shard lord_of_flames, embrace_chaos, accelerando(5)
2:08.054 default I potion Fluffy_Pillow 354042.7/1100000: 32% mana | 3.0/5: 60% soul_shard soul_harvest, lord_of_flames, embrace_chaos, accelerando(5)
2:08.054 default Q chaos_bolt Fluffy_Pillow 354042.7/1100000: 32% mana | 3.0/5: 60% soul_shard soul_harvest, lord_of_flames, embrace_chaos, accelerando(5), potion_of_deadly_grace
2:09.374 default R incinerate Fluffy_Pillow 373899.4/1100000: 34% mana | 1.0/5: 20% soul_shard soul_harvest, lord_of_flames, embrace_chaos, accelerando(5), potion_of_deadly_grace
2:10.753 default R incinerate Fluffy_Pillow 328643.8/1100000: 30% mana | 1.0/5: 20% soul_shard soul_harvest, lord_of_flames, embrace_chaos, accelerando(5), potion_of_deadly_grace
2:12.131 default R incinerate Fluffy_Pillow 283373.0/1100000: 26% mana | 1.0/5: 20% soul_shard soul_harvest, lord_of_flames, embrace_chaos, accelerando(5), potion_of_deadly_grace
2:13.509 default G immolate Fluffy_Pillow 237125.3/1100000: 22% mana | 1.0/5: 20% soul_shard soul_harvest, lord_of_flames, potion_of_deadly_grace
2:14.693 default J conflagrate Fluffy_Pillow 187661.0/1100000: 17% mana | 1.0/5: 20% soul_shard soul_harvest, lord_of_flames, potion_of_deadly_grace
2:15.880 default K conflagrate Fluffy_Pillow 204238.5/1100000: 19% mana | 2.0/5: 40% soul_shard soul_harvest, lord_of_flames, potion_of_deadly_grace
2:17.067 default P dimensional_rift Fluffy_Pillow 220915.9/1100000: 20% mana | 3.0/5: 60% soul_shard soul_harvest, lord_of_flames, conflagration_of_chaos, accelerando, potion_of_deadly_grace
2:18.235 default Q chaos_bolt Fluffy_Pillow 237479.5/1100000: 22% mana | 3.0/5: 60% soul_shard soul_harvest, lord_of_flames, conflagration_of_chaos, accelerando, potion_of_deadly_grace
2:20.566 default Q chaos_bolt Fluffy_Pillow 270881.1/1100000: 25% mana | 3.0/5: 60% soul_shard soul_harvest, lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(2), potion_of_deadly_grace
2:21.945 default K conflagrate Fluffy_Pillow 290734.3/1100000: 26% mana | 2.0/5: 40% soul_shard soul_harvest, lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(2), potion_of_deadly_grace
2:23.095 default Q chaos_bolt Fluffy_Pillow 307393.9/1100000: 28% mana | 4.0/5: 80% soul_shard soul_harvest, lord_of_flames, embrace_chaos, accelerando(3), potion_of_deadly_grace
2:24.453 default C havoc enemy2 327238.1/1100000: 30% mana | 3.0/5: 60% soul_shard soul_harvest, lord_of_flames, embrace_chaos, accelerando(4), potion_of_deadly_grace
2:25.569 default Q chaos_bolt Fluffy_Pillow 255785.8/1100000: 23% mana | 4.0/5: 80% soul_shard soul_harvest, lord_of_flames, embrace_chaos, accelerando(4), potion_of_deadly_grace
2:26.909 default K conflagrate Fluffy_Pillow 275656.0/1100000: 25% mana | 2.0/5: 40% soul_shard soul_harvest, lord_of_flames, embrace_chaos, accelerando(5), potion_of_deadly_grace
2:28.008 default Q chaos_bolt Fluffy_Pillow 292188.2/1100000: 27% mana | 3.0/5: 60% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(5), potion_of_deadly_grace
2:29.327 default K conflagrate Fluffy_Pillow 311250.1/1100000: 28% mana | 2.0/5: 40% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, potion_of_deadly_grace
2:30.511 default Q chaos_bolt Fluffy_Pillow 327785.8/1100000: 30% mana | 3.0/5: 60% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, potion_of_deadly_grace
2:31.934 default R incinerate Fluffy_Pillow 347712.4/1100000: 32% mana | 2.0/5: 40% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando, potion_of_deadly_grace
2:33.397 default R incinerate Fluffy_Pillow 302459.5/1100000: 27% mana | 2.0/5: 40% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando, potion_of_deadly_grace
2:34.859 default Q chaos_bolt Fluffy_Pillow 257192.4/1100000: 23% mana | 3.0/5: 60% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando, potion_of_deadly_grace
2:36.260 default E immolate Fluffy_Pillow 277060.3/1100000: 25% mana | 1.0/5: 20% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando, potion_of_deadly_grace
2:37.427 default R incinerate Fluffy_Pillow 227642.3/1100000: 21% mana | 2.0/5: 40% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(2), potion_of_deadly_grace
2:38.867 default R incinerate Fluffy_Pillow 182373.7/1100000: 17% mana | 2.0/5: 40% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(2)
2:40.308 default Q chaos_bolt Fluffy_Pillow 137120.6/1100000: 12% mana | 2.0/5: 40% soul_shard lord_of_flames, conflagration_of_chaos, accelerando(3)
2:42.568 default R incinerate Fluffy_Pillow 170144.3/1100000: 15% mana | 0.0/5: 0% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(4)
2:43.967 default R incinerate Fluffy_Pillow 124872.4/1100000: 11% mana | 0.0/5: 0% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos
2:45.451 default R incinerate Fluffy_Pillow 79730.9/1100000: 7% mana | 0.0/5: 0% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando
2:46.912 default S life_tap Fluffy_Pillow 34449.6/1100000: 3% mana | 0.0/5: 0% soul_shard lord_of_flames, conflagration_of_chaos, accelerando
2:48.078 default C havoc enemy2 380984.9/1100000: 35% mana | 0.0/5: 0% soul_shard lord_of_flames, conflagration_of_chaos, accelerando
2:49.245 default G immolate Fluffy_Pillow 309534.3/1100000: 28% mana | 0.0/5: 0% soul_shard lord_of_flames, conflagration_of_chaos, accelerando
2:50.414 default J conflagrate Fluffy_Pillow 260305.1/1100000: 24% mana | 0.0/5: 0% soul_shard lord_of_flames, accelerando(2)
2:51.565 default K conflagrate Fluffy_Pillow 276875.8/1100000: 25% mana | 1.0/5: 20% soul_shard lord_of_flames, accelerando(2)
2:52.716 default K conflagrate Fluffy_Pillow 293446.6/1100000: 27% mana | 2.0/5: 40% soul_shard lord_of_flames, accelerando(2)
2:53.866 default Q chaos_bolt Fluffy_Pillow 310002.9/1100000: 28% mana | 3.0/5: 60% soul_shard lord_of_flames, conflagration_of_chaos, accelerando(2)
2:56.163 default Q chaos_bolt Fluffy_Pillow 343072.3/1100000: 31% mana | 3.0/5: 60% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(2)
2:57.544 default K conflagrate Fluffy_Pillow 362647.9/1100000: 33% mana | 2.0/5: 40% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos
2:58.729 default Q chaos_bolt Fluffy_Pillow 379212.8/1100000: 34% mana | 3.0/5: 60% soul_shard lord_of_flames, embrace_chaos, accelerando
3:00.130 default R incinerate Fluffy_Pillow 399100.5/1100000: 36% mana | 2.0/5: 40% soul_shard lord_of_flames, embrace_chaos, accelerando(2)
3:01.570 default P dimensional_rift Fluffy_Pillow 353951.0/1100000: 32% mana | 2.0/5: 40% soul_shard lord_of_flames, embrace_chaos, accelerando(3)
3:02.703 default R incinerate Fluffy_Pillow 370506.5/1100000: 34% mana | 2.0/5: 40% soul_shard lord_of_flames, embrace_chaos, accelerando(3)
3:04.122 default H berserking Fluffy_Pillow 325241.9/1100000: 30% mana | 3.0/5: 60% soul_shard lord_of_flames, embrace_chaos, accelerando(4)
3:04.122 default Q chaos_bolt Fluffy_Pillow 325241.9/1100000: 30% mana | 3.0/5: 60% soul_shard berserking, lord_of_flames, embrace_chaos, accelerando(4)
3:05.287 default K conflagrate Fluffy_Pillow 345107.3/1100000: 31% mana | 1.0/5: 20% soul_shard berserking, lord_of_flames, embrace_chaos, accelerando(4)
3:06.258 default L service_imp Fluffy_Pillow 361664.7/1100000: 33% mana | 2.0/5: 40% soul_shard berserking, lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(4)
3:07.229 default R incinerate Fluffy_Pillow 378222.1/1100000: 34% mana | 1.0/5: 20% soul_shard berserking, lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(4)
3:08.445 default C havoc enemy2 333191.1/1100000: 30% mana | 1.0/5: 20% soul_shard berserking, lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(5)
3:09.402 default R incinerate Fluffy_Pillow 261746.7/1100000: 24% mana | 1.0/5: 20% soul_shard berserking, lord_of_flames, conflagration_of_chaos, accelerando(5)
3:10.600 default R incinerate Fluffy_Pillow 216471.5/1100000: 20% mana | 1.0/5: 20% soul_shard berserking, lord_of_flames, conflagration_of_chaos, accelerando(5)
3:11.799 default E immolate Fluffy_Pillow 169919.8/1100000: 15% mana | 2.0/5: 40% soul_shard berserking, lord_of_flames, conflagration_of_chaos, accelerando
3:12.815 default Q chaos_bolt Fluffy_Pillow 120489.1/1100000: 11% mana | 2.0/5: 40% soul_shard berserking, lord_of_flames, conflagration_of_chaos, accelerando
3:14.844 default R incinerate Fluffy_Pillow 152043.0/1100000: 14% mana | 0.0/5: 0% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando
3:16.305 default R incinerate Fluffy_Pillow 106761.7/1100000: 10% mana | 2.0/5: 40% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando
3:17.769 default Q chaos_bolt Fluffy_Pillow 61523.0/1100000: 6% mana | 4.0/5: 80% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando
3:19.170 default G immolate Fluffy_Pillow 81391.9/1100000: 7% mana | 2.0/5: 40% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(2)
3:20.320 default J conflagrate Fluffy_Pillow 31948.2/1100000: 3% mana | 2.0/5: 40% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(2)
3:21.470 default Q chaos_bolt Fluffy_Pillow 48504.5/1100000: 4% mana | 3.0/5: 60% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(2)
3:22.849 default K conflagrate Fluffy_Pillow 68357.7/1100000: 6% mana | 2.0/5: 40% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(2)
3:24.000 default Q chaos_bolt Fluffy_Pillow 84633.7/1100000: 8% mana | 3.0/5: 60% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos
3:25.421 default K conflagrate Fluffy_Pillow 104650.4/1100000: 10% mana | 1.0/5: 20% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando
3:26.590 default R incinerate Fluffy_Pillow 121228.2/1100000: 11% mana | 2.0/5: 40% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando
3:28.053 default K conflagrate Fluffy_Pillow 76211.4/1100000: 7% mana | 2.0/5: 40% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(2)
3:29.401 default C havoc enemy2 95618.3/1100000: 9% mana | 4.0/5: 80% soul_shard lord_of_flames, embrace_chaos, accelerando(2)
3:30.550 default Q chaos_bolt Fluffy_Pillow 24160.2/1100000: 2% mana | 4.0/5: 80% soul_shard lord_of_flames, accelerando(2)
3:32.846 default S life_tap Fluffy_Pillow 57215.3/1100000: 5% mana | 2.0/5: 40% soul_shard lord_of_flames, embrace_chaos, accelerando(2)
3:33.996 default Q chaos_bolt Fluffy_Pillow 403771.6/1100000: 37% mana | 3.0/5: 60% soul_shard lord_of_flames, embrace_chaos, accelerando(2)
3:35.375 default K conflagrate Fluffy_Pillow 423624.8/1100000: 39% mana | 1.0/5: 20% soul_shard lord_of_flames, embrace_chaos, accelerando(2)
3:36.526 default R incinerate Fluffy_Pillow 440275.2/1100000: 40% mana | 2.0/5: 40% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(3)
3:37.945 default R incinerate Fluffy_Pillow 394157.4/1100000: 36% mana | 2.0/5: 40% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos
3:39.430 default Q chaos_bolt Fluffy_Pillow 348896.7/1100000: 32% mana | 2.0/5: 40% soul_shard lord_of_flames, conflagration_of_chaos
3:41.795 default E immolate Fluffy_Pillow 382144.4/1100000: 35% mana | 1.0/5: 20% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando
3:42.964 default R incinerate Fluffy_Pillow 332722.2/1100000: 30% mana | 1.0/5: 20% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando
3:44.426 default Q chaos_bolt Fluffy_Pillow 287484.0/1100000: 26% mana | 2.0/5: 40% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(2)
3:45.806 default R incinerate Fluffy_Pillow 307425.2/1100000: 28% mana | 1.0/5: 20% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(3)
3:47.226 default P dimensional_rift Fluffy_Pillow 262174.4/1100000: 24% mana | 1.0/5: 20% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(3)
3:48.360 default N summon_doomguard Fluffy_Pillow 278744.6/1100000: 25% mana | 1.0/5: 20% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(3)
3:49.493 default C havoc enemy2 295300.1/1100000: 27% mana | 0.0/5: 0% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(3)
3:50.626 default R incinerate Fluffy_Pillow 223855.6/1100000: 20% mana | 0.0/5: 0% soul_shard lord_of_flames, conflagration_of_chaos, accelerando(3)
3:52.046 default R incinerate Fluffy_Pillow 178604.8/1100000: 16% mana | 0.0/5: 0% soul_shard lord_of_flames, conflagration_of_chaos, accelerando(3)
3:53.466 default R incinerate Fluffy_Pillow 133027.1/1100000: 12% mana | 0.0/5: 0% soul_shard lord_of_flames, conflagration_of_chaos
3:54.949 default G immolate Fluffy_Pillow 87738.5/1100000: 8% mana | 1.0/5: 20% soul_shard lord_of_flames, conflagration_of_chaos
3:56.133 default J conflagrate Fluffy_Pillow 38274.1/1100000: 3% mana | 1.0/5: 20% soul_shard lord_of_flames
3:57.319 default K conflagrate Fluffy_Pillow 54837.7/1100000: 5% mana | 2.0/5: 40% soul_shard lord_of_flames
3:58.502 default Q chaos_bolt Fluffy_Pillow 71359.3/1100000: 6% mana | 3.0/5: 60% soul_shard lord_of_flames
4:00.869 default K conflagrate Fluffy_Pillow 104771.4/1100000: 10% mana | 2.0/5: 40% soul_shard lord_of_flames, embrace_chaos, accelerando
4:02.036 default Q chaos_bolt Fluffy_Pillow 121320.9/1100000: 11% mana | 3.0/5: 60% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando
4:03.436 default K conflagrate Fluffy_Pillow 141174.6/1100000: 13% mana | 1.0/5: 20% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando
4:04.604 default R incinerate Fluffy_Pillow 157738.2/1100000: 14% mana | 2.0/5: 40% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando
4:06.066 default Q chaos_bolt Fluffy_Pillow 112500.0/1100000: 10% mana | 2.0/5: 40% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(2)
4:07.445 default R incinerate Fluffy_Pillow 132354.1/1100000: 12% mana | 1.0/5: 20% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(3)
4:08.865 default O soul_harvest Fluffy_Pillow 87182.2/1100000: 8% mana | 2.0/5: 40% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(4)
4:08.865 default P dimensional_rift Fluffy_Pillow 87182.2/1100000: 8% mana | 2.0/5: 40% soul_shard soul_harvest, lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(4)
4:09.983 default C havoc enemy2 103759.5/1100000: 9% mana | 2.0/5: 40% soul_shard soul_harvest, lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(4)
4:11.100 default K conflagrate Fluffy_Pillow 32322.1/1100000: 3% mana | 2.0/5: 40% soul_shard soul_harvest, lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(4)
4:12.215 default Q chaos_bolt Fluffy_Pillow 47998.3/1100000: 4% mana | 3.0/5: 60% soul_shard soul_harvest, lord_of_flames
4:14.580 default R incinerate Fluffy_Pillow 81028.3/1100000: 7% mana | 2.0/5: 40% soul_shard soul_harvest, lord_of_flames, embrace_chaos, accelerando
4:16.042 default S life_tap Fluffy_Pillow 35761.2/1100000: 3% mana | 2.0/5: 40% soul_shard soul_harvest, lord_of_flames, embrace_chaos, accelerando
4:17.209 default E immolate Fluffy_Pillow 382310.7/1100000: 35% mana | 2.0/5: 40% soul_shard soul_harvest, lord_of_flames, embrace_chaos, accelerando
4:18.378 default Q chaos_bolt Fluffy_Pillow 333041.6/1100000: 30% mana | 4.0/5: 80% soul_shard soul_harvest, lord_of_flames, embrace_chaos, accelerando(2)
4:19.757 default Q chaos_bolt Fluffy_Pillow 352894.8/1100000: 32% mana | 3.0/5: 60% soul_shard soul_harvest, lord_of_flames, embrace_chaos, accelerando(2)
4:21.137 default R incinerate Fluffy_Pillow 372762.4/1100000: 34% mana | 1.0/5: 20% soul_shard soul_harvest, lord_of_flames, embrace_chaos, accelerando(2)
4:22.577 default Q chaos_bolt Fluffy_Pillow 327494.6/1100000: 30% mana | 3.0/5: 60% soul_shard soul_harvest, lord_of_flames, embrace_chaos, accelerando(3)
4:23.937 default R incinerate Fluffy_Pillow 347367.1/1100000: 32% mana | 2.0/5: 40% soul_shard soul_harvest, lord_of_flames, embrace_chaos, accelerando(3)
4:25.356 default R incinerate Fluffy_Pillow 302102.5/1100000: 27% mana | 2.0/5: 40% soul_shard soul_harvest, lord_of_flames, embrace_chaos, accelerando(4)
4:26.753 default Q chaos_bolt Fluffy_Pillow 256709.3/1100000: 23% mana | 4.0/5: 80% soul_shard soul_harvest, lord_of_flames, embrace_chaos
4:28.174 default R incinerate Fluffy_Pillow 276554.8/1100000: 25% mana | 2.0/5: 40% soul_shard lord_of_flames, embrace_chaos
4:29.659 default G immolate Fluffy_Pillow 231529.7/1100000: 21% mana | 3.0/5: 60% soul_shard lord_of_flames, embrace_chaos, accelerando
4:30.826 default C havoc enemy2 182079.2/1100000: 17% mana | 3.0/5: 60% soul_shard lord_of_flames, embrace_chaos, accelerando
4:31.994 default J conflagrate Fluffy_Pillow 110642.8/1100000: 10% mana | 3.0/5: 60% soul_shard lord_of_flames, embrace_chaos, accelerando
4:33.162 default J conflagrate Fluffy_Pillow 127458.3/1100000: 12% mana | 4.0/5: 80% soul_shard lord_of_flames, accelerando(2)
4:34.313 default J conflagrate Fluffy_Pillow 144029.0/1100000: 13% mana | 5.0/5: 100% soul_shard lord_of_flames, conflagration_of_chaos, accelerando(2)
4:35.463 default P dimensional_rift Fluffy_Pillow 160585.3/1100000: 15% mana | 5.0/5: 100% soul_shard lord_of_flames, conflagration_of_chaos, accelerando(2)
4:36.614 default L service_imp Fluffy_Pillow 177156.1/1100000: 16% mana | 5.0/5: 100% soul_shard lord_of_flames, conflagration_of_chaos, accelerando(2)
4:37.764 default F immolate enemy2 193712.4/1100000: 18% mana | 4.0/5: 80% soul_shard lord_of_flames, conflagration_of_chaos, accelerando(2)
4:38.917 default J conflagrate Fluffy_Pillow 144311.9/1100000: 13% mana | 4.0/5: 80% soul_shard lord_of_flames, conflagration_of_chaos, accelerando(2)
4:40.127 default Q chaos_bolt Fluffy_Pillow 161732.0/1100000: 15% mana | 5.0/5: 100% soul_shard lord_of_flames, conflagration_of_chaos, accelerando(2)
4:42.424 default Q chaos_bolt Fluffy_Pillow 194263.5/1100000: 18% mana | 3.0/5: 60% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando
4:43.825 default R incinerate Fluffy_Pillow 214187.6/1100000: 19% mana | 2.0/5: 40% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(2)
4:45.265 default R incinerate Fluffy_Pillow 168919.0/1100000: 15% mana | 2.0/5: 40% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(2)
4:46.706 default J conflagrate Fluffy_Pillow 123664.8/1100000: 11% mana | 2.0/5: 40% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(2)
4:47.857 default Q chaos_bolt Fluffy_Pillow 140235.5/1100000: 13% mana | 4.0/5: 80% soul_shard lord_of_flames, accelerando(2)
4:50.152 default R incinerate Fluffy_Pillow 173276.2/1100000: 16% mana | 2.0/5: 40% soul_shard lord_of_flames, embrace_chaos, accelerando(2)
4:51.592 default C havoc enemy2 128008.4/1100000: 12% mana | 2.0/5: 40% soul_shard lord_of_flames, embrace_chaos, accelerando(3)
4:52.726 default J conflagrate Fluffy_Pillow 56578.6/1100000: 5% mana | 2.0/5: 40% soul_shard lord_of_flames, embrace_chaos, accelerando(3)
4:53.893 default E immolate Fluffy_Pillow 73186.5/1100000: 7% mana | 3.0/5: 60% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando
4:55.063 default Q chaos_bolt Fluffy_Pillow 23778.5/1100000: 2% mana | 3.0/5: 60% soul_shard lord_of_flames, conflagration_of_chaos, accelerando

Stats

Raid-Buffed Unbuffed Gear Amount
Strength 4201 3876 0
Agility 7254 6929 0
Stamina 55790 55790 34991
Intellect 50912 49205 39539 (1278)
Spirit 1 1 0
Health 3347400 3347400 0
Mana 1100000 1100000 0
Soul Shard 5 5 0
Spell Power 50912 49205 0
Crit 15.92% 15.92% 4367
Haste 26.96% 25.96% 9736
Damage / Heal Versatility 5.96% 5.96% 2829
ManaReg per Second 13966 13856 0
Mastery 76.44% 76.44% 6991
Armor 2002 2002 2002
Run Speed 7 0 0

Gear

Source Slot Average Item Level: 907.00
Local Head Eyes of Azj'Aqir
ilevel: 900, stats: { 253 Armor, +3255 Sta, +2170 Int, +1074 Haste, +578 Vers }
Local Neck Radiant String of Scorpid Eyes
ilevel: 900, stats: { +1831 Sta, +2011 Haste, +922 Crit }, enchant: mark_of_the_hidden_satyr
Local Shoulders Pauldrons of Azj'Aqir
ilevel: 900, stats: { 233 Armor, +2442 Sta, +1628 Int, +752 Mastery, +487 Vers }
Local Chest Finery of Azj'Aqir
ilevel: 905, stats: { 317 Armor, +3410 Sta, +2273 Int, +1058 Mastery, +625 Crit }
Local Waist Man'ari Skullbuckled Cinch
ilevel: 900, stats: { 175 Armor, +2442 Sta, +1628 Int, +699 Haste, +540 Mastery }
Local Legs Pillars of the Dark Portal
ilevel: 940, stats: { 314 Armor, +4726 Sta, +3150 Int, +1097 Crit, +822 Mastery, +658 Haste }
Local Feet Outcast Wanderer's Footrags
ilevel: 910, stats: { 222 Armor, +2680 Sta, +1786 Int, +864 Crit, +422 Mastery }
Local Wrists Woven Lasher Tendril Bracers
ilevel: 900, stats: { 136 Armor, +1831 Sta, +1221 Int, +644 Haste, +285 Vers }
Local Hands Clutch of Azj'Aqir
ilevel: 900, stats: { 194 Armor, +2442 Sta, +1628 Int, +859 Crit, +380 Mastery }
Local Finger1 Ring of the Scoured Clan
ilevel: 900, stats: { +1831 Sta, +2095 Mastery, +838 Haste }, enchant: { +200 Haste }
Local Finger2 Ring of Braided Stems
ilevel: 905, stats: { +1918 Sta, +1814 Haste, +1209 Vers }, enchant: { +200 Haste }
Local Trinket1 Whispers in the Dark
ilevel: 905, stats: { +2162 Int }
Local Trinket2 Erratic Metronome
ilevel: 900, stats: { +2063 Int }
Local Back Astromancer's Greatcloak
ilevel: 905, stats: { 158 Armor, +1918 Sta, +1278 StrAgiInt, +676 Haste, +270 Vers }, enchant: { +200 Int }
Local Main Hand Scepter of Sargeras
ilevel: 929, weapon: { 7005 - 10509, 3.6 }, stats: { +2843 Int, +4265 Sta, +922 Haste, +922 Mastery, +15509 Int }, relics: { +61 ilevels, +59 ilevels, +61 ilevels }

Talents

Level
15 Backdraft (Destruction Warlock) Roaring Blaze (Destruction Warlock) Shadowburn (Destruction Warlock)
30 Reverse Entropy (Destruction Warlock) Eradication (Destruction Warlock) Empowered Life Tap
45 Demonic Circle Mortal Coil Shadowfury
60 Cataclysm (Destruction Warlock) Fire and Brimstone (Destruction Warlock) Soul Harvest
75 Demon Skin Burning Rush Dark Pact
90 Grimoire of Supremacy Grimoire of Service Grimoire of Sacrifice
100 Wreak Havoc (Destruction Warlock) Channel Demonfire (Destruction Warlock) Soul Conduit

Profile

warlock="Portal_Pants"
level=110
race=troll
role=spell
position=back
talents=2203021
artifact=38:0:0:0:0:803:1:804:3:805:3:806:3:807:3:808:3:809:3:810:3:811:3:812:3:813:1:814:1:815:1:816:1:817:1:818:1:1355:1:1392:1:1609:4:1610:1:1611:1:1713:1
spec=destruction

# This default action priority list is automatically created based on your character.
# It is a attempt to provide you with a action list that is both simple and practicable,
# while resulting in a meaningful and good simulation. It may not result in the absolutely highest possible dps.
# Feel free to edit, adapt and improve it to your own needs.
# SimulationCraft is always looking for updates and improvements to the default action lists.

# Executed before combat begins. Accepts non-harmful actions only.
actions.precombat=flask,type=whispered_pact
actions.precombat+=/food,type=azshari_salad
actions.precombat+=/summon_pet,if=!talent.grimoire_of_supremacy.enabled&(!talent.grimoire_of_sacrifice.enabled|buff.demonic_power.down)
actions.precombat+=/summon_infernal,if=talent.grimoire_of_supremacy.enabled&artifact.lord_of_flames.rank>0
actions.precombat+=/summon_infernal,if=talent.grimoire_of_supremacy.enabled&active_enemies>1
actions.precombat+=/summon_doomguard,if=talent.grimoire_of_supremacy.enabled&active_enemies=1&artifact.lord_of_flames.rank=0
actions.precombat+=/augmentation,type=defiled
actions.precombat+=/snapshot_stats
actions.precombat+=/grimoire_of_sacrifice,if=talent.grimoire_of_sacrifice.enabled
actions.precombat+=/life_tap,if=talent.empowered_life_tap.enabled&!buff.empowered_life_tap.remains
actions.precombat+=/potion,name=prolonged_power
actions.precombat+=/chaos_bolt

# Executed every time the actor is available.
actions=havoc,target=2,if=active_enemies>1&(active_enemies<4|talent.wreak_havoc.enabled&active_enemies<6)&!debuff.havoc.remains
actions+=/dimensional_rift,if=charges=3
actions+=/immolate,if=remains<=tick_time
actions+=/immolate,cycle_targets=1,if=active_enemies>1&remains<=tick_time&(!talent.roaring_blaze.enabled|(!debuff.roaring_blaze.remains&action.conflagrate.charges<2+set_bonus.tier19_4pc))
actions+=/immolate,if=talent.roaring_blaze.enabled&remains<=duration&!debuff.roaring_blaze.remains&target.time_to_die>10&(action.conflagrate.charges=2+set_bonus.tier19_4pc|(action.conflagrate.charges>=1+set_bonus.tier19_4pc&action.conflagrate.recharge_time<cast_time+gcd)|target.time_to_die<24)
actions+=/berserking
actions+=/blood_fury
actions+=/arcane_torrent
actions+=/potion,name=deadly_grace,if=(buff.soul_harvest.remains|trinket.proc.any.react|target.time_to_die<=45)
actions+=/shadowburn,if=buff.conflagration_of_chaos.remains<=action.chaos_bolt.cast_time
actions+=/shadowburn,if=(charges=1+set_bonus.tier19_4pc&recharge_time<action.chaos_bolt.cast_time|charges=2+set_bonus.tier19_4pc)&soul_shard<5
actions+=/conflagrate,if=talent.roaring_blaze.enabled&(charges=2+set_bonus.tier19_4pc|(charges>=1+set_bonus.tier19_4pc&recharge_time<gcd)|target.time_to_die<24)
actions+=/conflagrate,if=talent.roaring_blaze.enabled&debuff.roaring_blaze.stack>0&dot.immolate.remains>dot.immolate.duration*0.3&(active_enemies=1|soul_shard<3)&soul_shard<5
actions+=/conflagrate,if=!talent.roaring_blaze.enabled&buff.backdraft.stack<3&buff.conflagration_of_chaos.remains<=action.chaos_bolt.cast_time
actions+=/conflagrate,if=!talent.roaring_blaze.enabled&buff.backdraft.stack<3&(charges=1+set_bonus.tier19_4pc&recharge_time<action.chaos_bolt.cast_time|charges=2+set_bonus.tier19_4pc)&soul_shard<5
actions+=/life_tap,if=talent.empowered_life_tap.enabled&buff.empowered_life_tap.remains<=gcd
actions+=/dimensional_rift,if=equipped.144369&!buff.lessons_of_spacetime.remains&((!talent.grimoire_of_supremacy.enabled&!cooldown.summon_doomguard.remains)|(talent.grimoire_of_service.enabled&!cooldown.service_pet.remains)|(talent.soul_harvest.enabled&!cooldown.soul_harvest.remains))
actions+=/service_pet
actions+=/summon_infernal,if=artifact.lord_of_flames.rank>0&!buff.lord_of_flames.remains
actions+=/summon_doomguard,if=!talent.grimoire_of_supremacy.enabled&spell_targets.infernal_awakening<=2&(target.time_to_die>180|target.health.pct<=20|target.time_to_die<30)
actions+=/summon_infernal,if=!talent.grimoire_of_supremacy.enabled&spell_targets.infernal_awakening>2
actions+=/summon_doomguard,if=talent.grimoire_of_supremacy.enabled&spell_targets.summon_infernal=1&artifact.lord_of_flames.rank>0&buff.lord_of_flames.remains&!pet.doomguard.active
actions+=/summon_doomguard,if=talent.grimoire_of_supremacy.enabled&spell_targets.summon_infernal=1&equipped.132379&!cooldown.sindorei_spite_icd.remains
actions+=/summon_infernal,if=talent.grimoire_of_supremacy.enabled&spell_targets.summon_infernal>1&equipped.132379&!cooldown.sindorei_spite_icd.remains
actions+=/soul_harvest
actions+=/channel_demonfire,if=dot.immolate.remains>cast_time
actions+=/havoc,if=active_enemies=1&talent.wreak_havoc.enabled&equipped.132375&!debuff.havoc.remains
actions+=/rain_of_fire,if=active_enemies>=3&cooldown.havoc.remains<=12&!talent.wreak_havoc.enabled
actions+=/rain_of_fire,if=active_enemies>=6&talent.wreak_havoc.enabled
actions+=/dimensional_rift,if=!equipped.144369|charges>1|((!talent.grimoire_of_service.enabled|recharge_time<cooldown.service_pet.remains)&(!talent.soul_harvest.enabled|recharge_time<cooldown.soul_harvest.remains)&(!talent.grimoire_of_supremacy.enabled|recharge_time<cooldown.summon_doomguard.remains))
actions+=/life_tap,if=talent.empowered_life_tap.enabled&buff.empowered_life_tap.remains<duration*0.3
actions+=/cataclysm
actions+=/chaos_bolt,if=(cooldown.havoc.remains>12&cooldown.havoc.remains|active_enemies<3|talent.wreak_havoc.enabled&active_enemies<6)&(set_bonus.tier19_4pc=0|!talent.eradication.enabled|buff.embrace_chaos.remains<=cast_time|soul_shard>=3)
actions+=/shadowburn
actions+=/conflagrate,if=!talent.roaring_blaze.enabled&buff.backdraft.stack<3
actions+=/immolate,if=!talent.roaring_blaze.enabled&remains<=duration*0.3
actions+=/incinerate
actions+=/life_tap

head=eyes_of_azjaqir,id=138314,bonus_id=3445
neck=radiant_string_of_scorpid_eyes,id=140898,bonus_id=3445,enchant_id=5439
shoulders=pauldrons_of_azjaqir,id=138323,bonus_id=3445
back=astromancers_greatcloak,id=140909,bonus_id=3518,enchant_id=5436
chest=finery_of_azjaqir,id=138320,bonus_id=3518
wrists=woven_lasher_tendril_bracers,id=140886,bonus_id=3445
hands=clutch_of_azjaqir,id=138311,bonus_id=3445
waist=manari_skullbuckled_cinch,id=140887,bonus_id=3445
legs=pillars_of_the_dark_portal,id=132357,ilevel=940
feet=outcast_wanderers_footrags,id=140914,bonus_id=3519
finger1=ring_of_the_scoured_clan,id=140897,bonus_id=3445,enchant=binding_of_haste
finger2=ring_of_braided_stems,id=140896,bonus_id=3518,enchant=binding_of_haste
trinket1=whispers_in_the_dark,id=140809,ilevel=905
trinket2=erratic_metronome,id=140792,ilevel=900
main_hand=scepter_of_sargeras,id=128941,ilevel=929,gem_id=140826/140837/140826,relic_id=3519/3518:3518/3519

# Gear Summary
# gear_ilvl=906.60
# gear_stamina=34991
# gear_intellect=39539
# gear_crit_rating=4367
# gear_haste_rating=9736
# gear_mastery_rating=6991
# gear_versatility_rating=2829
# gear_armor=2002
# set_bonus=tier19_2pc=1
# set_bonus=tier19_4pc=1
default_pet=imp

Prydaz : 1350763 dps, 806181 dps to main target

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR
1350762.7 1350762.7 1134.0 / 0.084% 227247.9 / 16.8% 43.2
RPS Out RPS In Primary Resource Waiting APM Active Skill
25122.6 25122.6 Mana 0.00% 49.8 100.0% 100%
Talents
  • 15: Roaring Blaze (Destruction Warlock)
  • 30: Eradication (Destruction Warlock)
  • 60: Soul Harvest
  • 90: Grimoire of Service
  • 100: Wreak Havoc (Destruction Warlock)
  • Talent Calculator
Artifact

Charts

Abilities

Damage Stats DPS DPS% Execute Interval DPE DPET Type Count Hit Crit Avg Crit% Up%
Prydaz 1350763
Chaos Bolt 401032 29.7% 60.3 4.85sec 2000819 1326151 Direct 115.1 0 1048166 1048166 100.0%  

Stats details: chaos_bolt

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 60.27 115.06 0.00 0.00 1.5087 0.0000 120598841.97 120598841.97 0.00 1326150.96 1326150.96
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
crit 115.06 100.00% 1048166.39 653729 1640273 1048448.43 978521 1114476 120598842 120598842 0.00
 
 

Action details: chaos_bolt

Static Values
  • id:116858
  • school:chromatic
  • resource:soul_shard
  • range:40.0
  • travel_speed:16.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:2.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:3.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:116858
  • name:Chaos Bolt
  • school:chromatic
  • tooltip:
  • description:Unleashes a devastating blast of chaos, causing {$s1=1} Chaos damage. Chaos Bolt always critically strikes and your critical strike chance increases its damage.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:4.000000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
Conflagrate 168740 12.5% 48.1 6.24sec 1053731 1009176 Direct 95.7 312333 708136 529735 54.9%  

Stats details: conflagrate

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 48.09 95.66 0.00 0.00 1.0442 0.0000 50671733.16 50671733.16 0.00 1009175.94 1009175.94
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 43.12 45.07% 312332.70 197029 494335 312508.02 276654 353941 13466310 13466310 0.00
crit 52.54 54.93% 708136.01 394071 1140752 708323.65 609366 789028 37205423 37205423 0.00
 
 

Action details: conflagrate

Static Values
  • id:17962
  • school:fire
  • resource:chi
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:9.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:talent.roaring_blaze.enabled&(charges=2+set_bonus.tier19_4pc|(charges>=1+set_bonus.tier19_4pc&recharge_time<gcd)|target.time_to_die<24)
Spelldata
  • id:17962
  • name:Conflagrate
  • school:fire
  • tooltip:
  • description:Triggers an explosion on the target, dealing {$s1=1} Fire damage.{$?s196406=false}[ Reduces the cast time of Incinerate and Chaos Bolt by {$117828s1=30}% for {$117828d=10 seconds}.][] |cFFFFFFFFGenerates 1 Soul Shard.|r
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:2.265510
  • base_dd_min:1.00
  • base_dd_max:1.00
 
Cry Havoc 41188 3.1% 51.9 5.58sec 238899 0 Direct 103.7 103495 207022 119451 15.4%  

Stats details: cry_havoc

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 51.86 103.72 0.00 0.00 0.0000 0.0000 12388910.27 12388910.27 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 87.73 84.59% 103495.37 70953 158956 103545.61 96633 112598 9079829 9079829 0.00
crit 15.98 15.41% 207021.63 141906 317912 207050.14 0 273200 3309081 3309081 0.00
 
 

Action details: cry_havoc

Static Values
  • id:243011
  • school:chromatic
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:243011
  • name:Cry Havoc
  • school:chromatic
  • tooltip:
  • description:Deals {$s2=0} Chaos damage to enemies within $A2 yards.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:1.000000
  • base_dd_min:0.00
  • base_dd_max:0.00
 
Deadly Grace 6098 0.4% 14.3 2.08sec 125919 0 Direct 14.3 109289 218658 125918 15.2%  

Stats details: deadly_grace

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 14.30 14.30 0.00 0.00 0.0000 0.0000 1800187.54 1800187.54 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 12.12 84.79% 109288.63 96891 116269 109299.58 100767 116269 1324866 1324866 0.00
crit 2.17 15.21% 218658.42 193782 232539 196573.97 0 232539 475322 475322 0.00
 
 

Action details: deadly_grace

Static Values
  • id:188091
  • school:arcane
  • resource:none
  • range:40.0
  • travel_speed:25.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:188091
  • name:Deadly Grace
  • school:arcane
  • tooltip:
  • description:Deal {$s1=63339 to 95008} Arcane damage.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:63338.72
  • base_dd_max:95008.08
 
Immolate 310324 23.0% 19.9 15.33sec 4689094 4429507 Direct 38.5 163259 326754 266947 63.4%  
Periodic 291.5 174093 348341 284496 63.4% 195.9%

Stats details: immolate

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 19.87 38.48 291.46 291.46 1.0586 2.0237 93192395.80 93192395.80 0.00 152559.84 4429506.91
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 14.08 36.58% 163259.23 103563 259809 163220.23 129937 192580 2298040 2298040 0.00
crit 24.41 63.42% 326753.52 207117 519606 326760.95 276420 382667 7974712 7974712 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 106.8 36.64% 174092.63 90 516234 174367.30 144416 207046 18592118 18592118 0.00
crit 184.7 63.36% 348340.51 56 1032488 348892.23 300288 400007 64327527 64327527 0.00
 
 

Action details: immolate

Static Values
  • id:348
  • school:fire
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:66000.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:1.50
  • base_crit:0.48
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:remains<=tick_time
Spelldata
  • id:348
  • name:Immolate
  • school:fire
  • tooltip:
  • description:Burns the enemy, causing {$s1=1} Fire damage immediately and an additional $157736o1 Fire damage over {$157736d=18 seconds}. |cFFFFFFFFPeriodic damage has a {$193541s1=15}% chance to generate 1 Soul Shard. Chance doubled on critical strikes.|r
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:1.332000
  • base_dd_min:1.00
  • base_dd_max:1.00
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.721500
  • base_td:0.00
  • dot_duration:18.00
  • base_tick_time:3.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
 
Incinerate 148758 11.0% 74.9 3.84sec 597841 463959 Direct 143.2 270820 541992 312562 15.4%  

Stats details: incinerate

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 74.86 143.18 0.00 0.00 1.2886 0.0000 44752519.11 44752519.11 0.00 463958.60 463958.60
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 121.14 84.61% 270820.50 167400 420024 270880.19 249669 288585 32806968 32806968 0.00
crit 22.04 15.39% 541991.99 334807 840038 542094.74 444399 653448 11945551 11945551 0.00
 
 

Action details: incinerate

Static Values
  • id:29722
  • school:fire
  • resource:mana
  • range:40.0
  • travel_speed:20.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:66000.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:1.88
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:29722
  • name:Incinerate
  • school:fire
  • tooltip:
  • description:Draws fire toward the enemy, dealing {$s2=0} Fire damage.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:2.331000
  • base_dd_min:0.00
  • base_dd_max:0.00
 
Mark of the Hidden Satyr 10104 0.7% 19.8 15.11sec 153414 0 Direct 19.8 133007 265976 153414 15.3%  

Stats details: mark_of_the_hidden_satyr

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 19.79 19.79 0.00 0.00 0.0000 0.0000 3035747.63 3035747.63 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 16.75 84.65% 133007.15 126701 160060 133030.69 126701 144156 2228010 2228010 0.00
crit 3.04 15.35% 265976.36 253403 320120 254103.03 0 320120 807738 807738 0.00
 
 

Action details: mark_of_the_hidden_satyr

Static Values
  • id:191259
  • school:fire
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:191259
  • name:Mark of the Hidden Satyr
  • school:fire
  • tooltip:
  • description:Deals fire damage.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:2.500000
  • spell_power_mod.direct:2.000000
  • base_dd_min:0.00
  • base_dd_max:0.00
 
pet - imp 48212 / 48212
Firebolt 48212 3.6% 108.1 2.78sec 134032 109414 Direct 107.3 117028 234063 135062 15.4%  

Stats details: firebolt

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 108.09 107.27 0.00 0.00 1.2250 0.0000 14487887.28 14487887.28 0.00 109414.39 109414.39
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 90.74 84.59% 117027.87 74755 141656 117058.76 114564 119592 10619071 10619071 0.00
crit 16.53 15.41% 234062.97 149511 283311 234128.46 210103 256424 3868816 3868816 0.00
 
 

Action details: firebolt

Static Values
  • id:3110
  • school:fire
  • resource:energy
  • range:40.0
  • travel_speed:16.0000
  • trigger_gcd:0.5000
  • min_gcd:0.7500
  • base_cost:40.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:1.75
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:3110
  • name:Firebolt
  • school:fire
  • tooltip:
  • description:Deals {$s1=1} Fire damage to a target.$?a231795[ Damage increased by {$231795s1=50}% if you have Immolated the target.][] |cFF777777(Right-Click to toggle)|r
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:1.000000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
pet - service_imp 139724 / 44710
Firebolt 139724 3.3% 48.9 5.55sec 273733 238674 Direct 48.6 238657 477483 275360 15.4%  

Stats details: firebolt

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 48.94 48.65 0.00 0.00 1.1469 0.0000 13395794.44 13395794.44 0.00 238673.60 238673.60
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 41.17 84.63% 238657.36 149511 283311 238884.05 227377 247399 9825969 9825969 0.00
crit 7.48 15.37% 477482.91 299021 566623 477863.41 0 566623 3569826 3569826 0.00
 
 

Action details: firebolt

Static Values
  • id:3110
  • school:fire
  • resource:energy
  • range:40.0
  • travel_speed:16.0000
  • trigger_gcd:0.5000
  • min_gcd:0.7500
  • base_cost:40.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:1.75
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:3110
  • name:Firebolt
  • school:fire
  • tooltip:
  • description:Deals {$s1=1} Fire damage to a target.$?a231795[ Damage increased by {$231795s1=50}% if you have Immolated the target.][] |cFF777777(Right-Click to toggle)|r
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:1.000000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
pet - infernal 132366 / 11210
Immolation 103055 0.6% 1.0 0.00sec 2576470 0 Periodic 46.3 48219 96432 55623 15.4% 8.1%

Stats details: immolation

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 23.16 46.32 0.0000 1.0551 2576470.11 2576470.11 0.00 105437.47 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 39.2 84.64% 48218.86 41682 50019 48220.91 46922 49409 1890508 1890508 0.00
crit 7.1 15.36% 96432.12 83365 100037 96403.91 0 100037 685962 685962 0.00
 
 

Action details: immolation

Static Values
  • id:19483
  • school:fire
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:!ticking
Spelldata
  • id:19483
  • name:Immolation
  • school:fire
  • tooltip:Burns nearby enemies for {$20153s1=0} fire damage every $t1 seconds.
  • description:Burns nearby enemies for {$20153s1=0} fire damage every $t1 seconds.
 

Action details: immolation_tick

Static Values
  • id:20153
  • school:fire
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:20153
  • name:Immolation
  • school:fire
  • tooltip:
  • description:Deals Fire damage to all enemies near the caster.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.650000
  • base_dd_min:0.00
  • base_dd_max:0.00
 
melee 29311 0.2% 22.0 1.11sec 33304 30026 Direct 22.0 28862 57673 33304 15.4%  

Stats details: melee

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 22.00 22.00 0.00 0.00 1.1092 0.0000 732805.35 1077293.27 31.98 30025.62 30025.62
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 18.61 84.58% 28861.80 24926 29911 28861.95 27994 29911 537129 789630 31.98
crit 3.39 15.42% 57673.12 49852 59823 56195.64 0 59823 195677 287663 31.16
 
 

Action details: melee

Static Values
  • id:0
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Weapon
  • normalized:false
  • weapon_power_mod:0.285714
  • weapon_multiplier:1.00
 
pet - doomguard 107506 / 9100
Doom Bolt 107506 0.7% 10.8 2.21sec 249369 115037 Direct 10.8 216323 432611 249381 15.3%  

Stats details: doom_bolt

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 10.78 10.78 0.00 0.00 2.1678 0.0000 2687715.11 2687715.11 0.00 115036.60 115036.60
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 9.13 84.71% 216322.68 209059 250871 216357.40 209059 250871 1975029 1975029 0.00
crit 1.65 15.29% 432611.34 418118 501741 359666.79 0 501741 712686 712686 0.00
 
 

Action details: doom_bolt

Static Values
  • id:85692
  • school:shadow
  • resource:energy
  • range:30.0
  • travel_speed:20.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:35.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:3.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:85692
  • name:Doom Bolt
  • school:shadow
  • tooltip:
  • description:Sends a shadowy bolt at the enemy, causing {$s1=1} Shadow damage. Deals {$s2=20}% additional damage to targets below 20% health.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:2.750000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
pet - lord_of_flames_infernal 132350 / 11209
Immolation 103034 0.6% 1.0 0.00sec 2575946 0 Periodic 46.3 48220 96415 55612 15.3% 8.1%

Stats details: immolation

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 23.16 46.32 0.0000 1.0551 2575945.69 2575945.69 0.00 105416.01 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 39.2 84.66% 48220.42 41682 50019 48222.32 46987 49423 1891033 1891033 0.00
crit 7.1 15.34% 96414.88 83365 100037 96349.69 0 100037 684913 684913 0.00
 
 

Action details: immolation

Static Values
  • id:19483
  • school:fire
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:!ticking
Spelldata
  • id:19483
  • name:Immolation
  • school:fire
  • tooltip:Burns nearby enemies for {$20153s1=0} fire damage every $t1 seconds.
  • description:Burns nearby enemies for {$20153s1=0} fire damage every $t1 seconds.
 

Action details: immolation_tick

Static Values
  • id:20153
  • school:fire
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:20153
  • name:Immolation
  • school:fire
  • tooltip:
  • description:Deals Fire damage to all enemies near the caster.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.650000
  • base_dd_min:0.00
  • base_dd_max:0.00
 
melee 29316 0.2% 22.0 1.11sec 33310 30031 Direct 22.0 28860 57695 33310 15.4%  

Stats details: melee

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 22.00 22.00 0.00 0.00 1.1092 0.0000 732926.50 1077471.38 31.98 30030.59 30030.59
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 18.61 84.57% 28859.80 24926 29911 28860.04 28131 29911 537008 789452 31.98
crit 3.40 15.43% 57695.08 49852 59823 56375.11 0 59823 195919 288019 31.25
 
 

Action details: melee

Static Values
  • id:0
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Weapon
  • normalized:false
  • weapon_power_mod:0.285714
  • weapon_multiplier:1.00
 
pet - lord_of_flames_infernal 132403 / 11212
Immolation 103111 0.6% 1.0 0.00sec 2577882 0 Periodic 46.3 48219 96426 55654 15.4% 8.1%

Stats details: immolation

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 23.16 46.32 0.0000 1.0551 2577882.44 2577882.44 0.00 105495.27 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 39.2 84.58% 48219.40 41682 50019 48220.91 47041 49513 1889096 1889096 0.00
crit 7.1 15.42% 96426.27 83365 100037 96392.53 0 100037 688787 688787 0.00
 
 

Action details: immolation

Static Values
  • id:19483
  • school:fire
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:!ticking
Spelldata
  • id:19483
  • name:Immolation
  • school:fire
  • tooltip:Burns nearby enemies for {$20153s1=0} fire damage every $t1 seconds.
  • description:Burns nearby enemies for {$20153s1=0} fire damage every $t1 seconds.
 

Action details: immolation_tick

Static Values
  • id:20153
  • school:fire
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:20153
  • name:Immolation
  • school:fire
  • tooltip:
  • description:Deals Fire damage to all enemies near the caster.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.650000
  • base_dd_min:0.00
  • base_dd_max:0.00
 
melee 29292 0.2% 22.0 1.11sec 33283 30006 Direct 22.0 28856 57738 33282 15.3%  

Stats details: melee

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 22.00 22.00 0.00 0.00 1.1092 0.0000 732321.73 1076582.31 31.98 30005.81 30005.81
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 18.63 84.67% 28855.86 24926 29911 28856.12 27994 29911 537612 790341 31.98
crit 3.37 15.33% 57738.43 49852 59823 56342.17 0 59823 194709 286241 31.19
 
 

Action details: melee

Static Values
  • id:0
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Weapon
  • normalized:false
  • weapon_power_mod:0.285714
  • weapon_multiplier:1.00
 
pet - lord_of_flames_infernal 132411 / 11214
Immolation 103083 0.6% 1.0 0.00sec 2577185 0 Periodic 46.3 48217 96456 55638 15.4% 8.1%

Stats details: immolation

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 23.16 46.32 0.0000 1.0551 2577184.61 2577184.61 0.00 105466.71 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 39.2 84.61% 48216.72 41682 50019 48218.51 46969 49409 1889794 1889794 0.00
crit 7.1 15.39% 96455.68 83365 100037 96394.16 0 100037 687391 687391 0.00
 
 

Action details: immolation

Static Values
  • id:19483
  • school:fire
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:!ticking
Spelldata
  • id:19483
  • name:Immolation
  • school:fire
  • tooltip:Burns nearby enemies for {$20153s1=0} fire damage every $t1 seconds.
  • description:Burns nearby enemies for {$20153s1=0} fire damage every $t1 seconds.
 

Action details: immolation_tick

Static Values
  • id:20153
  • school:fire
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:20153
  • name:Immolation
  • school:fire
  • tooltip:
  • description:Deals Fire damage to all enemies near the caster.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.650000
  • base_dd_min:0.00
  • base_dd_max:0.00
 
melee 29328 0.2% 22.0 1.11sec 33323 30043 Direct 22.0 28855 57745 33324 15.5%  

Stats details: melee

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 22.00 22.00 0.00 0.00 1.1092 0.0000 733223.15 1077907.48 31.98 30042.74 30042.74
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 18.60 84.53% 28855.27 24926 29911 28855.11 27994 29911 536711 789016 31.98
crit 3.40 15.47% 57744.65 49852 59823 56278.98 0 59823 196512 288892 31.16
 
 

Action details: melee

Static Values
  • id:0
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Weapon
  • normalized:false
  • weapon_power_mod:0.285714
  • weapon_multiplier:1.00
 
pet - shadowy_tear 133475 / 17886
Shadow Bolt 133475 1.3% 3.3 68.94sec 1605900 0 Periodic 36.7 126505 253229 146003 15.4% 15.1%

Stats details: shadow_bolt

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 3.33 0.00 36.87 36.68 0.0000 1.2318 5355153.40 5355153.40 0.00 117897.79 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 31.0 84.61% 126505.14 70 153905 125895.43 0 153905 3925976 3925976 0.00
crit 5.6 15.39% 253229.30 135 307810 244400.90 0 307810 1429178 1429178 0.00
 
 

Action details: shadow_bolt

Static Values
  • id:196657
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:20.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:196657
  • name:Shadow Bolt
  • school:shadow
  • tooltip:
  • description:Sends a shadowy bolt at the enemy, causing {$s1=1} Shadow damage.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • dot_duration:14.00
  • base_tick_time:2.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
 
pet - flame_rift 282327 / 78717
Searing Bolt 282327 5.8% 65.5 2.63sec 359635 1095097 Direct 65.1 65693 0 65693 0.0%  
Periodic 139.0 120243 240464 138677 15.3% 45.7%

Stats details: searing_bolt

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 65.52 65.15 139.05 139.05 0.3284 0.9896 23562108.22 23562108.22 0.00 148086.91 1095097.05
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 65.15 100.00% 65692.60 60915 76953 65734.80 0 76953 4279766 4279766 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 117.7 84.67% 120243.39 122 153933 119740.34 0 136729 14155786 14155786 0.00
crit 21.3 15.33% 240463.63 244 307866 239105.75 0 307866 5126556 5126556 0.00
 
 

Action details: searing_bolt

Static Values
  • id:243050
  • school:fire
  • resource:energy
  • range:100.0
  • travel_speed:20.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:1.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:243050
  • name:Searing Bolt
  • school:fire
  • tooltip:Burning for $w2 Fire damage every $t2 sec.
  • description:Sends a searing bolt at the enemy, causing {$s1=1} Fire damage, and an additional $o2 Fire damage over {$d=30 seconds}, stacking up to {$u=20} times.
Direct Damage
  • may_crit:false
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:1.000000
  • base_dd_min:1.00
  • base_dd_max:1.00
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.100000
  • base_td:1.00
  • dot_duration:30.00
  • base_tick_time:1.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
 
pet - chaos_tear 156745 / 8339
Chaos Bolt 156745 0.6% 3.3 71.11sec 753638 378572 Direct 3.3 0 758671 758671 100.0%  

Stats details: chaos_bolt

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 3.31 3.29 0.00 0.00 1.9908 0.0000 2497057.75 2497057.75 0.00 378571.52 378571.52
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
crit 3.29 100.00% 758671.27 702799 887836 758194.88 0 887836 2497058 2497058 0.00
 
 

Action details: chaos_bolt

Static Values
  • id:215279
  • school:chromatic
  • resource:none
  • range:100.0
  • travel_speed:16.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:5.500
  • base_execute_time:3.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:215279
  • name:Chaos Bolt
  • school:chromatic
  • tooltip:
  • description:Unleashes a devastating blast of chaos, causing {$s1=1} Chaos damage. Chaos Bolt always critically strikes and your critical strike chance increases its damage.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:5.000000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
pet - chaos_portal 278644 / 16210
Chaos Barrage 278644 1.2% 3.3 71.80sec 1454687 0 Periodic 116.2 36171 72332 41743 15.4% 6.0%

Stats details: chaos_barrage

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 3.33 0.00 116.73 116.20 0.0000 0.1552 4850806.70 4850806.70 0.00 267748.89 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 98.3 84.59% 36171.29 147 42325 35971.76 0 42325 3555628 3555628 0.00
crit 17.9 15.41% 72332.07 298 84650 71924.59 0 84650 1295179 1295179 0.00
 
 

Action details: chaos_barrage

Static Values
  • id:187394
  • school:magic
  • resource:none
  • range:100.0
  • travel_speed:24.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:187394
  • name:Chaos Barrage
  • school:magic
  • tooltip:
  • description:Deals {$s1=1} Chaos damage.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • dot_duration:5.50
  • base_tick_time:0.25
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
 
Simple Action Stats Execute Interval
Prydaz
augmentation 1.0 0.00sec

Stats details: augmentation

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: augmentation

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Prydaz
  • harmful:false
  • if_expr:
 
Berserking 2.1 180.57sec

Stats details: berserking

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.06 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: berserking

Static Values
  • id:26297
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:180.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:26297
  • name:Berserking
  • school:physical
  • tooltip:Haste increased by {$s1=15}%.
  • description:Increases your haste by {$s1=15}% for {$d=10 seconds}.
 
Dimensional Rift 12.9 23.72sec

Stats details: dimensional_rift

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 12.92 0.00 0.00 0.00 1.0153 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: dimensional_rift

Static Values
  • id:196586
  • school:none
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:45.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:charges=3
Spelldata
  • id:196586
  • name:Dimensional Rift
  • school:chaos
  • tooltip:
  • description:Rips a hole in time and space, opening a portal that damages your target.
 
flask 1.0 0.00sec

Stats details: flask

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: flask

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Prydaz
  • harmful:false
  • if_expr:
 
food 1.0 0.00sec

Stats details: food

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: food

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Prydaz
  • harmful:false
  • if_expr:
 
Havoc 14.9 20.94sec

Stats details: havoc

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 14.88 0.00 0.00 0.00 1.0758 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: havoc

Static Values
  • id:80240
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:88000.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:active_enemies>1&(active_enemies<4|talent.wreak_havoc.enabled&active_enemies<6)&!debuff.havoc.remains
Spelldata
  • id:80240
  • name:Havoc
  • school:shadow
  • tooltip:Spells cast by the Warlock also hit this target.
  • description:Marks a target with Havoc for {$d=8 seconds}, causing your single target spells to also strike the Havoc victim. Limit 1.
 
Life Tap 6.6 33.88sec

Stats details: life_tap

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 6.58 0.00 0.00 0.00 1.0500 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: life_tap

Static Values
  • id:1454
  • school:shadow
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:talent.empowered_life_tap.enabled&!buff.empowered_life_tap.remains
Spelldata
  • id:1454
  • name:Life Tap
  • school:shadow
  • tooltip:
  • description:Restores {$s1=30}% of your maximum mana, at the cost of {$s2=10}% of your maximum health.
 
potion 2.0 0.00sec

Stats details: potion

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: potion

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:60.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
 
Grimoire: Imp (service_imp) 3.7 91.33sec

Stats details: service_imp

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 3.69 0.00 0.00 0.00 0.9758 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: service_imp

Static Values
  • id:111859
  • school:shadow
  • resource:soul_shard
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:1.0
  • secondary_cost:0.0
  • cooldown:90.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:111859
  • name:Grimoire: Imp
  • school:shadow
  • tooltip:
  • description:Summons an Imp who attacks the target for {$108501s1=25} sec. Imps cast ranged Firebolts and cleanse a hostile magic effect from their master.
 
Soul Harvest 2.9 120.97sec

Stats details: soul_harvest

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.89 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: soul_harvest

Static Values
  • id:196098
  • school:shadow
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:120.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:196098
  • name:Soul Harvest
  • school:shadow
  • tooltip:Damage increased by {$s1=20}%.
  • description:Increases your damage and your pets' damage by {$s1=20}%. Lasts {$d=15 seconds}, increased by {$s2=2} sec for each target afflicted by your {$?s137043=false}[Agony][]{$?s137044=false}[Doom][]{$?s137046=false}[Immolate][], up to a maximum of {$s3=35} sec.
 
Summon Doomguard 1.0 0.00sec

Stats details: summon_doomguard

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 1.0868 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: summon_doomguard

Static Values
  • id:18540
  • school:shadow
  • resource:soul_shard
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:1.0
  • secondary_cost:0.0
  • cooldown:180.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:talent.grimoire_of_supremacy.enabled&active_enemies=1&artifact.lord_of_flames.rank=0
Spelldata
  • id:18540
  • name:Summon Doomguard
  • school:shadow
  • tooltip:
  • description:Summons a Doomguard for {$60478d=25 seconds} to assault the target with its Doom Bolts.
 
Summon Imp 1.0 0.00sec

Stats details: summon_imp

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: summon_imp

Static Values
  • id:688
  • school:shadow
  • resource:soul_shard
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:1.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:2.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:!talent.grimoire_of_supremacy.enabled&(!talent.grimoire_of_sacrifice.enabled|buff.demonic_power.down)
Spelldata
  • id:688
  • name:Summon Imp
  • school:shadow
  • tooltip:
  • description:Summons an Imp under your command that casts ranged Firebolts.$?s74434[ |cFFFFFFFFSoulburn:|r |cFF8282FFInstant cast.|r][]
 
Summon Infernal 1.0 0.00sec

Stats details: summon_infernal

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.7603 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: summon_infernal

Static Values
  • id:1122
  • school:shadow
  • resource:soul_shard
  • range:30.0
  • travel_speed:1.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:1.0
  • secondary_cost:0.0
  • cooldown:180.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:talent.grimoire_of_supremacy.enabled&artifact.lord_of_flames.rank>0
Spelldata
  • id:1122
  • name:Summon Infernal
  • school:shadow
  • tooltip:
  • description:Summons an Infernal from the Twisting Nether, impacting for {$22703s1=0} Fire damage and stunning all enemy targets in the area for {$22703d=2 seconds}. The Infernal will serve you for {$111685d=25 seconds}, dealing strong area-of-effect damage.
 

Buffs

Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit Overflow Expiry
Accelerando 20.1 0.0 15.4sec 15.4sec 78.41% 78.41% 1.5(1.5) 19.3

Buff details

  • buff initial source:Prydaz
  • cooldown name:buff_accelerando
  • max_stacks:5
  • duration:12.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00

Stat Buff details

  • stat:haste_rating
  • amount:734.41

Stack Uptimes

  • accelerando_1:29.63%
  • accelerando_2:24.53%
  • accelerando_3:14.66%
  • accelerando_4:6.58%
  • accelerando_5:3.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:225719
  • name:Accelerando
  • tooltip:Haste increased by $w1.
  • description:{$@spelldesc225125=Your damaging spells have a chance to grant you {$225719s1=528} Haste for {$225719d=12 seconds}, stacking up to 5 times. Stacking does not refresh duration.}
  • max_stacks:5
  • duration:12.00
  • cooldown:0.00
  • default_chance:101.00%
Berserking 2.1 0.0 180.6sec 180.6sec 6.86% 8.50% 0.0(0.0) 2.0

Buff details

  • buff initial source:Prydaz
  • cooldown name:buff_berserking
  • max_stacks:1
  • duration:10.00
  • cooldown:180.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • berserking_1:6.86%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:26297
  • name:Berserking
  • tooltip:Haste increased by {$s1=15}%.
  • description:Increases your haste by {$s1=15}% for {$d=10 seconds}.
  • max_stacks:0
  • duration:10.00
  • cooldown:180.00
  • default_chance:0.00%
Bloodlust 1.0 0.0 0.0sec 0.0sec 13.55% 13.55% 0.0(0.0) 1.0

Buff details

  • buff initial source:Prydaz
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • duration:40.00
  • cooldown:300.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • bloodlust_1:13.55%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:2825
  • name:Bloodlust
  • tooltip:Haste increased by {$s1=30}%.
  • description:Increases Haste by {$s1=30}% for all party and raid members for {$d=40 seconds}. Allies receiving this effect will become Sated and unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.
  • max_stacks:0
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
Conflagration of Chaos 24.0 0.0 12.4sec 12.4sec 49.16% 46.78% 0.0(0.0) 1.0

Buff details

  • buff initial source:Prydaz
  • cooldown name:buff_conflagration_of_chaos
  • max_stacks:1
  • duration:20.00
  • cooldown:0.00
  • default_chance:50.00%
  • default_value:-0.00

Stack Uptimes

  • conflagration_of_chaos_1:49.16%

Trigger Attempt Success

  • trigger_pct:49.99%

Spelldata details

  • id:196546
  • name:Conflagration of Chaos
  • tooltip:Your {$?s17877=false}[Shadowburn][Conflagrate] will always critically strike. Critical strike chance will increase the critical strike damage of {$?s17877=false}[Shadowburn][Conflagrate].
  • description:{$@spelldesc219195={$?s17877=false}[Shadowburn][Conflagrate] has a chance to guarantee your next {$?s17877=false}[Shadowburn][Conflagrate] critically strikes, and to increase its damage by your critical strike chance.}
  • max_stacks:0
  • duration:20.00
  • cooldown:0.00
  • default_chance:100.00%
Devil's Due 3.5 0.0 70.4sec 70.4sec 8.67% 8.67% 0.0(0.0) 3.2

Buff details

  • buff initial source:Prydaz
  • cooldown name:buff_devils_due
  • max_stacks:1
  • duration:8.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.18

Stack Uptimes

  • devils_due_1:8.67%

Trigger Attempt Success

  • trigger_pct:99.92%

Spelldata details

  • id:225776
  • name:Devil's Due
  • tooltip:Cast speed slowed by {$s1=7}%.
  • description:{$@spelldesc225142=Your damaging spells have a chance to grant Nefarious Pact, increasing your casting speed by {$225774s1=17}% for {$225774d=12 seconds}. When Nefarious Pact expires, your casting speed is decreased by {$225776s1=7}% for {$225776d=8 seconds}.}
  • max_stacks:0
  • duration:8.00
  • cooldown:0.00
  • default_chance:0.00%
Embrace Chaos 33.4 27.9 9.2sec 4.9sec 66.68% 79.33% 27.9(27.9) 32.7

Buff details

  • buff initial source:Prydaz
  • cooldown name:buff_embrace_chaos
  • max_stacks:1
  • duration:4.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • embrace_chaos_1:66.68%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:212019
  • name:Embrace Chaos
  • tooltip:Chaos Bolt has {$s1=40}% reduced cast time.
  • description:{$@spelldesc212018=Casting Chaos Bolt reduces the cast time of your next Chaos Bolt by {$212019s1=40}% for {$212019d=4 seconds}.}
  • max_stacks:0
  • duration:4.00
  • cooldown:0.00
  • default_chance:0.00%
Lord of Flames 1.0 0.0 0.0sec 0.0sec 97.87% 97.87% 0.0(0.0) 0.0

Buff details

  • buff initial source:Prydaz
  • cooldown name:buff_lord_of_flames
  • max_stacks:1
  • duration:600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • lord_of_flames_1:97.87%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:226802
  • name:Lord of Flames
  • tooltip:Recently activated Lord of Flames.
  • description:{$@spelldesc224103=Once every {$s2=10} minutes, {$?s152107=false}[your Infernal's Meteor Strike][Summon Infernal] will summon {$s3=3} additional Infernals to serve you for {$226804d=25 seconds}.}
  • max_stacks:0
  • duration:600.00
  • cooldown:0.00
  • default_chance:0.00%
Nefarious Pact 3.5 0.0 70.7sec 70.0sec 13.48% 13.48% 0.0(0.0) 3.3

Buff details

  • buff initial source:Prydaz
  • cooldown name:buff_nefarious_pact
  • max_stacks:1
  • duration:12.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.44

Stack Uptimes

  • nefarious_pact_1:13.48%

Trigger Attempt Success

  • trigger_pct:99.92%

Spelldata details

  • id:225774
  • name:Nefarious Pact
  • tooltip:Cast speed increased by {$s1=17}%.
  • description:{$@spelldesc225142=Your damaging spells have a chance to grant Nefarious Pact, increasing your casting speed by {$225774s1=17}% for {$225774d=12 seconds}. When Nefarious Pact expires, your casting speed is decreased by {$225776s1=7}% for {$225776d=8 seconds}.}
  • max_stacks:0
  • duration:12.00
  • cooldown:0.00
  • default_chance:0.00%
Potion of Deadly Grace 1.0 0.0 0.0sec 0.0sec 10.16% 10.16% 0.0(0.0) 1.0

Buff details

  • buff initial source:Prydaz
  • cooldown name:buff_potion_of_deadly_grace
  • max_stacks:1
  • duration:30.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • potion_of_deadly_grace_1:10.16%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:188027
  • name:Potion of Deadly Grace
  • tooltip:Your attacks have a chance to unleash a bolt of energy at your target.
  • description:Grants your attacks a chance to unleash a bolt of energy at your target. Staying away from enemies for the entire duration of the effect will extend the effect by an additional 5 seconds.
  • max_stacks:0
  • duration:25.00
  • cooldown:1.00
  • default_chance:101.00%
Potion of Prolonged Power 1.0 0.0 0.0sec 0.0sec 19.64% 19.64% 0.0(0.0) 1.0

Buff details

  • buff initial source:Prydaz
  • cooldown name:buff_potion_of_prolonged_power
  • max_stacks:1
  • duration:60.00
  • cooldown:1.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:all
  • amount:2500.00

Stack Uptimes

  • potion_of_prolonged_power_1:19.64%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:229206
  • name:Potion of Prolonged Power
  • tooltip:All stats increased by {$s1=2500}.
  • description:Drink to increase all stats by {$s1=2500} for {$d=60 seconds}.
  • max_stacks:0
  • duration:60.00
  • cooldown:1.00
  • default_chance:0.00%
Soul Harvest 2.9 0.0 120.9sec 120.9sec 17.78% 17.78% 0.0(0.0) 2.7

Buff details

  • buff initial source:Prydaz
  • cooldown name:buff_soul_harvest
  • max_stacks:1
  • duration:15.00
  • cooldown:120.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • soul_harvest_1:17.78%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:196098
  • name:Soul Harvest
  • tooltip:Damage increased by {$s1=20}%.
  • description:Increases your damage and your pets' damage by {$s1=20}%. Lasts {$d=15 seconds}, increased by {$s2=2} sec for each target afflicted by your {$?s137043=false}[Agony][]{$?s137044=false}[Doom][]{$?s137046=false}[Immolate][], up to a maximum of {$s3=35} sec.
  • max_stacks:0
  • duration:15.00
  • cooldown:120.00
  • default_chance:0.00%
Constant Buffs
Well Fed (azshari_salad)

Buff details

  • buff initial source:Prydaz
  • cooldown name:buff_azshari_salad
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:haste_rating
  • amount:375.00

Stack Uptimes

  • azshari_salad_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:225603
  • name:Well Fed
  • tooltip:Haste increased by $w1.
  • description:Increases haste by {$s1=375} for {$d=3600 seconds}.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Defiled Augmentation

Buff details

  • buff initial source:Prydaz
  • cooldown name:buff_defiled_augmentation
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:agility
  • amount:325.00
  • stat:strength
  • amount:325.00
  • stat:intellect
  • amount:325.00

Stack Uptimes

  • defiled_augmentation_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:224001
  • name:Defiled Augmentation
  • tooltip:Agility, Intellect and Strength increased by $w1.
  • description:Increases Agility, Intellect and Strength by {$s1=325} for {$d=3600 seconds}. Augment Rune.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Flask of the Whispered Pact

Buff details

  • buff initial source:Prydaz
  • cooldown name:buff_flask_of_the_whispered_pact
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:intellect
  • amount:1300.00

Stack Uptimes

  • flask_of_the_whispered_pact_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:188031
  • name:Flask of the Whispered Pact
  • tooltip:Intellect increased by $w1.
  • description:Increases Intellect by {$s1=1300} for {$d=3600 seconds}. Counts as both a Battle and Guardian elixir. This effect persists through death.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:101.00%
Tormented Souls

Buff details

  • buff initial source:Prydaz
  • cooldown name:buff_tormented_souls
  • max_stacks:12
  • duration:0.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00

Stack Uptimes

  • tormented_souls_2:0.38%
  • tormented_souls_3:99.62%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:216695
  • name:Tormented Souls
  • tooltip:Activate Reap Souls to consume all Tormented Souls collected by |cFFFFCC99Ulthalesh|r, increasing your damage by 10% and doubling the effect of all of |cFFFFCC99Ulthalesh|r's other traits for {$216708d=5 seconds} per soul consumed.
  • description:Activate Reap Souls to consume all Tormented Souls collected by |cFFFFCC99Ulthalesh|r, increasing your damage by 10% and doubling the effect of all of |cFFFFCC99Ulthalesh|r's other traits for {$216708d=5 seconds} per soul consumed.
  • max_stacks:12
  • duration:-0.00
  • cooldown:0.00
  • default_chance:101.00%

Procs

Count Interval
shadowy_tear 3.2 70.1sec
flame_rift 3.2 71.1sec
chaos_tear 3.2 70.7sec
chaos_portal 3.2 70.8sec
dimension_ripper 3.8 55.9sec
t19_2pc_chaos_bolt 42.4 6.8sec

Resources

Resource Usage Type Count Total Average RPE APR
Prydaz
chaos_bolt Soul Shard 61.3 122.5 2.0 2.0 984084.8
havoc Mana 14.9 1309874.2 88000.0 88000.3 0.0
immolate Mana 19.9 1311706.3 66000.0 66000.2 71.0
incinerate Mana 74.9 4940479.1 66000.0 65999.0 9.1
service_imp Soul Shard 3.7 3.7 1.0 1.0 0.0
summon_doomguard Soul Shard 1.0 1.0 1.0 1.0 0.0
summon_infernal Soul Shard 1.0 1.0 1.0 1.0 0.0
pet - imp
firebolt Energy 108.1 4323.7 40.0 40.0 3350.8
pet - service_imp
firebolt Energy 48.9 1957.5 40.0 40.0 6843.1
pet - doomguard
doom_bolt Energy 10.8 377.2 35.0 35.0 7124.9
pet - flame_rift
searing_bolt Energy 63.7 63.7 1.0 1.0 369996.4
Resource Gains Type Count Total Average Overflow
life_tap Mana 6.58 2172332.30 (32.44%) 330000.00 0.00 0.00%
immolate Soul Shard 71.44 70.37 (55.19%) 0.99 1.07 1.50%
conflagrate Soul Shard 48.09 47.99 (37.63%) 1.00 0.10 0.21%
mp5_regen Mana 516.58 4523736.27 (67.56%) 8757.07 75010.83 1.63%
soulsnatcher Soul Shard 9.16 9.16 (7.18%) 1.00 0.00 0.00%
pet - imp
energy_regen Energy 1899.03 4157.40 (100.00%) 2.19 21.67 0.52%
pet - service_imp
energy_regen Energy 441.91 1336.38 (100.00%) 3.02 61.99 4.43%
pet - doomguard
energy_regen Energy 15.58 336.07 (100.00%) 21.57 42.75 11.28%
Resource RPS-Gain RPS-Loss
Health 0.00 7179.79
Mana 22245.70 25122.64
Soul Shard 0.42 0.43
Combat End Resource Mean Min Max
Mana 232671.06 5612.83 524055.08
Soul Shard 2.29 0.00 5.00

Benefits & Uptimes

Benefits %
Uptimes %
Mana Cap 1.2%

Statistics & Data Analysis

Fight Length
Sample Data Prydaz Fight Length
Count 9999
Mean 301.01
Minimum 217.68
Maximum 385.07
Spread ( max - min ) 167.39
Range [ ( max - min ) / 2 * 100% ] 27.80%
DPS
Sample Data Prydaz Damage Per Second
Count 9999
Mean 1350762.70
Minimum 1173277.89
Maximum 1629282.97
Spread ( max - min ) 456005.07
Range [ ( max - min ) / 2 * 100% ] 16.88%
Standard Deviation 57856.9812
5th Percentile 1259486.02
95th Percentile 1448249.97
( 95th Percentile - 5th Percentile ) 188763.95
Mean Distribution
Standard Deviation 578.5987
95.00% Confidence Intervall ( 1349628.67 - 1351896.74 )
Normalized 95.00% Confidence Intervall ( 99.92% - 100.08% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 71
0.1% Error 7048
0.1 Scale Factor Error with Delta=300 28575591
0.05 Scale Factor Error with Delta=300 114302361
0.01 Scale Factor Error with Delta=300 2857559016
Priority Target DPS
Sample Data Prydaz Priority Target Damage Per Second
Count 9999
Mean 806180.63
Minimum 673875.59
Maximum 1023312.56
Spread ( max - min ) 349436.97
Range [ ( max - min ) / 2 * 100% ] 21.67%
Standard Deviation 44052.3894
5th Percentile 737909.47
95th Percentile 880500.93
( 95th Percentile - 5th Percentile ) 142591.46
Mean Distribution
Standard Deviation 440.5459
95.00% Confidence Intervall ( 805317.18 - 807044.08 )
Normalized 95.00% Confidence Intervall ( 99.89% - 100.11% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 115
0.1% Error 11471
0.1 Scale Factor Error with Delta=300 16566189
0.05 Scale Factor Error with Delta=300 66264756
0.01 Scale Factor Error with Delta=300 1656618883
DPS(e)
Sample Data Prydaz Damage Per Second (Effective)
Count 9999
Mean 1350762.70
Minimum 1173277.89
Maximum 1629282.97
Spread ( max - min ) 456005.07
Range [ ( max - min ) / 2 * 100% ] 16.88%
Damage
Sample Data Prydaz Damage
Count 9999
Mean 326440335.49
Minimum 226651337.99
Maximum 441439910.99
Spread ( max - min ) 214788572.99
Range [ ( max - min ) / 2 * 100% ] 32.90%
DTPS
Sample Data Prydaz Damage Taken Per Second
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HPS
Sample Data Prydaz Healing Per Second
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
HPS(e)
Sample Data Prydaz Healing Per Second (Effective)
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
Sample Data Prydaz Heal
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
Sample Data Prydaz Healing Taken Per Second
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
TMI
Sample Data Prydaz Theck-Meloree Index
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
ETMI
Sample Data PrydazTheck-Meloree Index (Effective)
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
MSD
Sample Data Prydaz Max Spike Value
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 flask,type=whispered_pact
1 0.00 food,type=azshari_salad
2 0.00 summon_pet,if=!talent.grimoire_of_supremacy.enabled&(!talent.grimoire_of_sacrifice.enabled|buff.demonic_power.down)
3 0.00 summon_infernal,if=talent.grimoire_of_supremacy.enabled&artifact.lord_of_flames.rank>0
4 0.00 summon_infernal,if=talent.grimoire_of_supremacy.enabled&active_enemies>1
5 0.00 summon_doomguard,if=talent.grimoire_of_supremacy.enabled&active_enemies=1&artifact.lord_of_flames.rank=0
6 0.00 augmentation,type=defiled
7 0.00 snapshot_stats
8 0.00 grimoire_of_sacrifice,if=talent.grimoire_of_sacrifice.enabled
9 0.00 life_tap,if=talent.empowered_life_tap.enabled&!buff.empowered_life_tap.remains
A 0.00 potion,name=prolonged_power
B 0.00 chaos_bolt
Default action list Executed every time the actor is available.
# count action,conditions
C 14.88 havoc,target=2,if=active_enemies>1&(active_enemies<4|talent.wreak_havoc.enabled&active_enemies<6)&!debuff.havoc.remains
D 1.00 dimensional_rift,if=charges=3
E 10.31 immolate,if=remains<=tick_time
F 0.63 immolate,cycle_targets=1,if=active_enemies>1&remains<=tick_time&(!talent.roaring_blaze.enabled|(!debuff.roaring_blaze.remains&action.conflagrate.charges<2+set_bonus.tier19_4pc))
G 8.99 immolate,if=talent.roaring_blaze.enabled&remains<=duration&!debuff.roaring_blaze.remains&target.time_to_die>10&(action.conflagrate.charges=2+set_bonus.tier19_4pc|(action.conflagrate.charges>=1+set_bonus.tier19_4pc&action.conflagrate.recharge_time<cast_time+gcd)|target.time_to_die<24)
H 2.06 berserking
0.00 blood_fury
0.00 arcane_torrent
I 1.00 potion,name=deadly_grace,if=(buff.soul_harvest.remains|trinket.proc.any.react|target.time_to_die<=45)
0.00 shadowburn,if=buff.conflagration_of_chaos.remains<=action.chaos_bolt.cast_time
0.00 shadowburn,if=(charges=1+set_bonus.tier19_4pc&recharge_time<action.chaos_bolt.cast_time|charges=2+set_bonus.tier19_4pc)&soul_shard<5
J 13.95 conflagrate,if=talent.roaring_blaze.enabled&(charges=2+set_bonus.tier19_4pc|(charges>=1+set_bonus.tier19_4pc&recharge_time<gcd)|target.time_to_die<24)
K 34.14 conflagrate,if=talent.roaring_blaze.enabled&debuff.roaring_blaze.stack>0&dot.immolate.remains>dot.immolate.duration*0.3&(active_enemies=1|soul_shard<3)&soul_shard<5
0.00 conflagrate,if=!talent.roaring_blaze.enabled&buff.backdraft.stack<3&buff.conflagration_of_chaos.remains<=action.chaos_bolt.cast_time
0.00 conflagrate,if=!talent.roaring_blaze.enabled&buff.backdraft.stack<3&(charges=1+set_bonus.tier19_4pc&recharge_time<action.chaos_bolt.cast_time|charges=2+set_bonus.tier19_4pc)&soul_shard<5
0.00 life_tap,if=talent.empowered_life_tap.enabled&buff.empowered_life_tap.remains<=gcd
0.00 dimensional_rift,if=equipped.144369&!buff.lessons_of_spacetime.remains&((!talent.grimoire_of_supremacy.enabled&!cooldown.summon_doomguard.remains)|(talent.grimoire_of_service.enabled&!cooldown.service_pet.remains)|(talent.soul_harvest.enabled&!cooldown.soul_harvest.remains))
L 3.69 service_pet
M 1.00 summon_infernal,if=artifact.lord_of_flames.rank>0&!buff.lord_of_flames.remains
N 1.00 summon_doomguard,if=!talent.grimoire_of_supremacy.enabled&spell_targets.infernal_awakening<=2&(target.time_to_die>180|target.health.pct<=20|target.time_to_die<30)
0.00 summon_infernal,if=!talent.grimoire_of_supremacy.enabled&spell_targets.infernal_awakening>2
0.00 summon_doomguard,if=talent.grimoire_of_supremacy.enabled&spell_targets.summon_infernal=1&artifact.lord_of_flames.rank>0&buff.lord_of_flames.remains&!pet.doomguard.active
0.00 summon_doomguard,if=talent.grimoire_of_supremacy.enabled&spell_targets.summon_infernal=1&equipped.132379&!cooldown.sindorei_spite_icd.remains
0.00 summon_infernal,if=talent.grimoire_of_supremacy.enabled&spell_targets.summon_infernal>1&equipped.132379&!cooldown.sindorei_spite_icd.remains
O 2.90 soul_harvest
0.00 channel_demonfire,if=dot.immolate.remains>cast_time
0.00 havoc,if=active_enemies=1&talent.wreak_havoc.enabled&equipped.132375&!debuff.havoc.remains
0.00 rain_of_fire,if=active_enemies>=3&cooldown.havoc.remains<=12&!talent.wreak_havoc.enabled
0.00 rain_of_fire,if=active_enemies>=6&talent.wreak_havoc.enabled
P 11.92 dimensional_rift,if=!equipped.144369|charges>1|((!talent.grimoire_of_service.enabled|recharge_time<cooldown.service_pet.remains)&(!talent.soul_harvest.enabled|recharge_time<cooldown.soul_harvest.remains)&(!talent.grimoire_of_supremacy.enabled|recharge_time<cooldown.summon_doomguard.remains))
0.00 life_tap,if=talent.empowered_life_tap.enabled&buff.empowered_life_tap.remains<duration*0.3
0.00 cataclysm
Q 60.59 chaos_bolt,if=(cooldown.havoc.remains>12&cooldown.havoc.remains|active_enemies<3|talent.wreak_havoc.enabled&active_enemies<6)&(set_bonus.tier19_4pc=0|!talent.eradication.enabled|buff.embrace_chaos.remains<=cast_time|soul_shard>=3)
0.00 shadowburn
0.00 conflagrate,if=!talent.roaring_blaze.enabled&buff.backdraft.stack<3
0.00 immolate,if=!talent.roaring_blaze.enabled&remains<=duration*0.3
R 75.18 incinerate
S 6.58 life_tap

Sample Sequence

0126ABCDEGHJKLMKOPPQQKRKQRRRKQCRRQRERQRRRGJKQKRQQKCQRQKPRQRRERRRRCGJKQKQQKQQRRKQRCREQQRPQRLSGJQKCQKKQQRKQRRQRERQCRROIRQJQKRPEQQRJQQCKQKQRSREQRRRRQRSGJQCQJQKQKQKPQHQLREPRCQRRRRQGJKQKQRPQQKRCKQQRREQSRRRPQRRRCJNQRQEJKQQKOQKRCQRSEQRRQRRGJKQCJJLPQQJQQRRJEQCQJ

Sample Sequence Table

time list # name target resources buffs
Pre precombat 0 flask Prydaz 1100000.0/1100000: 100% mana | 3.0/5: 60% soul_shard
Pre precombat 1 food Prydaz 1100000.0/1100000: 100% mana | 3.0/5: 60% soul_shard
Pre precombat 2 summon_imp Fluffy_Pillow 1100000.0/1100000: 100% mana | 3.0/5: 60% soul_shard
Pre precombat 6 augmentation Prydaz 1100000.0/1100000: 100% mana | 3.0/5: 60% soul_shard
Pre precombat A potion Fluffy_Pillow 1100000.0/1100000: 100% mana | 3.0/5: 60% soul_shard potion_of_prolonged_power
0:00.000 precombat B chaos_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 1.0/5: 20% soul_shard embrace_chaos, accelerando, potion_of_prolonged_power
0:00.000 default C havoc enemy2 1100000.0/1100000: 100% mana | 1.0/5: 20% soul_shard embrace_chaos, accelerando, potion_of_prolonged_power
0:01.151 default D dimensional_rift Fluffy_Pillow 1033522.6/1100000: 94% mana | 1.0/5: 20% soul_shard bloodlust, embrace_chaos, accelerando, potion_of_prolonged_power
0:02.039 default E immolate Fluffy_Pillow 1050127.4/1100000: 95% mana | 1.0/5: 20% soul_shard bloodlust, embrace_chaos, accelerando, potion_of_prolonged_power
0:02.926 default G immolate Fluffy_Pillow 1000714.9/1100000: 91% mana | 1.0/5: 20% soul_shard bloodlust, embrace_chaos, accelerando(2), potion_of_prolonged_power
0:03.799 default H berserking Fluffy_Pillow 951283.8/1100000: 86% mana | 1.0/5: 20% soul_shard bloodlust, embrace_chaos, accelerando(2), potion_of_prolonged_power
0:03.799 default J conflagrate Fluffy_Pillow 951283.8/1100000: 86% mana | 1.0/5: 20% soul_shard bloodlust, berserking, embrace_chaos, accelerando(2), potion_of_prolonged_power
0:04.560 default K conflagrate Fluffy_Pillow 967893.6/1100000: 88% mana | 2.0/5: 40% soul_shard bloodlust, berserking, conflagration_of_chaos, accelerando(2), potion_of_prolonged_power
0:05.320 default L service_imp Fluffy_Pillow 984481.5/1100000: 89% mana | 4.0/5: 80% soul_shard bloodlust, berserking, conflagration_of_chaos, accelerando(2), potion_of_prolonged_power
0:06.080 default M summon_infernal Fluffy_Pillow 1001069.5/1100000: 91% mana | 3.0/5: 60% soul_shard bloodlust, berserking, conflagration_of_chaos, accelerando(2), potion_of_prolonged_power
0:06.841 default K conflagrate Fluffy_Pillow 1017924.2/1100000: 93% mana | 2.0/5: 40% soul_shard bloodlust, berserking, lord_of_flames, conflagration_of_chaos, accelerando(3), potion_of_prolonged_power
0:07.597 default O soul_harvest Fluffy_Pillow 1034668.2/1100000: 94% mana | 3.0/5: 60% soul_shard bloodlust, berserking, lord_of_flames, accelerando(3), potion_of_prolonged_power
0:07.597 default P dimensional_rift Fluffy_Pillow 1034668.2/1100000: 94% mana | 3.0/5: 60% soul_shard bloodlust, berserking, soul_harvest, lord_of_flames, accelerando(3), potion_of_prolonged_power
0:08.351 default P dimensional_rift Fluffy_Pillow 1051367.9/1100000: 96% mana | 4.0/5: 80% soul_shard bloodlust, berserking, soul_harvest, lord_of_flames, accelerando(3), potion_of_prolonged_power
0:09.106 default Q chaos_bolt Fluffy_Pillow 1068089.7/1100000: 97% mana | 4.0/5: 80% soul_shard bloodlust, berserking, soul_harvest, lord_of_flames, accelerando(3), potion_of_prolonged_power
0:10.599 default Q chaos_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 3.0/5: 60% soul_shard bloodlust, berserking, soul_harvest, lord_of_flames, embrace_chaos, accelerando(3), potion_of_prolonged_power
0:11.496 default K conflagrate Fluffy_Pillow 1100000.0/1100000: 100% mana | 1.0/5: 20% soul_shard bloodlust, berserking, soul_harvest, lord_of_flames, embrace_chaos, accelerando(4), potion_of_prolonged_power
0:12.251 default R incinerate Fluffy_Pillow 1100000.0/1100000: 100% mana | 2.0/5: 40% soul_shard bloodlust, berserking, soul_harvest, lord_of_flames, conflagration_of_chaos, embrace_chaos, potion_of_prolonged_power
0:13.231 default K conflagrate Fluffy_Pillow 1034086.0/1100000: 94% mana | 2.0/5: 40% soul_shard bloodlust, berserking, soul_harvest, lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando, potion_of_prolonged_power
0:14.001 default Q chaos_bolt Fluffy_Pillow 1050163.1/1100000: 95% mana | 3.0/5: 60% soul_shard bloodlust, soul_harvest, lord_of_flames, embrace_chaos, accelerando(2), potion_of_prolonged_power
0:15.046 default R incinerate Fluffy_Pillow 1069997.3/1100000: 97% mana | 2.0/5: 40% soul_shard bloodlust, soul_harvest, lord_of_flames, embrace_chaos, accelerando(3), potion_of_prolonged_power
0:16.123 default R incinerate Fluffy_Pillow 1024739.5/1100000: 93% mana | 2.0/5: 40% soul_shard bloodlust, soul_harvest, lord_of_flames, embrace_chaos, accelerando(3), potion_of_prolonged_power
0:17.198 default R incinerate Fluffy_Pillow 979517.5/1100000: 89% mana | 2.0/5: 40% soul_shard bloodlust, soul_harvest, lord_of_flames, embrace_chaos, accelerando(4), potion_of_prolonged_power
0:18.261 default K conflagrate Fluffy_Pillow 934289.4/1100000: 85% mana | 2.0/5: 40% soul_shard bloodlust, soul_harvest, lord_of_flames, embrace_chaos, accelerando(5), potion_of_prolonged_power
0:19.097 default Q chaos_bolt Fluffy_Pillow 950858.4/1100000: 86% mana | 3.0/5: 60% soul_shard bloodlust, soul_harvest, lord_of_flames, conflagration_of_chaos, accelerando(5), potion_of_prolonged_power
0:20.767 default C havoc enemy2 983956.9/1100000: 89% mana | 2.0/5: 40% soul_shard bloodlust, soul_harvest, lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(5), potion_of_prolonged_power
0:21.605 default R incinerate Fluffy_Pillow 912565.5/1100000: 83% mana | 2.0/5: 40% soul_shard bloodlust, soul_harvest, lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(5), potion_of_prolonged_power
0:22.652 default R incinerate Fluffy_Pillow 867316.5/1100000: 79% mana | 2.0/5: 40% soul_shard bloodlust, soul_harvest, lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(5), potion_of_prolonged_power
0:23.701 default Q chaos_bolt Fluffy_Pillow 822107.0/1100000: 75% mana | 3.0/5: 60% soul_shard bloodlust, soul_harvest, lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(5), potion_of_prolonged_power
0:24.705 default R incinerate Fluffy_Pillow 842005.7/1100000: 77% mana | 1.0/5: 20% soul_shard bloodlust, soul_harvest, lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(5), potion_of_prolonged_power
0:25.754 default E immolate Fluffy_Pillow 795873.5/1100000: 72% mana | 2.0/5: 40% soul_shard bloodlust, soul_harvest, lord_of_flames, conflagration_of_chaos, embrace_chaos, potion_of_prolonged_power
0:26.652 default R incinerate Fluffy_Pillow 746413.9/1100000: 68% mana | 2.0/5: 40% soul_shard bloodlust, lord_of_flames, conflagration_of_chaos, embrace_chaos, potion_of_prolonged_power
0:27.777 default Q chaos_bolt Fluffy_Pillow 701135.5/1100000: 64% mana | 2.0/5: 40% soul_shard bloodlust, lord_of_flames, conflagration_of_chaos, embrace_chaos, potion_of_prolonged_power
0:28.856 default R incinerate Fluffy_Pillow 721011.2/1100000: 66% mana | 1.0/5: 20% soul_shard bloodlust, lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando, potion_of_prolonged_power
0:29.966 default R incinerate Fluffy_Pillow 675768.5/1100000: 61% mana | 1.0/5: 20% soul_shard bloodlust, lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(2), potion_of_prolonged_power
0:31.060 default R incinerate Fluffy_Pillow 630646.7/1100000: 57% mana | 1.0/5: 20% soul_shard bloodlust, lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(3), potion_of_prolonged_power
0:32.138 default G immolate Fluffy_Pillow 585408.2/1100000: 53% mana | 1.0/5: 20% soul_shard bloodlust, lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(3), potion_of_prolonged_power
0:33.000 default J conflagrate Fluffy_Pillow 536009.6/1100000: 49% mana | 1.0/5: 20% soul_shard bloodlust, lord_of_flames, conflagration_of_chaos, accelerando(3), potion_of_prolonged_power
0:33.860 default K conflagrate Fluffy_Pillow 552572.6/1100000: 50% mana | 2.0/5: 40% soul_shard bloodlust, lord_of_flames, conflagration_of_chaos, accelerando(3), potion_of_prolonged_power
0:34.722 default Q chaos_bolt Fluffy_Pillow 569174.0/1100000: 52% mana | 3.0/5: 60% soul_shard bloodlust, lord_of_flames, accelerando(3), potion_of_prolonged_power
0:36.440 default K conflagrate Fluffy_Pillow 602444.7/1100000: 55% mana | 1.0/5: 20% soul_shard bloodlust, lord_of_flames, embrace_chaos, accelerando(5), potion_of_prolonged_power
0:37.276 default R incinerate Fluffy_Pillow 619013.7/1100000: 56% mana | 2.0/5: 40% soul_shard bloodlust, lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(5), potion_of_prolonged_power
0:38.325 default Q chaos_bolt Fluffy_Pillow 573804.3/1100000: 52% mana | 3.0/5: 60% soul_shard bloodlust, lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(5), potion_of_prolonged_power
0:39.329 default Q chaos_bolt Fluffy_Pillow 593703.0/1100000: 54% mana | 3.0/5: 60% soul_shard bloodlust, lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(5), potion_of_prolonged_power
0:40.334 default K conflagrate Fluffy_Pillow 613621.5/1100000: 56% mana | 2.0/5: 40% soul_shard bloodlust, lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(5), potion_of_prolonged_power
0:41.169 default C havoc enemy2 628373.8/1100000: 57% mana | 3.0/5: 60% soul_shard lord_of_flames, embrace_chaos, potion_of_prolonged_power
0:42.336 default Q chaos_bolt Fluffy_Pillow 556908.5/1100000: 51% mana | 3.0/5: 60% soul_shard lord_of_flames, embrace_chaos, potion_of_prolonged_power
0:43.737 default R incinerate Fluffy_Pillow 577025.7/1100000: 52% mana | 2.0/5: 40% soul_shard lord_of_flames, embrace_chaos, accelerando, potion_of_prolonged_power
0:45.178 default Q chaos_bolt Fluffy_Pillow 531752.9/1100000: 48% mana | 3.0/5: 60% soul_shard lord_of_flames, embrace_chaos, accelerando, potion_of_prolonged_power
0:46.559 default K conflagrate Fluffy_Pillow 551617.0/1100000: 50% mana | 1.0/5: 20% soul_shard lord_of_flames, embrace_chaos, accelerando, potion_of_prolonged_power
0:47.711 default P dimensional_rift Fluffy_Pillow 568187.3/1100000: 52% mana | 2.0/5: 40% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando, potion_of_prolonged_power
0:48.862 default R incinerate Fluffy_Pillow 584743.1/1100000: 53% mana | 2.0/5: 40% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando, potion_of_prolonged_power
0:50.303 default Q chaos_bolt Fluffy_Pillow 539471.2/1100000: 49% mana | 2.0/5: 40% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(2), potion_of_prolonged_power
0:51.666 default R incinerate Fluffy_Pillow 559371.8/1100000: 51% mana | 0.0/5: 0% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(3), potion_of_prolonged_power
0:53.065 default R incinerate Fluffy_Pillow 514097.7/1100000: 47% mana | 0.0/5: 0% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(3), potion_of_prolonged_power
0:54.465 default E immolate Fluffy_Pillow 468838.4/1100000: 43% mana | 0.0/5: 0% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(3), potion_of_prolonged_power
0:55.582 default R incinerate Fluffy_Pillow 418685.4/1100000: 38% mana | 0.0/5: 0% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, potion_of_prolonged_power
0:57.045 default R incinerate Fluffy_Pillow 373414.1/1100000: 34% mana | 0.0/5: 0% soul_shard lord_of_flames, conflagration_of_chaos, potion_of_prolonged_power
0:58.508 default R incinerate Fluffy_Pillow 328142.7/1100000: 30% mana | 0.0/5: 0% soul_shard lord_of_flames, conflagration_of_chaos
0:59.971 default R incinerate Fluffy_Pillow 282872.2/1100000: 26% mana | 0.0/5: 0% soul_shard lord_of_flames, conflagration_of_chaos, accelerando
1:01.413 default C havoc enemy2 237614.9/1100000: 22% mana | 0.0/5: 0% soul_shard lord_of_flames, conflagration_of_chaos, accelerando(2)
1:02.547 default G immolate Fluffy_Pillow 166170.7/1100000: 15% mana | 0.0/5: 0% soul_shard lord_of_flames, conflagration_of_chaos, accelerando(2)
1:03.682 default J conflagrate Fluffy_Pillow 116741.1/1100000: 11% mana | 1.0/5: 20% soul_shard lord_of_flames, conflagration_of_chaos, accelerando(2)
1:04.815 default K conflagrate Fluffy_Pillow 133282.3/1100000: 12% mana | 2.0/5: 40% soul_shard lord_of_flames, accelerando(2)
1:05.951 default Q chaos_bolt Fluffy_Pillow 149867.4/1100000: 14% mana | 4.0/5: 80% soul_shard lord_of_flames, accelerando(2)
1:08.214 default K conflagrate Fluffy_Pillow 183038.0/1100000: 17% mana | 2.0/5: 40% soul_shard lord_of_flames, embrace_chaos, accelerando(3)
1:09.331 default Q chaos_bolt Fluffy_Pillow 199586.1/1100000: 18% mana | 3.0/5: 60% soul_shard lord_of_flames, embrace_chaos, accelerando(3)
1:10.673 default Q chaos_bolt Fluffy_Pillow 219467.6/1100000: 20% mana | 3.0/5: 60% soul_shard lord_of_flames, embrace_chaos, accelerando(3)
1:12.013 default K conflagrate Fluffy_Pillow 239290.6/1100000: 22% mana | 1.0/5: 20% soul_shard lord_of_flames, embrace_chaos, accelerando
1:13.168 default Q chaos_bolt Fluffy_Pillow 255904.0/1100000: 23% mana | 3.0/5: 60% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando
1:14.550 default Q chaos_bolt Fluffy_Pillow 275791.3/1100000: 25% mana | 4.0/5: 80% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(2)
1:15.910 default R incinerate Fluffy_Pillow 295646.6/1100000: 27% mana | 2.0/5: 40% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(2)
1:17.330 default R incinerate Fluffy_Pillow 250378.8/1100000: 23% mana | 2.0/5: 40% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(3)
1:18.730 default K conflagrate Fluffy_Pillow 205120.6/1100000: 19% mana | 2.0/5: 40% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(4)
1:19.832 default Q chaos_bolt Fluffy_Pillow 221684.1/1100000: 20% mana | 3.0/5: 60% soul_shard lord_of_flames, embrace_chaos, accelerando(4)
1:21.153 default R incinerate Fluffy_Pillow 241544.0/1100000: 22% mana | 1.0/5: 20% soul_shard lord_of_flames, embrace_chaos, accelerando(5)
1:22.514 default C havoc enemy2 196293.4/1100000: 18% mana | 1.0/5: 20% soul_shard lord_of_flames, embrace_chaos, accelerando(5)
1:23.601 default R incinerate Fluffy_Pillow 124865.5/1100000: 11% mana | 2.0/5: 40% soul_shard lord_of_flames, embrace_chaos, accelerando(5)
1:24.963 default E immolate Fluffy_Pillow 78602.6/1100000: 7% mana | 2.0/5: 40% soul_shard lord_of_flames, embrace_chaos
1:26.133 default Q chaos_bolt Fluffy_Pillow 29179.8/1100000: 3% mana | 3.0/5: 60% soul_shard lord_of_flames
1:28.466 default Q chaos_bolt Fluffy_Pillow 62534.2/1100000: 6% mana | 3.0/5: 60% soul_shard lord_of_flames, embrace_chaos, accelerando
1:29.846 default R incinerate Fluffy_Pillow 82486.4/1100000: 7% mana | 2.0/5: 40% soul_shard lord_of_flames, embrace_chaos, accelerando(2)
1:31.267 default P dimensional_rift Fluffy_Pillow 37232.2/1100000: 3% mana | 2.0/5: 40% soul_shard lord_of_flames, embrace_chaos, accelerando(2)
1:32.402 default Q chaos_bolt Fluffy_Pillow 53802.7/1100000: 5% mana | 3.0/5: 60% soul_shard lord_of_flames, embrace_chaos, accelerando(2)
1:33.761 default R incinerate Fluffy_Pillow 73644.0/1100000: 7% mana | 1.0/5: 20% soul_shard lord_of_flames, embrace_chaos, accelerando(3)
1:35.161 default L service_imp Fluffy_Pillow 28384.7/1100000: 3% mana | 1.0/5: 20% soul_shard lord_of_flames, embrace_chaos, accelerando(3)
1:36.438 default S life_tap Fluffy_Pillow 47364.9/1100000: 4% mana | 1.0/5: 20% soul_shard lord_of_flames, embrace_chaos, accelerando(4)
1:37.540 default G immolate Fluffy_Pillow 393928.4/1100000: 36% mana | 1.0/5: 20% soul_shard lord_of_flames, embrace_chaos, accelerando(4)
1:38.642 default J conflagrate Fluffy_Pillow 344493.0/1100000: 31% mana | 2.0/5: 40% soul_shard lord_of_flames, accelerando(5)
1:39.729 default Q chaos_bolt Fluffy_Pillow 360362.8/1100000: 33% mana | 3.0/5: 60% soul_shard lord_of_flames, conflagration_of_chaos
1:42.063 default K conflagrate Fluffy_Pillow 393432.3/1100000: 36% mana | 2.0/5: 40% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos
1:43.229 default C havoc enemy2 409952.8/1100000: 37% mana | 3.0/5: 60% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos
1:44.397 default Q chaos_bolt Fluffy_Pillow 338501.7/1100000: 31% mana | 3.0/5: 60% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos
1:45.799 default K conflagrate Fluffy_Pillow 358366.1/1100000: 33% mana | 1.0/5: 20% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos
1:46.968 default K conflagrate Fluffy_Pillow 374929.2/1100000: 34% mana | 2.0/5: 40% soul_shard lord_of_flames, embrace_chaos
1:48.136 default Q chaos_bolt Fluffy_Pillow 391729.6/1100000: 36% mana | 4.0/5: 80% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando
1:49.517 default Q chaos_bolt Fluffy_Pillow 411857.4/1100000: 37% mana | 3.0/5: 60% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(2)
1:50.878 default R incinerate Fluffy_Pillow 431727.3/1100000: 39% mana | 1.0/5: 20% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(2)
1:52.296 default K conflagrate Fluffy_Pillow 386429.4/1100000: 35% mana | 2.0/5: 40% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(2)
1:53.433 default Q chaos_bolt Fluffy_Pillow 403041.9/1100000: 37% mana | 3.0/5: 60% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(3)
1:54.773 default R incinerate Fluffy_Pillow 422893.8/1100000: 38% mana | 2.0/5: 40% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(3)
1:56.172 default R incinerate Fluffy_Pillow 377620.5/1100000: 34% mana | 2.0/5: 40% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(4)
1:57.553 default Q chaos_bolt Fluffy_Pillow 332377.5/1100000: 30% mana | 2.0/5: 40% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(4)
1:58.875 default R incinerate Fluffy_Pillow 352271.2/1100000: 32% mana | 2.0/5: 40% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(5)
2:00.237 default E immolate Fluffy_Pillow 305669.0/1100000: 28% mana | 2.0/5: 40% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos
2:01.405 default R incinerate Fluffy_Pillow 256217.9/1100000: 23% mana | 2.0/5: 40% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos
2:02.868 default Q chaos_bolt Fluffy_Pillow 210946.5/1100000: 19% mana | 2.0/5: 40% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos
2:04.269 default C havoc enemy2 230796.7/1100000: 21% mana | 0.0/5: 0% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos
2:05.437 default R incinerate Fluffy_Pillow 159345.6/1100000: 14% mana | 1.0/5: 20% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos
2:06.903 default R incinerate Fluffy_Pillow 114161.5/1100000: 10% mana | 1.0/5: 20% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando
2:08.346 default O soul_harvest Fluffy_Pillow 68917.5/1100000: 6% mana | 1.0/5: 20% soul_shard lord_of_flames, conflagration_of_chaos, accelerando
2:08.346 default I potion Fluffy_Pillow 68917.5/1100000: 6% mana | 1.0/5: 20% soul_shard soul_harvest, lord_of_flames, conflagration_of_chaos, accelerando
2:08.346 default R incinerate Fluffy_Pillow 68917.5/1100000: 6% mana | 1.0/5: 20% soul_shard soul_harvest, lord_of_flames, conflagration_of_chaos, accelerando, potion_of_deadly_grace
2:09.787 default Q chaos_bolt Fluffy_Pillow 23644.7/1100000: 2% mana | 2.0/5: 40% soul_shard soul_harvest, lord_of_flames, conflagration_of_chaos, accelerando, potion_of_deadly_grace
2:12.086 default J conflagrate Fluffy_Pillow 56886.4/1100000: 5% mana | 2.0/5: 40% soul_shard soul_harvest, lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(2), potion_of_deadly_grace
2:13.219 default Q chaos_bolt Fluffy_Pillow 73427.6/1100000: 7% mana | 3.0/5: 60% soul_shard soul_harvest, lord_of_flames, embrace_chaos, accelerando(2), potion_of_deadly_grace
2:14.579 default K conflagrate Fluffy_Pillow 93498.7/1100000: 8% mana | 1.0/5: 20% soul_shard soul_harvest, lord_of_flames, embrace_chaos, accelerando(3), potion_of_deadly_grace
2:15.697 default R incinerate Fluffy_Pillow 110061.6/1100000: 10% mana | 2.0/5: 40% soul_shard soul_harvest, lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(3), potion_of_deadly_grace
2:17.097 default P dimensional_rift Fluffy_Pillow 64802.3/1100000: 6% mana | 3.0/5: 60% soul_shard soul_harvest, lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(3), potion_of_deadly_grace
2:18.214 default E immolate Fluffy_Pillow 81389.7/1100000: 7% mana | 4.0/5: 80% soul_shard soul_harvest, lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(4), potion_of_deadly_grace
2:19.315 default Q chaos_bolt Fluffy_Pillow 31403.8/1100000: 3% mana | 4.0/5: 80% soul_shard soul_harvest, lord_of_flames, conflagration_of_chaos, potion_of_deadly_grace
2:21.649 default Q chaos_bolt Fluffy_Pillow 64474.4/1100000: 6% mana | 3.0/5: 60% soul_shard soul_harvest, lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando, potion_of_deadly_grace
2:23.028 default R incinerate Fluffy_Pillow 84309.8/1100000: 8% mana | 1.0/5: 20% soul_shard soul_harvest, lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando, potion_of_deadly_grace
2:24.469 default J conflagrate Fluffy_Pillow 39037.0/1100000: 4% mana | 1.0/5: 20% soul_shard soul_harvest, lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando, potion_of_deadly_grace
2:25.621 default Q chaos_bolt Fluffy_Pillow 55814.4/1100000: 5% mana | 3.0/5: 60% soul_shard soul_harvest, lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(2), potion_of_deadly_grace
2:26.980 default Q chaos_bolt Fluffy_Pillow 75655.1/1100000: 7% mana | 3.0/5: 60% soul_shard soul_harvest, lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(2), potion_of_deadly_grace
2:28.341 default C havoc enemy2 95525.0/1100000: 9% mana | 1.0/5: 20% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(2), potion_of_deadly_grace
2:29.475 default K conflagrate Fluffy_Pillow 24080.9/1100000: 2% mana | 2.0/5: 40% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(2), potion_of_deadly_grace
2:30.610 default Q chaos_bolt Fluffy_Pillow 40651.3/1100000: 4% mana | 3.0/5: 60% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(2), potion_of_deadly_grace
2:31.971 default K conflagrate Fluffy_Pillow 60521.2/1100000: 6% mana | 2.0/5: 40% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, nefarious_pact, accelerando(2), potion_of_deadly_grace
2:32.759 default Q chaos_bolt Fluffy_Pillow 72025.6/1100000: 7% mana | 3.0/5: 60% soul_shard lord_of_flames, embrace_chaos, nefarious_pact, accelerando(2), potion_of_deadly_grace
2:33.704 default R incinerate Fluffy_Pillow 85796.3/1100000: 8% mana | 2.0/5: 40% soul_shard lord_of_flames, embrace_chaos, nefarious_pact, potion_of_deadly_grace
2:34.721 default S life_tap Fluffy_Pillow 34260.6/1100000: 3% mana | 2.0/5: 40% soul_shard lord_of_flames, embrace_chaos, nefarious_pact, accelerando, potion_of_deadly_grace
2:35.520 default R incinerate Fluffy_Pillow 375753.4/1100000: 34% mana | 2.0/5: 40% soul_shard lord_of_flames, embrace_chaos, nefarious_pact, accelerando, potion_of_deadly_grace
2:36.520 default E immolate Fluffy_Pillow 324137.2/1100000: 29% mana | 2.0/5: 40% soul_shard lord_of_flames, embrace_chaos, nefarious_pact, accelerando, potion_of_deadly_grace
2:37.320 default Q chaos_bolt Fluffy_Pillow 269644.4/1100000: 25% mana | 2.0/5: 40% soul_shard lord_of_flames, embrace_chaos, nefarious_pact, accelerando, potion_of_deadly_grace
2:38.278 default R incinerate Fluffy_Pillow 283530.6/1100000: 26% mana | 1.0/5: 20% soul_shard lord_of_flames, embrace_chaos, nefarious_pact, accelerando(2), potion_of_deadly_grace
2:39.263 default R incinerate Fluffy_Pillow 231911.1/1100000: 21% mana | 1.0/5: 20% soul_shard lord_of_flames, embrace_chaos, nefarious_pact, accelerando(2)
2:40.249 default R incinerate Fluffy_Pillow 180307.3/1100000: 16% mana | 1.0/5: 20% soul_shard lord_of_flames, embrace_chaos, nefarious_pact, accelerando(3)
2:41.220 default R incinerate Fluffy_Pillow 128692.5/1100000: 12% mana | 2.0/5: 40% soul_shard lord_of_flames, embrace_chaos, nefarious_pact, accelerando(3)
2:42.191 default Q chaos_bolt Fluffy_Pillow 77077.7/1100000: 7% mana | 2.0/5: 40% soul_shard lord_of_flames, embrace_chaos, nefarious_pact, accelerando(3)
2:43.120 default R incinerate Fluffy_Pillow 90840.6/1100000: 8% mana | 1.0/5: 20% soul_shard lord_of_flames, embrace_chaos, nefarious_pact, accelerando(3)
2:44.090 default S life_tap Fluffy_Pillow 39211.0/1100000: 4% mana | 1.0/5: 20% soul_shard lord_of_flames, embrace_chaos, devils_due, accelerando(3)
2:45.406 default G immolate Fluffy_Pillow 388707.2/1100000: 35% mana | 2.0/5: 40% soul_shard lord_of_flames, embrace_chaos, devils_due, accelerando(3)
2:46.723 default J conflagrate Fluffy_Pillow 342052.3/1100000: 31% mana | 3.0/5: 60% soul_shard lord_of_flames, embrace_chaos, devils_due
2:48.099 default Q chaos_bolt Fluffy_Pillow 361810.9/1100000: 33% mana | 4.0/5: 80% soul_shard lord_of_flames, devils_due, accelerando
2:50.805 default C havoc enemy2 400733.7/1100000: 36% mana | 3.0/5: 60% soul_shard lord_of_flames, embrace_chaos, devils_due, accelerando
2:52.160 default Q chaos_bolt Fluffy_Pillow 332223.9/1100000: 30% mana | 3.0/5: 60% soul_shard lord_of_flames, embrace_chaos, accelerando
2:53.540 default J conflagrate Fluffy_Pillow 352073.7/1100000: 32% mana | 2.0/5: 40% soul_shard lord_of_flames, embrace_chaos, accelerando
2:54.691 default Q chaos_bolt Fluffy_Pillow 368629.5/1100000: 34% mana | 4.0/5: 80% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando
2:56.071 default K conflagrate Fluffy_Pillow 388486.8/1100000: 35% mana | 2.0/5: 40% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(2)
2:57.206 default Q chaos_bolt Fluffy_Pillow 405057.3/1100000: 37% mana | 4.0/5: 80% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(2)
2:58.566 default K conflagrate Fluffy_Pillow 424912.6/1100000: 39% mana | 2.0/5: 40% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(2)
2:59.699 default Q chaos_bolt Fluffy_Pillow 441100.5/1100000: 40% mana | 4.0/5: 80% soul_shard lord_of_flames, embrace_chaos
3:01.101 default K conflagrate Fluffy_Pillow 460964.8/1100000: 42% mana | 2.0/5: 40% soul_shard lord_of_flames, embrace_chaos
3:02.269 default P dimensional_rift Fluffy_Pillow 477728.2/1100000: 43% mana | 4.0/5: 80% soul_shard lord_of_flames, embrace_chaos, accelerando
3:03.421 default Q chaos_bolt Fluffy_Pillow 494298.4/1100000: 45% mana | 4.0/5: 80% soul_shard lord_of_flames, embrace_chaos, accelerando
3:04.802 default H berserking Fluffy_Pillow 514163.7/1100000: 47% mana | 3.0/5: 60% soul_shard lord_of_flames, embrace_chaos, accelerando(2)
3:04.802 default Q chaos_bolt Fluffy_Pillow 514163.7/1100000: 47% mana | 3.0/5: 60% soul_shard berserking, lord_of_flames, embrace_chaos, accelerando(2)
3:05.986 default L service_imp Fluffy_Pillow 534042.3/1100000: 49% mana | 1.0/5: 20% soul_shard berserking, lord_of_flames, embrace_chaos, accelerando(2)
3:06.972 default R incinerate Fluffy_Pillow 550596.7/1100000: 50% mana | 0.0/5: 0% soul_shard berserking, lord_of_flames, embrace_chaos, accelerando(2)
3:08.208 default E immolate Fluffy_Pillow 505574.0/1100000: 46% mana | 0.0/5: 0% soul_shard berserking, lord_of_flames, embrace_chaos, accelerando(3)
3:09.180 default P dimensional_rift Fluffy_Pillow 456134.0/1100000: 41% mana | 0.0/5: 0% soul_shard berserking, lord_of_flames, embrace_chaos, accelerando(3)
3:10.153 default R incinerate Fluffy_Pillow 472711.0/1100000: 43% mana | 1.0/5: 20% soul_shard berserking, lord_of_flames, accelerando(3)
3:11.372 default C havoc enemy2 427479.1/1100000: 39% mana | 1.0/5: 20% soul_shard berserking, lord_of_flames, nefarious_pact, accelerando(3)
3:12.125 default Q chaos_bolt Fluffy_Pillow 352308.0/1100000: 32% mana | 2.0/5: 40% soul_shard berserking, lord_of_flames, nefarious_pact, accelerando(3)
3:13.470 default R incinerate Fluffy_Pillow 375125.5/1100000: 34% mana | 1.0/5: 20% soul_shard berserking, lord_of_flames, embrace_chaos, nefarious_pact
3:14.354 default R incinerate Fluffy_Pillow 323529.3/1100000: 29% mana | 1.0/5: 20% soul_shard berserking, lord_of_flames, embrace_chaos, nefarious_pact
3:15.237 default R incinerate Fluffy_Pillow 270992.3/1100000: 25% mana | 1.0/5: 20% soul_shard lord_of_flames, embrace_chaos, nefarious_pact
3:16.254 default R incinerate Fluffy_Pillow 219401.7/1100000: 20% mana | 2.0/5: 40% soul_shard lord_of_flames, embrace_chaos, nefarious_pact
3:17.269 default Q chaos_bolt Fluffy_Pillow 167782.8/1100000: 15% mana | 2.0/5: 40% soul_shard lord_of_flames, embrace_chaos, nefarious_pact
3:18.239 default G immolate Fluffy_Pillow 181527.0/1100000: 17% mana | 0.0/5: 0% soul_shard lord_of_flames, embrace_chaos, nefarious_pact, accelerando
3:19.039 default J conflagrate Fluffy_Pillow 127035.4/1100000: 12% mana | 0.0/5: 0% soul_shard lord_of_flames, embrace_chaos, nefarious_pact, accelerando(2)
3:19.826 default K conflagrate Fluffy_Pillow 138525.2/1100000: 13% mana | 2.0/5: 40% soul_shard lord_of_flames, embrace_chaos, nefarious_pact, accelerando(2)
3:20.612 default Q chaos_bolt Fluffy_Pillow 150169.6/1100000: 14% mana | 4.0/5: 80% soul_shard lord_of_flames, embrace_chaos, nefarious_pact, accelerando(3)
3:21.542 default K conflagrate Fluffy_Pillow 163947.4/1100000: 15% mana | 2.0/5: 40% soul_shard lord_of_flames, embrace_chaos, nefarious_pact, accelerando(3)
3:22.319 default Q chaos_bolt Fluffy_Pillow 175458.5/1100000: 16% mana | 3.0/5: 60% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, nefarious_pact, accelerando(3)
3:23.248 default R incinerate Fluffy_Pillow 189221.4/1100000: 17% mana | 2.0/5: 40% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, nefarious_pact, accelerando(3)
3:24.220 default P dimensional_rift Fluffy_Pillow 137621.4/1100000: 13% mana | 3.0/5: 60% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, devils_due, accelerando(3)
3:25.537 default Q chaos_bolt Fluffy_Pillow 157132.5/1100000: 14% mana | 3.0/5: 60% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, devils_due, accelerando(3)
3:27.116 default Q chaos_bolt Fluffy_Pillow 180525.1/1100000: 16% mana | 3.0/5: 60% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, devils_due, accelerando(3)
3:28.693 default K conflagrate Fluffy_Pillow 203888.7/1100000: 19% mana | 1.0/5: 20% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, devils_due, accelerando(4)
3:29.988 default R incinerate Fluffy_Pillow 223353.0/1100000: 20% mana | 2.0/5: 40% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, devils_due, accelerando(4)
3:31.613 default C havoc enemy2 180590.7/1100000: 16% mana | 2.0/5: 40% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos
3:32.782 default K conflagrate Fluffy_Pillow 109153.8/1100000: 10% mana | 2.0/5: 40% soul_shard lord_of_flames, conflagration_of_chaos
3:33.950 default Q chaos_bolt Fluffy_Pillow 125702.7/1100000: 11% mana | 4.0/5: 80% soul_shard lord_of_flames, conflagration_of_chaos
3:36.284 default Q chaos_bolt Fluffy_Pillow 158792.2/1100000: 14% mana | 3.0/5: 60% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando
3:37.664 default R incinerate Fluffy_Pillow 178642.9/1100000: 16% mana | 1.0/5: 20% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(2)
3:39.085 default R incinerate Fluffy_Pillow 133388.7/1100000: 12% mana | 1.0/5: 20% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(2)
3:40.507 default E immolate Fluffy_Pillow 88223.9/1100000: 8% mana | 1.0/5: 20% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(3)
3:41.624 default Q chaos_bolt Fluffy_Pillow 38772.1/1100000: 4% mana | 3.0/5: 60% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(3)
3:42.965 default S life_tap Fluffy_Pillow 58638.7/1100000: 5% mana | 1.0/5: 20% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, nefarious_pact, accelerando(3)
3:43.743 default R incinerate Fluffy_Pillow 400164.6/1100000: 36% mana | 1.0/5: 20% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, nefarious_pact, accelerando(3)
3:44.715 default R incinerate Fluffy_Pillow 348564.6/1100000: 32% mana | 1.0/5: 20% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, nefarious_pact, accelerando(3)
3:45.688 default R incinerate Fluffy_Pillow 296979.4/1100000: 27% mana | 1.0/5: 20% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, nefarious_pact, accelerando(3)
3:46.660 default P dimensional_rift Fluffy_Pillow 245379.4/1100000: 22% mana | 1.0/5: 20% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, nefarious_pact, accelerando(3)
3:47.436 default Q chaos_bolt Fluffy_Pillow 256875.7/1100000: 23% mana | 2.0/5: 40% soul_shard lord_of_flames, conflagration_of_chaos, nefarious_pact, accelerando(3)
3:48.982 default R incinerate Fluffy_Pillow 279268.2/1100000: 25% mana | 0.0/5: 0% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, nefarious_pact
3:49.997 default R incinerate Fluffy_Pillow 227650.2/1100000: 21% mana | 0.0/5: 0% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, nefarious_pact, accelerando
3:50.998 default R incinerate Fluffy_Pillow 176048.5/1100000: 16% mana | 0.0/5: 0% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, nefarious_pact, accelerando
3:51.999 default C havoc enemy2 124446.7/1100000: 11% mana | 1.0/5: 20% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, nefarious_pact, accelerando
3:52.799 default J conflagrate Fluffy_Pillow 47953.9/1100000: 4% mana | 2.0/5: 40% soul_shard lord_of_flames, embrace_chaos, nefarious_pact, accelerando
3:53.597 default N summon_doomguard Fluffy_Pillow 59432.2/1100000: 5% mana | 4.0/5: 80% soul_shard lord_of_flames, conflagration_of_chaos, nefarious_pact, accelerando
3:54.395 default Q chaos_bolt Fluffy_Pillow 70910.5/1100000: 6% mana | 3.0/5: 60% soul_shard lord_of_flames, conflagration_of_chaos, nefarious_pact, accelerando
3:55.988 default R incinerate Fluffy_Pillow 93824.1/1100000: 9% mana | 2.0/5: 40% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, devils_due, accelerando
3:57.689 default Q chaos_bolt Fluffy_Pillow 52292.6/1100000: 5% mana | 3.0/5: 60% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, devils_due, accelerando(2)
3:59.290 default E immolate Fluffy_Pillow 75666.4/1100000: 7% mana | 1.0/5: 20% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, devils_due, accelerando(2)
4:00.628 default J conflagrate Fluffy_Pillow 29200.5/1100000: 3% mana | 1.0/5: 20% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, devils_due, accelerando(2)
4:01.964 default K conflagrate Fluffy_Pillow 48705.4/1100000: 4% mana | 2.0/5: 40% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, devils_due, accelerando(2)
4:03.299 default Q chaos_bolt Fluffy_Pillow 67633.0/1100000: 6% mana | 4.0/5: 80% soul_shard lord_of_flames
4:05.633 default Q chaos_bolt Fluffy_Pillow 100702.5/1100000: 9% mana | 3.0/5: 60% soul_shard lord_of_flames, embrace_chaos
4:07.036 default K conflagrate Fluffy_Pillow 120581.0/1100000: 11% mana | 1.0/5: 20% soul_shard lord_of_flames, embrace_chaos
4:08.206 default O soul_harvest Fluffy_Pillow 137158.2/1100000: 12% mana | 3.0/5: 60% soul_shard lord_of_flames, embrace_chaos
4:08.346 default Q chaos_bolt Fluffy_Pillow 139141.8/1100000: 13% mana | 3.0/5: 60% soul_shard soul_harvest, lord_of_flames, embrace_chaos
4:09.747 default K conflagrate Fluffy_Pillow 159038.8/1100000: 14% mana | 1.0/5: 20% soul_shard soul_harvest, lord_of_flames, embrace_chaos, accelerando
4:10.897 default R incinerate Fluffy_Pillow 175580.2/1100000: 16% mana | 2.0/5: 40% soul_shard soul_harvest, lord_of_flames, embrace_chaos, accelerando
4:12.338 default C havoc enemy2 130307.4/1100000: 12% mana | 2.0/5: 40% soul_shard soul_harvest, lord_of_flames, embrace_chaos, accelerando
4:13.490 default Q chaos_bolt Fluffy_Pillow 58877.7/1100000: 5% mana | 2.0/5: 40% soul_shard soul_harvest, lord_of_flames, embrace_chaos, accelerando
4:14.869 default R incinerate Fluffy_Pillow 78715.2/1100000: 7% mana | 1.0/5: 20% soul_shard soul_harvest, lord_of_flames, embrace_chaos, accelerando(2)
4:16.291 default S life_tap Fluffy_Pillow 33475.7/1100000: 3% mana | 1.0/5: 20% soul_shard soul_harvest, lord_of_flames, embrace_chaos, accelerando(2)
4:17.425 default E immolate Fluffy_Pillow 380031.5/1100000: 35% mana | 3.0/5: 60% soul_shard soul_harvest, lord_of_flames, embrace_chaos, accelerando(2)
4:18.561 default Q chaos_bolt Fluffy_Pillow 330617.8/1100000: 30% mana | 3.0/5: 60% soul_shard soul_harvest, lord_of_flames, embrace_chaos, accelerando(3)
4:19.902 default R incinerate Fluffy_Pillow 350485.6/1100000: 32% mana | 1.0/5: 20% soul_shard soul_harvest, lord_of_flames, embrace_chaos, accelerando(4)
4:21.282 default R incinerate Fluffy_Pillow 305227.5/1100000: 28% mana | 2.0/5: 40% soul_shard soul_harvest, lord_of_flames, embrace_chaos, accelerando(4)
4:22.664 default Q chaos_bolt Fluffy_Pillow 259079.7/1100000: 24% mana | 2.0/5: 40% soul_shard soul_harvest, lord_of_flames, embrace_chaos, accelerando
4:24.044 default R incinerate Fluffy_Pillow 278929.5/1100000: 25% mana | 1.0/5: 20% soul_shard soul_harvest, lord_of_flames, embrace_chaos, accelerando
4:25.485 default R incinerate Fluffy_Pillow 233656.7/1100000: 21% mana | 1.0/5: 20% soul_shard soul_harvest, lord_of_flames, embrace_chaos, accelerando
4:26.927 default G immolate Fluffy_Pillow 188398.3/1100000: 17% mana | 1.0/5: 20% soul_shard soul_harvest, lord_of_flames, embrace_chaos, accelerando
4:28.080 default J conflagrate Fluffy_Pillow 138982.9/1100000: 13% mana | 1.0/5: 20% soul_shard lord_of_flames, accelerando
4:29.232 default K conflagrate Fluffy_Pillow 155553.1/1100000: 14% mana | 2.0/5: 40% soul_shard lord_of_flames, accelerando
4:30.384 default Q chaos_bolt Fluffy_Pillow 172123.4/1100000: 16% mana | 3.0/5: 60% soul_shard lord_of_flames, conflagration_of_chaos, accelerando
4:32.683 default C havoc enemy2 205292.0/1100000: 19% mana | 2.0/5: 40% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(2)
4:33.818 default J conflagrate Fluffy_Pillow 133862.4/1100000: 12% mana | 2.0/5: 40% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(2)
4:34.951 default J conflagrate Fluffy_Pillow 150164.9/1100000: 14% mana | 4.0/5: 80% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos
4:36.231 default L service_imp Fluffy_Pillow 168300.7/1100000: 15% mana | 5.0/5: 100% soul_shard lord_of_flames, embrace_chaos
4:37.398 default P dimensional_rift Fluffy_Pillow 184962.5/1100000: 17% mana | 5.0/5: 100% soul_shard lord_of_flames, accelerando
4:38.550 default Q chaos_bolt Fluffy_Pillow 201532.7/1100000: 18% mana | 5.0/5: 100% soul_shard lord_of_flames, accelerando
4:40.849 default Q chaos_bolt Fluffy_Pillow 234601.3/1100000: 21% mana | 3.0/5: 60% soul_shard lord_of_flames, embrace_chaos, accelerando
4:42.231 default J conflagrate Fluffy_Pillow 254479.8/1100000: 23% mana | 3.0/5: 60% soul_shard lord_of_flames, embrace_chaos, accelerando
4:43.385 default Q chaos_bolt Fluffy_Pillow 271087.7/1100000: 25% mana | 4.0/5: 80% soul_shard lord_of_flames, embrace_chaos, accelerando(2)
4:44.747 default Q chaos_bolt Fluffy_Pillow 290972.2/1100000: 26% mana | 3.0/5: 60% soul_shard lord_of_flames, embrace_chaos, accelerando(2)
4:46.106 default R incinerate Fluffy_Pillow 310812.9/1100000: 28% mana | 1.0/5: 20% soul_shard lord_of_flames, embrace_chaos, accelerando(2)
4:47.525 default R incinerate Fluffy_Pillow 265529.6/1100000: 24% mana | 1.0/5: 20% soul_shard lord_of_flames, embrace_chaos, accelerando(2)
4:48.947 default J conflagrate Fluffy_Pillow 220230.2/1100000: 20% mana | 2.0/5: 40% soul_shard lord_of_flames, embrace_chaos
4:50.115 default E immolate Fluffy_Pillow 236779.1/1100000: 22% mana | 3.0/5: 60% soul_shard lord_of_flames
4:51.282 default Q chaos_bolt Fluffy_Pillow 187313.8/1100000: 17% mana | 4.0/5: 80% soul_shard lord_of_flames
4:53.616 default C havoc enemy2 220384.4/1100000: 20% mana | 2.0/5: 40% soul_shard lord_of_flames, embrace_chaos, accelerando
4:54.767 default Q chaos_bolt Fluffy_Pillow 148940.2/1100000: 14% mana | 3.0/5: 60% soul_shard lord_of_flames, embrace_chaos, accelerando
4:56.146 default J conflagrate Fluffy_Pillow 168775.6/1100000: 15% mana | 2.0/5: 40% soul_shard lord_of_flames, embrace_chaos, accelerando

Stats

Raid-Buffed Unbuffed Gear Amount
Strength 4201 3876 0
Agility 7254 6929 0
Stamina 54709 54709 34192
Intellect 49775 48068 38456 (1278)
Spirit 1 1 0
Health 3282540 3282540 0
Mana 1100000 1100000 0
Soul Shard 5 5 0
Spell Power 49775 48068 0
Crit 15.38% 15.38% 4150
Haste 28.81% 27.81% 10427
Damage / Heal Versatility 5.96% 5.96% 2829
ManaReg per Second 14169 14059 0
Mastery 77.34% 77.34% 7113
Armor 1954 1954 1954
Run Speed 7 0 0

Gear

Source Slot Average Item Level: 906.00
Local Head Eyes of Azj'Aqir
ilevel: 900, stats: { 253 Armor, +3255 Sta, +2170 Int, +1074 Haste, +578 Vers }
Local Neck Prydaz, Xavaric's Magnum Opus
ilevel: 940, stats: { +2658 Sta, +1495 Mastery, +1495 Crit, +1495 Haste }, enchant: mark_of_the_hidden_satyr
Local Shoulders Pauldrons of Azj'Aqir
ilevel: 900, stats: { 233 Armor, +2442 Sta, +1628 Int, +752 Mastery, +487 Vers }
Local Chest Robes of Fluctuating Energy
ilevel: 900, stats: { 311 Armor, +3255 Sta, +2170 Int, +1145 Haste, +507 Mastery }
Local Waist Man'ari Skullbuckled Cinch
ilevel: 900, stats: { 175 Armor, +2442 Sta, +1628 Int, +699 Haste, +540 Mastery }
Local Legs Leggings of Azj'Aqir
ilevel: 900, stats: { 272 Armor, +3255 Sta, +2170 Int, +932 Crit, +720 Haste }
Local Feet Outcast Wanderer's Footrags
ilevel: 910, stats: { 222 Armor, +2680 Sta, +1786 Int, +864 Crit, +422 Mastery }
Local Wrists Woven Lasher Tendril Bracers
ilevel: 900, stats: { 136 Armor, +1831 Sta, +1221 Int, +644 Haste, +285 Vers }
Local Hands Clutch of Azj'Aqir
ilevel: 900, stats: { 194 Armor, +2442 Sta, +1628 Int, +859 Crit, +380 Mastery }
Local Finger1 Ring of the Scoured Clan
ilevel: 900, stats: { +1831 Sta, +2095 Mastery, +838 Haste }, enchant: { +200 Haste }
Local Finger2 Ring of Braided Stems
ilevel: 905, stats: { +1918 Sta, +1814 Haste, +1209 Vers }, enchant: { +200 Haste }
Local Trinket1 Whispers in the Dark
ilevel: 905, stats: { +2162 Int }
Local Trinket2 Erratic Metronome
ilevel: 900, stats: { +2063 Int }
Local Back Astromancer's Greatcloak
ilevel: 905, stats: { 158 Armor, +1918 Sta, +1278 StrAgiInt, +676 Haste, +270 Vers }, enchant: { +200 Int }
Local Main Hand Scepter of Sargeras
ilevel: 929, weapon: { 7005 - 10509, 3.6 }, stats: { +2843 Int, +4265 Sta, +922 Haste, +922 Mastery, +15509 Int }, relics: { +61 ilevels, +59 ilevels, +61 ilevels }

Talents

Level
15 Backdraft (Destruction Warlock) Roaring Blaze (Destruction Warlock) Shadowburn (Destruction Warlock)
30 Reverse Entropy (Destruction Warlock) Eradication (Destruction Warlock) Empowered Life Tap
45 Demonic Circle Mortal Coil Shadowfury
60 Cataclysm (Destruction Warlock) Fire and Brimstone (Destruction Warlock) Soul Harvest
75 Demon Skin Burning Rush Dark Pact
90 Grimoire of Supremacy Grimoire of Service Grimoire of Sacrifice
100 Wreak Havoc (Destruction Warlock) Channel Demonfire (Destruction Warlock) Soul Conduit

Profile

warlock="Prydaz"
level=110
race=troll
role=spell
position=back
talents=2203021
artifact=38:0:0:0:0:803:1:804:3:805:3:806:3:807:3:808:3:809:3:810:3:811:3:812:3:813:1:814:1:815:1:816:1:817:1:818:1:1355:1:1392:1:1609:4:1610:1:1611:1:1713:1
spec=destruction

# This default action priority list is automatically created based on your character.
# It is a attempt to provide you with a action list that is both simple and practicable,
# while resulting in a meaningful and good simulation. It may not result in the absolutely highest possible dps.
# Feel free to edit, adapt and improve it to your own needs.
# SimulationCraft is always looking for updates and improvements to the default action lists.

# Executed before combat begins. Accepts non-harmful actions only.
actions.precombat=flask,type=whispered_pact
actions.precombat+=/food,type=azshari_salad
actions.precombat+=/summon_pet,if=!talent.grimoire_of_supremacy.enabled&(!talent.grimoire_of_sacrifice.enabled|buff.demonic_power.down)
actions.precombat+=/summon_infernal,if=talent.grimoire_of_supremacy.enabled&artifact.lord_of_flames.rank>0
actions.precombat+=/summon_infernal,if=talent.grimoire_of_supremacy.enabled&active_enemies>1
actions.precombat+=/summon_doomguard,if=talent.grimoire_of_supremacy.enabled&active_enemies=1&artifact.lord_of_flames.rank=0
actions.precombat+=/augmentation,type=defiled
actions.precombat+=/snapshot_stats
actions.precombat+=/grimoire_of_sacrifice,if=talent.grimoire_of_sacrifice.enabled
actions.precombat+=/life_tap,if=talent.empowered_life_tap.enabled&!buff.empowered_life_tap.remains
actions.precombat+=/potion,name=prolonged_power
actions.precombat+=/chaos_bolt

# Executed every time the actor is available.
actions=havoc,target=2,if=active_enemies>1&(active_enemies<4|talent.wreak_havoc.enabled&active_enemies<6)&!debuff.havoc.remains
actions+=/dimensional_rift,if=charges=3
actions+=/immolate,if=remains<=tick_time
actions+=/immolate,cycle_targets=1,if=active_enemies>1&remains<=tick_time&(!talent.roaring_blaze.enabled|(!debuff.roaring_blaze.remains&action.conflagrate.charges<2+set_bonus.tier19_4pc))
actions+=/immolate,if=talent.roaring_blaze.enabled&remains<=duration&!debuff.roaring_blaze.remains&target.time_to_die>10&(action.conflagrate.charges=2+set_bonus.tier19_4pc|(action.conflagrate.charges>=1+set_bonus.tier19_4pc&action.conflagrate.recharge_time<cast_time+gcd)|target.time_to_die<24)
actions+=/berserking
actions+=/blood_fury
actions+=/arcane_torrent
actions+=/potion,name=deadly_grace,if=(buff.soul_harvest.remains|trinket.proc.any.react|target.time_to_die<=45)
actions+=/shadowburn,if=buff.conflagration_of_chaos.remains<=action.chaos_bolt.cast_time
actions+=/shadowburn,if=(charges=1+set_bonus.tier19_4pc&recharge_time<action.chaos_bolt.cast_time|charges=2+set_bonus.tier19_4pc)&soul_shard<5
actions+=/conflagrate,if=talent.roaring_blaze.enabled&(charges=2+set_bonus.tier19_4pc|(charges>=1+set_bonus.tier19_4pc&recharge_time<gcd)|target.time_to_die<24)
actions+=/conflagrate,if=talent.roaring_blaze.enabled&debuff.roaring_blaze.stack>0&dot.immolate.remains>dot.immolate.duration*0.3&(active_enemies=1|soul_shard<3)&soul_shard<5
actions+=/conflagrate,if=!talent.roaring_blaze.enabled&buff.backdraft.stack<3&buff.conflagration_of_chaos.remains<=action.chaos_bolt.cast_time
actions+=/conflagrate,if=!talent.roaring_blaze.enabled&buff.backdraft.stack<3&(charges=1+set_bonus.tier19_4pc&recharge_time<action.chaos_bolt.cast_time|charges=2+set_bonus.tier19_4pc)&soul_shard<5
actions+=/life_tap,if=talent.empowered_life_tap.enabled&buff.empowered_life_tap.remains<=gcd
actions+=/dimensional_rift,if=equipped.144369&!buff.lessons_of_spacetime.remains&((!talent.grimoire_of_supremacy.enabled&!cooldown.summon_doomguard.remains)|(talent.grimoire_of_service.enabled&!cooldown.service_pet.remains)|(talent.soul_harvest.enabled&!cooldown.soul_harvest.remains))
actions+=/service_pet
actions+=/summon_infernal,if=artifact.lord_of_flames.rank>0&!buff.lord_of_flames.remains
actions+=/summon_doomguard,if=!talent.grimoire_of_supremacy.enabled&spell_targets.infernal_awakening<=2&(target.time_to_die>180|target.health.pct<=20|target.time_to_die<30)
actions+=/summon_infernal,if=!talent.grimoire_of_supremacy.enabled&spell_targets.infernal_awakening>2
actions+=/summon_doomguard,if=talent.grimoire_of_supremacy.enabled&spell_targets.summon_infernal=1&artifact.lord_of_flames.rank>0&buff.lord_of_flames.remains&!pet.doomguard.active
actions+=/summon_doomguard,if=talent.grimoire_of_supremacy.enabled&spell_targets.summon_infernal=1&equipped.132379&!cooldown.sindorei_spite_icd.remains
actions+=/summon_infernal,if=talent.grimoire_of_supremacy.enabled&spell_targets.summon_infernal>1&equipped.132379&!cooldown.sindorei_spite_icd.remains
actions+=/soul_harvest
actions+=/channel_demonfire,if=dot.immolate.remains>cast_time
actions+=/havoc,if=active_enemies=1&talent.wreak_havoc.enabled&equipped.132375&!debuff.havoc.remains
actions+=/rain_of_fire,if=active_enemies>=3&cooldown.havoc.remains<=12&!talent.wreak_havoc.enabled
actions+=/rain_of_fire,if=active_enemies>=6&talent.wreak_havoc.enabled
actions+=/dimensional_rift,if=!equipped.144369|charges>1|((!talent.grimoire_of_service.enabled|recharge_time<cooldown.service_pet.remains)&(!talent.soul_harvest.enabled|recharge_time<cooldown.soul_harvest.remains)&(!talent.grimoire_of_supremacy.enabled|recharge_time<cooldown.summon_doomguard.remains))
actions+=/life_tap,if=talent.empowered_life_tap.enabled&buff.empowered_life_tap.remains<duration*0.3
actions+=/cataclysm
actions+=/chaos_bolt,if=(cooldown.havoc.remains>12&cooldown.havoc.remains|active_enemies<3|talent.wreak_havoc.enabled&active_enemies<6)&(set_bonus.tier19_4pc=0|!talent.eradication.enabled|buff.embrace_chaos.remains<=cast_time|soul_shard>=3)
actions+=/shadowburn
actions+=/conflagrate,if=!talent.roaring_blaze.enabled&buff.backdraft.stack<3
actions+=/immolate,if=!talent.roaring_blaze.enabled&remains<=duration*0.3
actions+=/incinerate
actions+=/life_tap

head=eyes_of_azjaqir,id=138314,bonus_id=3445
neck=prydaz_xavarics_magnum_opus,id=132444,ilevel=940,enchant_id=5439
shoulders=pauldrons_of_azjaqir,id=138323,bonus_id=3445
back=astromancers_greatcloak,id=140909,bonus_id=3518,enchant_id=5436
chest=robes_of_fluctuating_energy,id=140848,bonus_id=3445
wrists=woven_lasher_tendril_bracers,id=140886,bonus_id=3445
hands=clutch_of_azjaqir,id=138311,bonus_id=3445
waist=manari_skullbuckled_cinch,id=140887,bonus_id=3445
legs=leggings_of_azjaqir,id=138317,bonus_id=3445
feet=outcast_wanderers_footrags,id=140914,bonus_id=3519
finger1=ring_of_the_scoured_clan,id=140897,bonus_id=3445,enchant=binding_of_haste
finger2=ring_of_braided_stems,id=140896,bonus_id=3518,enchant=binding_of_haste
trinket1=whispers_in_the_dark,id=140809,ilevel=905
trinket2=erratic_metronome,id=140792,ilevel=900
main_hand=scepter_of_sargeras,id=128941,ilevel=929,gem_id=140826/140837/140826,relic_id=3519/3518:3518/3519

# Gear Summary
# gear_ilvl=906.27
# gear_stamina=34192
# gear_intellect=38456
# gear_crit_rating=4150
# gear_haste_rating=10427
# gear_mastery_rating=7113
# gear_versatility_rating=2829
# gear_armor=1954
# set_bonus=tier19_2pc=1
# set_bonus=tier19_4pc=1
default_pet=imp

Sephuz : 1362872 dps, 815007 dps to main target

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR
1362871.9 1362871.9 1157.5 / 0.085% 230944.6 / 16.9% 42.8
RPS Out RPS In Primary Resource Waiting APM Active Skill
25409.9 25409.9 Mana 0.00% 50.6 100.0% 100%
Talents
  • 15: Roaring Blaze (Destruction Warlock)
  • 30: Eradication (Destruction Warlock)
  • 60: Soul Harvest
  • 90: Grimoire of Service
  • 100: Wreak Havoc (Destruction Warlock)
  • Talent Calculator
Artifact

Charts

Abilities

Damage Stats DPS DPS% Execute Interval DPE DPET Type Count Hit Crit Avg Crit% Up%
Sephuz 1362872
Chaos Bolt 408857 30.0% 62.5 4.68sec 1966968 1343215 Direct 119.7 0 1026828 1026828 100.0%  

Stats details: chaos_bolt

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 62.49 119.71 0.00 0.00 1.4644 0.0000 122918903.13 122918903.13 0.00 1343214.51 1343214.51
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
crit 119.71 100.00% 1026827.61 667043 1568065 1027141.10 968097 1092597 122918903 122918903 0.00
 
 

Action details: chaos_bolt

Static Values
  • id:116858
  • school:chromatic
  • resource:soul_shard
  • range:40.0
  • travel_speed:16.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:2.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:3.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:116858
  • name:Chaos Bolt
  • school:chromatic
  • tooltip:
  • description:Unleashes a devastating blast of chaos, causing {$s1=1} Chaos damage. Chaos Bolt always critically strikes and your critical strike chance increases its damage.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:4.000000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
Conflagrate 168542 12.4% 48.7 6.16sec 1038546 1007952 Direct 96.9 293250 686722 522269 58.2%  

Stats details: conflagrate

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 48.73 96.91 0.00 0.00 1.0304 0.0000 50613314.44 50613314.44 0.00 1007952.25 1007952.25
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 40.50 41.79% 293250.32 192298 452046 293380.96 260143 327618 11877672 11877672 0.00
crit 56.41 58.21% 686721.91 384596 1090487 686871.42 612095 751010 38735642 38735642 0.00
 
 

Action details: conflagrate

Static Values
  • id:17962
  • school:fire
  • resource:chi
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:9.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:talent.roaring_blaze.enabled&(charges=2+set_bonus.tier19_4pc|(charges>=1+set_bonus.tier19_4pc&recharge_time<gcd)|target.time_to_die<24)
Spelldata
  • id:17962
  • name:Conflagrate
  • school:fire
  • tooltip:
  • description:Triggers an explosion on the target, dealing {$s1=1} Fire damage.{$?s196406=false}[ Reduces the cast time of Incinerate and Chaos Bolt by {$117828s1=30}% for {$117828d=10 seconds}.][] |cFFFFFFFFGenerates 1 Soul Shard.|r
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:2.265510
  • base_dd_min:1.00
  • base_dd_max:1.00
 
Cry Havoc 42289 3.1% 54.4 5.33sec 233805 0 Direct 108.8 96930 193929 116903 20.6%  

Stats details: cry_havoc

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 54.38 108.76 0.00 0.00 0.0000 0.0000 12714130.02 12714130.02 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 86.36 79.41% 96929.67 69248 145348 96978.26 90444 104658 8371218 8371218 0.00
crit 22.39 20.59% 193928.77 138497 290696 194042.86 170635 220437 4342912 4342912 0.00
 
 

Action details: cry_havoc

Static Values
  • id:243011
  • school:chromatic
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:243011
  • name:Cry Havoc
  • school:chromatic
  • tooltip:
  • description:Deals {$s2=0} Chaos damage to enemies within $A2 yards.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:1.000000
  • base_dd_min:0.00
  • base_dd_max:0.00
 
Deadly Grace 6346 0.5% 14.6 2.03sec 128673 0 Direct 14.6 106621 213148 128673 20.7%  

Stats details: deadly_grace

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 14.56 14.56 0.00 0.00 0.0000 0.0000 1873650.44 1873650.44 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 11.55 79.30% 106621.18 94564 113476 106631.03 96665 113476 1231159 1231159 0.00
crit 3.01 20.70% 213148.13 189127 226953 204994.61 0 226953 642491 642491 0.00
 
 

Action details: deadly_grace

Static Values
  • id:188091
  • school:arcane
  • resource:none
  • range:40.0
  • travel_speed:25.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:188091
  • name:Deadly Grace
  • school:arcane
  • tooltip:
  • description:Deal {$s1=63339 to 95008} Arcane damage.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:63338.72
  • base_dd_max:95008.08
 
Immolate 306747 22.5% 20.2 15.05sec 4565693 4376723 Direct 38.9 153352 306662 258538 68.6%  
Periodic 296.3 164231 328396 276974 68.7% 196.0%

Stats details: immolate

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 20.18 38.89 296.35 296.35 1.0432 1.9903 92134406.34 92134406.34 0.00 150821.69 4376723.50
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 12.21 31.39% 153351.74 101073 237580 153339.33 126700 187050 1872010 1872010 0.00
crit 26.68 68.61% 306662.34 202139 475184 306637.90 270898 345436 8182469 8182469 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 92.8 31.32% 164231.29 95 530530 164462.94 137361 195632 15244670 15244670 0.00
crit 203.5 68.68% 328395.70 54 1064358 328861.41 288596 372653 66835257 66835257 0.00
 
 

Action details: immolate

Static Values
  • id:348
  • school:fire
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:66000.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:1.50
  • base_crit:0.48
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:remains<=tick_time
Spelldata
  • id:348
  • name:Immolate
  • school:fire
  • tooltip:
  • description:Burns the enemy, causing {$s1=1} Fire damage immediately and an additional $157736o1 Fire damage over {$157736d=18 seconds}. |cFFFFFFFFPeriodic damage has a {$193541s1=15}% chance to generate 1 Soul Shard. Chance doubled on critical strikes.|r
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:1.332000
  • base_dd_min:1.00
  • base_dd_max:1.00
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.721500
  • base_td:0.00
  • dot_duration:18.00
  • base_tick_time:3.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
 
Incinerate 147204 10.8% 75.8 3.79sec 583931 459658 Direct 144.7 253771 507444 305980 20.6%  

Stats details: incinerate

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 75.85 144.74 0.00 0.00 1.2704 0.0000 44288552.21 44288552.21 0.00 459658.46 459658.46
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 114.95 79.42% 253770.94 163385 384072 253844.80 238562 268851 29172022 29172022 0.00
crit 29.79 20.58% 507444.08 326770 768144 507598.50 442962 571556 15116530 15116530 0.00
 
 

Action details: incinerate

Static Values
  • id:29722
  • school:fire
  • resource:mana
  • range:40.0
  • travel_speed:20.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:66000.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:1.88
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:29722
  • name:Incinerate
  • school:fire
  • tooltip:
  • description:Draws fire toward the enemy, dealing {$s2=0} Fire damage.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:2.331000
  • base_dd_min:0.00
  • base_dd_max:0.00
 
Mark of the Hidden Satyr 10507 0.8% 20.2 14.79sec 156526 0 Direct 20.2 129767 259465 156525 20.6%  

Stats details: mark_of_the_hidden_satyr

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 20.17 20.17 0.00 0.00 0.0000 0.0000 3157815.28 3157815.28 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 16.01 79.37% 129767.27 123658 156215 129785.53 123658 142835 2077847 2077847 0.00
crit 4.16 20.63% 259464.82 247315 312430 255722.31 0 312430 1079968 1079968 0.00
 
 

Action details: mark_of_the_hidden_satyr

Static Values
  • id:191259
  • school:fire
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:191259
  • name:Mark of the Hidden Satyr
  • school:fire
  • tooltip:
  • description:Deals fire damage.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:2.500000
  • spell_power_mod.direct:2.000000
  • base_dd_min:0.00
  • base_dd_max:0.00
 
pet - imp 49924 / 49924
Firebolt 49924 3.7% 109.7 2.74sec 136783 113363 Direct 108.8 114234 228532 137846 20.7%  

Stats details: firebolt

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 109.68 108.83 0.00 0.00 1.2066 0.0000 15002122.60 15002122.60 0.00 113363.02 113363.02
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 86.35 79.34% 114233.70 72960 138253 114264.16 111418 117046 9863689 9863689 0.00
crit 22.48 20.66% 228532.40 145919 276506 228604.76 211204 247000 5138433 5138433 0.00
 
 

Action details: firebolt

Static Values
  • id:3110
  • school:fire
  • resource:energy
  • range:40.0
  • travel_speed:16.0000
  • trigger_gcd:0.5000
  • min_gcd:0.7500
  • base_cost:40.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:1.75
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:3110
  • name:Firebolt
  • school:fire
  • tooltip:
  • description:Deals {$s1=1} Fire damage to a target.$?a231795[ Damage increased by {$231795s1=50}% if you have Immolated the target.][] |cFF777777(Right-Click to toggle)|r
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:1.000000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
pet - service_imp 144324 / 46172
Firebolt 144324 3.4% 49.5 5.49sec 279731 246868 Direct 49.2 233056 465880 281329 20.7%  

Stats details: firebolt

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 49.46 49.18 0.00 0.00 1.1331 0.0000 13834750.72 13834750.72 0.00 246868.38 246868.38
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 38.98 79.27% 233056.26 145919 276506 233288.25 222141 245688 9084718 9084718 0.00
crit 10.20 20.73% 465879.91 291838 553011 466254.18 407049 553011 4750033 4750033 0.00
 
 

Action details: firebolt

Static Values
  • id:3110
  • school:fire
  • resource:energy
  • range:40.0
  • travel_speed:16.0000
  • trigger_gcd:0.5000
  • min_gcd:0.7500
  • base_cost:40.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:1.75
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:3110
  • name:Firebolt
  • school:fire
  • tooltip:
  • description:Deals {$s1=1} Fire damage to a target.$?a231795[ Damage increased by {$231795s1=50}% if you have Immolated the target.][] |cFF777777(Right-Click to toggle)|r
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:1.000000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
pet - infernal 136979 / 11600
Immolation 106732 0.7% 1.0 0.00sec 2668397 0 Periodic 46.9 47134 94233 56853 20.6% 8.1%

Stats details: immolation

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 23.47 46.94 0.0000 1.0363 2668397.07 2668397.07 0.00 109720.27 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 37.3 79.37% 47133.64 40681 48817 47140.01 45859 48410 1755747 1755747 0.00
crit 9.7 20.63% 94232.91 81362 97634 94233.43 81362 97634 912650 912650 0.00
 
 

Action details: immolation

Static Values
  • id:19483
  • school:fire
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:!ticking
Spelldata
  • id:19483
  • name:Immolation
  • school:fire
  • tooltip:Burns nearby enemies for {$20153s1=0} fire damage every $t1 seconds.
  • description:Burns nearby enemies for {$20153s1=0} fire damage every $t1 seconds.
 

Action details: immolation_tick

Static Values
  • id:20153
  • school:fire
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:20153
  • name:Immolation
  • school:fire
  • tooltip:
  • description:Deals Fire damage to all enemies near the caster.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.650000
  • base_dd_min:0.00
  • base_dd_max:0.00
 
melee 30248 0.2% 22.2 1.10sec 34028 31188 Direct 22.2 28230 56444 34029 20.5%  

Stats details: melee

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 22.22 22.22 0.00 0.00 1.0911 0.0000 756226.81 1111725.04 31.98 31188.47 31188.47
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 17.66 79.45% 28230.50 24327 29193 28231.41 27166 29193 498453 732773 31.98
crit 4.57 20.55% 56444.29 48655 58386 56154.98 0 58386 257774 378952 31.82
 
 

Action details: melee

Static Values
  • id:0
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Weapon
  • normalized:false
  • weapon_power_mod:0.285714
  • weapon_multiplier:1.00
 
pet - doomguard 112767 / 9539
Doom Bolt 112767 0.7% 11.1 2.18sec 254232 118797 Direct 11.1 211048 421858 254245 20.5%  

Stats details: doom_bolt

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 11.09 11.09 0.00 0.00 2.1401 0.0000 2819286.68 2819286.68 0.00 118796.84 118796.84
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 8.82 79.51% 211048.29 204037 244844 211062.89 204037 244844 1860765 1860765 0.00
crit 2.27 20.49% 421857.93 408074 489688 388833.75 0 489688 958522 958522 0.00
 
 

Action details: doom_bolt

Static Values
  • id:85692
  • school:shadow
  • resource:energy
  • range:30.0
  • travel_speed:20.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:35.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:3.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:85692
  • name:Doom Bolt
  • school:shadow
  • tooltip:
  • description:Sends a shadowy bolt at the enemy, causing {$s1=1} Shadow damage. Deals {$s2=20}% additional damage to targets below 20% health.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:2.750000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
pet - lord_of_flames_infernal 137039 / 11604
Immolation 106755 0.7% 1.0 0.00sec 2668985 0 Periodic 46.9 47128 94275 56865 20.7% 8.1%

Stats details: immolation

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 23.47 46.94 0.0000 1.0363 2668985.38 2668985.38 0.00 109744.46 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 37.2 79.35% 47128.23 40681 48817 47135.57 45766 48377 1755159 1755159 0.00
crit 9.7 20.65% 94274.54 81362 97634 94273.13 0 97634 913827 913827 0.00
 
 

Action details: immolation

Static Values
  • id:19483
  • school:fire
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:!ticking
Spelldata
  • id:19483
  • name:Immolation
  • school:fire
  • tooltip:Burns nearby enemies for {$20153s1=0} fire damage every $t1 seconds.
  • description:Burns nearby enemies for {$20153s1=0} fire damage every $t1 seconds.
 

Action details: immolation_tick

Static Values
  • id:20153
  • school:fire
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:20153
  • name:Immolation
  • school:fire
  • tooltip:
  • description:Deals Fire damage to all enemies near the caster.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.650000
  • base_dd_min:0.00
  • base_dd_max:0.00
 
melee 30284 0.2% 22.2 1.10sec 34069 31225 Direct 22.2 28228 56461 34069 20.7%  

Stats details: melee

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 22.22 22.22 0.00 0.00 1.0911 0.0000 757118.74 1113036.26 31.98 31225.25 31225.25
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 17.63 79.31% 28228.33 24327 29193 28229.20 27321 29193 497561 731462 31.98
crit 4.60 20.69% 56461.06 48655 58386 56141.18 0 58386 259558 381575 31.79
 
 

Action details: melee

Static Values
  • id:0
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Weapon
  • normalized:false
  • weapon_power_mod:0.285714
  • weapon_multiplier:1.00
 
pet - lord_of_flames_infernal 137023 / 11603
Immolation 106747 0.7% 1.0 0.00sec 2668793 0 Periodic 46.9 47132 94244 56860 20.7% 8.1%

Stats details: immolation

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 23.47 46.94 0.0000 1.0363 2668793.34 2668793.34 0.00 109736.57 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 37.2 79.35% 47132.22 40681 48817 47138.68 45766 48339 1755351 1755351 0.00
crit 9.7 20.65% 94243.84 81362 97634 94247.61 81362 97634 913443 913443 0.00
 
 

Action details: immolation

Static Values
  • id:19483
  • school:fire
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:!ticking
Spelldata
  • id:19483
  • name:Immolation
  • school:fire
  • tooltip:Burns nearby enemies for {$20153s1=0} fire damage every $t1 seconds.
  • description:Burns nearby enemies for {$20153s1=0} fire damage every $t1 seconds.
 

Action details: immolation_tick

Static Values
  • id:20153
  • school:fire
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:20153
  • name:Immolation
  • school:fire
  • tooltip:
  • description:Deals Fire damage to all enemies near the caster.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.650000
  • base_dd_min:0.00
  • base_dd_max:0.00
 
melee 30275 0.2% 22.2 1.10sec 34059 31217 Direct 22.2 28229 56457 34060 20.7%  

Stats details: melee

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 22.22 22.22 0.00 0.00 1.0911 0.0000 756911.45 1112731.53 31.98 31216.71 31216.71
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 17.63 79.35% 28228.81 24327 29193 28229.89 27030 29193 497768 731766 31.98
crit 4.59 20.65% 56457.32 48655 58386 56160.08 0 58386 259143 380965 31.80
 
 

Action details: melee

Static Values
  • id:0
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Weapon
  • normalized:false
  • weapon_power_mod:0.285714
  • weapon_multiplier:1.00
 
pet - lord_of_flames_infernal 137018 / 11602
Immolation 106779 0.7% 1.0 0.00sec 2669583 0 Periodic 46.9 47129 94267 56877 20.7% 8.1%

Stats details: immolation

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 23.47 46.94 0.0000 1.0363 2669583.45 2669583.45 0.00 109769.06 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 37.2 79.32% 47129.27 40681 48817 47136.25 44988 48324 1754560 1754560 0.00
crit 9.7 20.68% 94266.57 81362 97634 94282.87 81362 97634 915023 915023 0.00
 
 

Action details: immolation

Static Values
  • id:19483
  • school:fire
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:!ticking
Spelldata
  • id:19483
  • name:Immolation
  • school:fire
  • tooltip:Burns nearby enemies for {$20153s1=0} fire damage every $t1 seconds.
  • description:Burns nearby enemies for {$20153s1=0} fire damage every $t1 seconds.
 

Action details: immolation_tick

Static Values
  • id:20153
  • school:fire
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:20153
  • name:Immolation
  • school:fire
  • tooltip:
  • description:Deals Fire damage to all enemies near the caster.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.650000
  • base_dd_min:0.00
  • base_dd_max:0.00
 
melee 30239 0.2% 22.2 1.10sec 34018 31179 Direct 22.2 28226 56478 34018 20.5%  

Stats details: melee

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 22.22 22.22 0.00 0.00 1.0911 0.0000 755994.70 1111383.83 31.98 31178.90 31178.90
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 17.67 79.50% 28226.18 24327 29193 28226.93 27166 29193 498685 733114 31.98
crit 4.56 20.50% 56477.74 48655 58386 56137.69 0 58386 257310 378270 31.79
 
 

Action details: melee

Static Values
  • id:0
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Weapon
  • normalized:false
  • weapon_power_mod:0.285714
  • weapon_multiplier:1.00
 
pet - shadowy_tear 138232 / 18463
Shadow Bolt 138232 1.4% 3.3 68.94sec 1665243 0 Periodic 36.8 124402 248955 150070 20.6% 15.0%

Stats details: shadow_bolt

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 3.32 0.00 37.02 36.82 0.0000 1.2210 5526350.77 5526350.77 0.00 122280.63 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 29.2 79.39% 124401.88 68 150208 123929.06 0 150208 3636928 3636928 0.00
crit 7.6 20.61% 248955.28 158 300416 244750.80 0 300416 1889423 1889423 0.00
 
 

Action details: shadow_bolt

Static Values
  • id:196657
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:20.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:196657
  • name:Shadow Bolt
  • school:shadow
  • tooltip:
  • description:Sends a shadowy bolt at the enemy, causing {$s1=1} Shadow damage.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • dot_duration:14.00
  • base_tick_time:2.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
 
pet - flame_rift 285947 / 80148
Searing Bolt 285947 5.9% 66.1 2.64sec 363008 1121420 Direct 65.7 64114 0 64114 0.0%  
Periodic 139.5 117499 235033 141730 20.6% 45.9%

Stats details: searing_bolt

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 66.09 65.69 139.55 139.55 0.3237 0.9898 23989406.41 23989406.41 0.00 150384.94 1121419.52
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 65.69 100.00% 64114.34 59452 75105 64151.80 0 75105 4211697 4211697 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 110.8 79.38% 117498.69 119 150235 116918.30 0 135322 13016030 13016030 0.00
crit 28.8 20.62% 235033.01 238 300471 233610.72 0 286163 6761679 6761679 0.00
 
 

Action details: searing_bolt

Static Values
  • id:243050
  • school:fire
  • resource:energy
  • range:100.0
  • travel_speed:20.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:1.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:243050
  • name:Searing Bolt
  • school:fire
  • tooltip:Burning for $w2 Fire damage every $t2 sec.
  • description:Sends a searing bolt at the enemy, causing {$s1=1} Fire damage, and an additional $o2 Fire damage over {$d=30 seconds}, stacking up to {$u=20} times.
Direct Damage
  • may_crit:false
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:1.000000
  • base_dd_min:1.00
  • base_dd_max:1.00
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.100000
  • base_td:1.00
  • dot_duration:30.00
  • base_tick_time:1.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
 
pet - chaos_tear 160275 / 8504
Chaos Bolt 160275 0.6% 3.3 70.68sec 769043 391927 Direct 3.3 0 773670 773670 100.0%  

Stats details: chaos_bolt

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 3.31 3.29 0.00 0.00 1.9624 0.0000 2547523.10 2547523.10 0.00 391926.63 391926.63
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
crit 3.29 100.00% 773670.38 717099 905900 774064.84 0 905900 2547523 2547523 0.00
 
 

Action details: chaos_bolt

Static Values
  • id:215279
  • school:chromatic
  • resource:none
  • range:100.0
  • travel_speed:16.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:5.500
  • base_execute_time:3.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:215279
  • name:Chaos Bolt
  • school:chromatic
  • tooltip:
  • description:Unleashes a devastating blast of chaos, causing {$s1=1} Chaos damage. Chaos Bolt always critically strikes and your critical strike chance increases its damage.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:5.000000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
pet - chaos_portal 290117 / 16862
Chaos Barrage 290117 1.2% 3.3 69.63sec 1508846 0 Periodic 118.4 35282 70589 42578 20.7% 6.0%

Stats details: chaos_barrage

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 3.34 0.00 118.89 118.38 0.0000 0.1527 5040211.73 5040211.73 0.00 277712.92 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 93.9 79.34% 35281.86 145 41308 35120.65 0 41308 3313513 3313513 0.00
crit 24.5 20.66% 70588.75 296 82617 70268.45 0 82617 1726699 1726699 0.00
 
 

Action details: chaos_barrage

Static Values
  • id:187394
  • school:magic
  • resource:none
  • range:100.0
  • travel_speed:24.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:187394
  • name:Chaos Barrage
  • school:magic
  • tooltip:
  • description:Deals {$s1=1} Chaos damage.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • dot_duration:5.50
  • base_tick_time:0.25
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
 
Simple Action Stats Execute Interval
Sephuz
augmentation 1.0 0.00sec

Stats details: augmentation

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: augmentation

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Sephuz
  • harmful:false
  • if_expr:
 
Berserking 2.1 180.70sec

Stats details: berserking

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.06 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: berserking

Static Values
  • id:26297
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:180.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:26297
  • name:Berserking
  • school:physical
  • tooltip:Haste increased by {$s1=15}%.
  • description:Increases your haste by {$s1=15}% for {$d=10 seconds}.
 
Dimensional Rift 12.9 23.61sec

Stats details: dimensional_rift

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 12.94 0.00 0.00 0.00 1.0021 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: dimensional_rift

Static Values
  • id:196586
  • school:none
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:45.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:charges=3
Spelldata
  • id:196586
  • name:Dimensional Rift
  • school:chaos
  • tooltip:
  • description:Rips a hole in time and space, opening a portal that damages your target.
 
flask 1.0 0.00sec

Stats details: flask

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: flask

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Sephuz
  • harmful:false
  • if_expr:
 
food 1.0 0.00sec

Stats details: food

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: food

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Sephuz
  • harmful:false
  • if_expr:
 
Havoc 14.9 20.91sec

Stats details: havoc

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 14.90 0.00 0.00 0.00 1.0591 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: havoc

Static Values
  • id:80240
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:88000.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:active_enemies>1&(active_enemies<4|talent.wreak_havoc.enabled&active_enemies<6)&!debuff.havoc.remains
Spelldata
  • id:80240
  • name:Havoc
  • school:shadow
  • tooltip:Spells cast by the Warlock also hit this target.
  • description:Marks a target with Havoc for {$d=8 seconds}, causing your single target spells to also strike the Havoc victim. Limit 1.
 
Life Tap 6.6 33.56sec

Stats details: life_tap

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 6.64 0.00 0.00 0.00 1.0324 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: life_tap

Static Values
  • id:1454
  • school:shadow
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:talent.empowered_life_tap.enabled&!buff.empowered_life_tap.remains
Spelldata
  • id:1454
  • name:Life Tap
  • school:shadow
  • tooltip:
  • description:Restores {$s1=30}% of your maximum mana, at the cost of {$s2=10}% of your maximum health.
 
potion 2.0 0.00sec

Stats details: potion

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: potion

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:60.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
 
Grimoire: Imp (service_imp) 3.7 91.40sec

Stats details: service_imp

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 3.69 0.00 0.00 0.00 0.9635 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: service_imp

Static Values
  • id:111859
  • school:shadow
  • resource:soul_shard
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:1.0
  • secondary_cost:0.0
  • cooldown:90.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:111859
  • name:Grimoire: Imp
  • school:shadow
  • tooltip:
  • description:Summons an Imp who attacks the target for {$108501s1=25} sec. Imps cast ranged Firebolts and cleanse a hostile magic effect from their master.
 
Soul Harvest 2.9 120.84sec

Stats details: soul_harvest

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.90 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: soul_harvest

Static Values
  • id:196098
  • school:shadow
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:120.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:196098
  • name:Soul Harvest
  • school:shadow
  • tooltip:Damage increased by {$s1=20}%.
  • description:Increases your damage and your pets' damage by {$s1=20}%. Lasts {$d=15 seconds}, increased by {$s2=2} sec for each target afflicted by your {$?s137043=false}[Agony][]{$?s137044=false}[Doom][]{$?s137046=false}[Immolate][], up to a maximum of {$s3=35} sec.
 
Summon Doomguard 1.0 0.00sec

Stats details: summon_doomguard

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 1.0700 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: summon_doomguard

Static Values
  • id:18540
  • school:shadow
  • resource:soul_shard
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:1.0
  • secondary_cost:0.0
  • cooldown:180.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:talent.grimoire_of_supremacy.enabled&active_enemies=1&artifact.lord_of_flames.rank=0
Spelldata
  • id:18540
  • name:Summon Doomguard
  • school:shadow
  • tooltip:
  • description:Summons a Doomguard for {$60478d=25 seconds} to assault the target with its Doom Bolts.
 
Summon Imp 1.0 0.00sec

Stats details: summon_imp

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: summon_imp

Static Values
  • id:688
  • school:shadow
  • resource:soul_shard
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:1.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:2.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:!talent.grimoire_of_supremacy.enabled&(!talent.grimoire_of_sacrifice.enabled|buff.demonic_power.down)
Spelldata
  • id:688
  • name:Summon Imp
  • school:shadow
  • tooltip:
  • description:Summons an Imp under your command that casts ranged Firebolts.$?s74434[ |cFFFFFFFFSoulburn:|r |cFF8282FFInstant cast.|r][]
 
Summon Infernal 1.0 0.00sec

Stats details: summon_infernal

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.7557 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: summon_infernal

Static Values
  • id:1122
  • school:shadow
  • resource:soul_shard
  • range:30.0
  • travel_speed:1.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:1.0
  • secondary_cost:0.0
  • cooldown:180.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:talent.grimoire_of_supremacy.enabled&artifact.lord_of_flames.rank>0
Spelldata
  • id:1122
  • name:Summon Infernal
  • school:shadow
  • tooltip:
  • description:Summons an Infernal from the Twisting Nether, impacting for {$22703s1=0} Fire damage and stunning all enemy targets in the area for {$22703d=2 seconds}. The Infernal will serve you for {$111685d=25 seconds}, dealing strong area-of-effect damage.
 

Buffs

Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit Overflow Expiry
Accelerando 20.1 0.0 15.4sec 15.4sec 78.42% 78.42% 1.5(1.5) 19.3

Buff details

  • buff initial source:Sephuz
  • cooldown name:buff_accelerando
  • max_stacks:5
  • duration:12.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00

Stat Buff details

  • stat:haste_rating
  • amount:734.41

Stack Uptimes

  • accelerando_1:29.68%
  • accelerando_2:24.49%
  • accelerando_3:14.61%
  • accelerando_4:6.59%
  • accelerando_5:3.03%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:225719
  • name:Accelerando
  • tooltip:Haste increased by $w1.
  • description:{$@spelldesc225125=Your damaging spells have a chance to grant you {$225719s1=528} Haste for {$225719d=12 seconds}, stacking up to 5 times. Stacking does not refresh duration.}
  • max_stacks:5
  • duration:12.00
  • cooldown:0.00
  • default_chance:101.00%
Berserking 2.1 0.0 180.7sec 180.7sec 6.86% 8.52% 0.0(0.0) 2.0

Buff details

  • buff initial source:Sephuz
  • cooldown name:buff_berserking
  • max_stacks:1
  • duration:10.00
  • cooldown:180.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • berserking_1:6.86%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:26297
  • name:Berserking
  • tooltip:Haste increased by {$s1=15}%.
  • description:Increases your haste by {$s1=15}% for {$d=10 seconds}.
  • max_stacks:0
  • duration:10.00
  • cooldown:180.00
  • default_chance:0.00%
Bloodlust 1.0 0.0 0.0sec 0.0sec 13.55% 13.55% 0.0(0.0) 1.0

Buff details

  • buff initial source:Sephuz
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • duration:40.00
  • cooldown:300.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • bloodlust_1:13.55%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:2825
  • name:Bloodlust
  • tooltip:Haste increased by {$s1=30}%.
  • description:Increases Haste by {$s1=30}% for all party and raid members for {$d=40 seconds}. Allies receiving this effect will become Sated and unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.
  • max_stacks:0
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
Conflagration of Chaos 24.3 0.0 12.2sec 12.2sec 49.27% 47.40% 0.0(0.0) 0.7

Buff details

  • buff initial source:Sephuz
  • cooldown name:buff_conflagration_of_chaos
  • max_stacks:1
  • duration:20.00
  • cooldown:0.00
  • default_chance:50.00%
  • default_value:-0.00

Stack Uptimes

  • conflagration_of_chaos_1:49.27%

Trigger Attempt Success

  • trigger_pct:49.94%

Spelldata details

  • id:196546
  • name:Conflagration of Chaos
  • tooltip:Your {$?s17877=false}[Shadowburn][Conflagrate] will always critically strike. Critical strike chance will increase the critical strike damage of {$?s17877=false}[Shadowburn][Conflagrate].
  • description:{$@spelldesc219195={$?s17877=false}[Shadowburn][Conflagrate] has a chance to guarantee your next {$?s17877=false}[Shadowburn][Conflagrate] critically strikes, and to increase its damage by your critical strike chance.}
  • max_stacks:0
  • duration:20.00
  • cooldown:0.00
  • default_chance:100.00%
Devil's Due 3.5 0.0 70.0sec 70.0sec 8.67% 8.67% 0.0(0.0) 3.2

Buff details

  • buff initial source:Sephuz
  • cooldown name:buff_devils_due
  • max_stacks:1
  • duration:8.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.18

Stack Uptimes

  • devils_due_1:8.67%

Trigger Attempt Success

  • trigger_pct:99.94%

Spelldata details

  • id:225776
  • name:Devil's Due
  • tooltip:Cast speed slowed by {$s1=7}%.
  • description:{$@spelldesc225142=Your damaging spells have a chance to grant Nefarious Pact, increasing your casting speed by {$225774s1=17}% for {$225774d=12 seconds}. When Nefarious Pact expires, your casting speed is decreased by {$225776s1=7}% for {$225776d=8 seconds}.}
  • max_stacks:0
  • duration:8.00
  • cooldown:0.00
  • default_chance:0.00%
Embrace Chaos 33.4 30.1 9.1sec 4.7sec 68.23% 81.30% 30.1(30.1) 32.7

Buff details

  • buff initial source:Sephuz
  • cooldown name:buff_embrace_chaos
  • max_stacks:1
  • duration:4.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • embrace_chaos_1:68.23%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:212019
  • name:Embrace Chaos
  • tooltip:Chaos Bolt has {$s1=40}% reduced cast time.
  • description:{$@spelldesc212018=Casting Chaos Bolt reduces the cast time of your next Chaos Bolt by {$212019s1=40}% for {$212019d=4 seconds}.}
  • max_stacks:0
  • duration:4.00
  • cooldown:0.00
  • default_chance:0.00%
Lord of Flames 1.0 0.0 0.0sec 0.0sec 97.90% 97.90% 0.0(0.0) 0.0

Buff details

  • buff initial source:Sephuz
  • cooldown name:buff_lord_of_flames
  • max_stacks:1
  • duration:600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • lord_of_flames_1:97.90%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:226802
  • name:Lord of Flames
  • tooltip:Recently activated Lord of Flames.
  • description:{$@spelldesc224103=Once every {$s2=10} minutes, {$?s152107=false}[your Infernal's Meteor Strike][Summon Infernal] will summon {$s3=3} additional Infernals to serve you for {$226804d=25 seconds}.}
  • max_stacks:0
  • duration:600.00
  • cooldown:0.00
  • default_chance:0.00%
Nefarious Pact 3.5 0.0 70.4sec 69.7sec 13.48% 13.48% 0.0(0.0) 3.3

Buff details

  • buff initial source:Sephuz
  • cooldown name:buff_nefarious_pact
  • max_stacks:1
  • duration:12.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.44

Stack Uptimes

  • nefarious_pact_1:13.48%

Trigger Attempt Success

  • trigger_pct:99.94%

Spelldata details

  • id:225774
  • name:Nefarious Pact
  • tooltip:Cast speed increased by {$s1=17}%.
  • description:{$@spelldesc225142=Your damaging spells have a chance to grant Nefarious Pact, increasing your casting speed by {$225774s1=17}% for {$225774d=12 seconds}. When Nefarious Pact expires, your casting speed is decreased by {$225776s1=7}% for {$225776d=8 seconds}.}
  • max_stacks:0
  • duration:12.00
  • cooldown:0.00
  • default_chance:0.00%
Potion of Deadly Grace 1.0 0.0 0.0sec 0.0sec 10.16% 10.16% 0.0(0.0) 1.0

Buff details

  • buff initial source:Sephuz
  • cooldown name:buff_potion_of_deadly_grace
  • max_stacks:1
  • duration:30.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • potion_of_deadly_grace_1:10.16%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:188027
  • name:Potion of Deadly Grace
  • tooltip:Your attacks have a chance to unleash a bolt of energy at your target.
  • description:Grants your attacks a chance to unleash a bolt of energy at your target. Staying away from enemies for the entire duration of the effect will extend the effect by an additional 5 seconds.
  • max_stacks:0
  • duration:25.00
  • cooldown:1.00
  • default_chance:101.00%
Potion of Prolonged Power 1.0 0.0 0.0sec 0.0sec 19.64% 19.64% 0.0(0.0) 1.0

Buff details

  • buff initial source:Sephuz
  • cooldown name:buff_potion_of_prolonged_power
  • max_stacks:1
  • duration:60.00
  • cooldown:1.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:all
  • amount:2500.00

Stack Uptimes

  • potion_of_prolonged_power_1:19.64%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:229206
  • name:Potion of Prolonged Power
  • tooltip:All stats increased by {$s1=2500}.
  • description:Drink to increase all stats by {$s1=2500} for {$d=60 seconds}.
  • max_stacks:0
  • duration:60.00
  • cooldown:1.00
  • default_chance:0.00%
Soul Harvest 2.9 0.0 120.8sec 120.8sec 17.81% 17.81% 0.0(0.0) 2.7

Buff details

  • buff initial source:Sephuz
  • cooldown name:buff_soul_harvest
  • max_stacks:1
  • duration:15.00
  • cooldown:120.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • soul_harvest_1:17.81%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:196098
  • name:Soul Harvest
  • tooltip:Damage increased by {$s1=20}%.
  • description:Increases your damage and your pets' damage by {$s1=20}%. Lasts {$d=15 seconds}, increased by {$s2=2} sec for each target afflicted by your {$?s137043=false}[Agony][]{$?s137044=false}[Doom][]{$?s137046=false}[Immolate][], up to a maximum of {$s3=35} sec.
  • max_stacks:0
  • duration:15.00
  • cooldown:120.00
  • default_chance:0.00%
Constant Buffs
Well Fed (azshari_salad)

Buff details

  • buff initial source:Sephuz
  • cooldown name:buff_azshari_salad
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:haste_rating
  • amount:375.00

Stack Uptimes

  • azshari_salad_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:225603
  • name:Well Fed
  • tooltip:Haste increased by $w1.
  • description:Increases haste by {$s1=375} for {$d=3600 seconds}.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Defiled Augmentation

Buff details

  • buff initial source:Sephuz
  • cooldown name:buff_defiled_augmentation
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:agility
  • amount:325.00
  • stat:strength
  • amount:325.00
  • stat:intellect
  • amount:325.00

Stack Uptimes

  • defiled_augmentation_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:224001
  • name:Defiled Augmentation
  • tooltip:Agility, Intellect and Strength increased by $w1.
  • description:Increases Agility, Intellect and Strength by {$s1=325} for {$d=3600 seconds}. Augment Rune.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Flask of the Whispered Pact

Buff details

  • buff initial source:Sephuz
  • cooldown name:buff_flask_of_the_whispered_pact
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:intellect
  • amount:1300.00

Stack Uptimes

  • flask_of_the_whispered_pact_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:188031
  • name:Flask of the Whispered Pact
  • tooltip:Intellect increased by $w1.
  • description:Increases Intellect by {$s1=1300} for {$d=3600 seconds}. Counts as both a Battle and Guardian elixir. This effect persists through death.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:101.00%
Tormented Souls

Buff details

  • buff initial source:Sephuz
  • cooldown name:buff_tormented_souls
  • max_stacks:12
  • duration:0.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00

Stack Uptimes

  • tormented_souls_2:0.37%
  • tormented_souls_3:99.63%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:216695
  • name:Tormented Souls
  • tooltip:Activate Reap Souls to consume all Tormented Souls collected by |cFFFFCC99Ulthalesh|r, increasing your damage by 10% and doubling the effect of all of |cFFFFCC99Ulthalesh|r's other traits for {$216708d=5 seconds} per soul consumed.
  • description:Activate Reap Souls to consume all Tormented Souls collected by |cFFFFCC99Ulthalesh|r, increasing your damage by 10% and doubling the effect of all of |cFFFFCC99Ulthalesh|r's other traits for {$216708d=5 seconds} per soul consumed.
  • max_stacks:12
  • duration:-0.00
  • cooldown:0.00
  • default_chance:101.00%

Procs

Count Interval
shadowy_tear 3.2 70.4sec
flame_rift 3.2 70.7sec
chaos_tear 3.2 70.5sec
chaos_portal 3.2 70.4sec
dimension_ripper 3.8 55.9sec
t19_2pc_chaos_bolt 45.6 6.4sec

Resources

Resource Usage Type Count Total Average RPE APR
Sephuz
chaos_bolt Soul Shard 63.5 127.0 2.0 2.0 967997.2
havoc Mana 14.9 1310929.9 88000.0 88000.2 0.0
immolate Mana 20.2 1331843.4 66000.0 65999.1 69.2
incinerate Mana 75.8 5005806.1 66000.0 66000.1 8.8
service_imp Soul Shard 3.7 3.7 1.0 1.0 0.0
summon_doomguard Soul Shard 1.0 1.0 1.0 1.0 0.0
summon_infernal Soul Shard 1.0 1.0 1.0 1.0 0.0
pet - imp
firebolt Energy 109.7 4387.1 40.0 40.0 3419.6
pet - service_imp
firebolt Energy 49.5 1978.3 40.0 40.0 6993.1
pet - doomguard
doom_bolt Energy 11.1 388.1 35.0 35.0 7263.8
pet - flame_rift
searing_bolt Energy 64.1 64.1 1.0 1.0 374056.2
Resource Gains Type Count Total Average Overflow
life_tap Mana 6.64 2192456.26 (32.33%) 330000.00 0.00 0.00%
immolate Soul Shard 75.02 73.78 (55.91%) 0.98 1.24 1.65%
conflagrate Soul Shard 48.73 48.63 (36.86%) 1.00 0.10 0.21%
mp5_regen Mana 527.15 4589575.47 (67.67%) 8706.35 79442.13 1.70%
soulsnatcher Soul Shard 9.54 9.54 (7.23%) 1.00 0.00 0.00%
pet - imp
energy_regen Energy 1903.08 4220.79 (100.00%) 2.22 21.58 0.51%
pet - service_imp
energy_regen Energy 448.68 1364.28 (100.00%) 3.04 61.92 4.34%
pet - doomguard
energy_regen Energy 15.83 347.42 (100.00%) 21.94 42.96 11.00%
Resource RPS-Gain RPS-Loss
Health 0.00 7230.39
Mana 22531.14 25409.88
Soul Shard 0.44 0.44
Combat End Resource Mean Min Max
Mana 234085.95 13766.42 490121.82
Soul Shard 2.29 0.00 5.00

Benefits & Uptimes

Benefits %
Uptimes %
Mana Cap 1.2%

Statistics & Data Analysis

Fight Length
Sample Data Sephuz Fight Length
Count 9999
Mean 301.01
Minimum 217.68
Maximum 385.07
Spread ( max - min ) 167.39
Range [ ( max - min ) / 2 * 100% ] 27.80%
DPS
Sample Data Sephuz Damage Per Second
Count 9999
Mean 1362871.94
Minimum 1177214.32
Maximum 1629150.94
Spread ( max - min ) 451936.62
Range [ ( max - min ) / 2 * 100% ] 16.58%
Standard Deviation 59052.0795
5th Percentile 1271378.07
95th Percentile 1465129.87
( 95th Percentile - 5th Percentile ) 193751.81
Mean Distribution
Standard Deviation 590.5503
95.00% Confidence Intervall ( 1361714.48 - 1364029.39 )
Normalized 95.00% Confidence Intervall ( 99.92% - 100.08% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 73
0.1% Error 7213
0.1 Scale Factor Error with Delta=300 29768302
0.05 Scale Factor Error with Delta=300 119073208
0.01 Scale Factor Error with Delta=300 2976830182
Priority Target DPS
Sample Data Sephuz Priority Target Damage Per Second
Count 9999
Mean 815006.67
Minimum 685794.49
Maximum 1016850.96
Spread ( max - min ) 331056.47
Range [ ( max - min ) / 2 * 100% ] 20.31%
Standard Deviation 45197.9438
5th Percentile 746521.23
95th Percentile 893410.09
( 95th Percentile - 5th Percentile ) 146888.86
Mean Distribution
Standard Deviation 452.0020
95.00% Confidence Intervall ( 814120.77 - 815892.58 )
Normalized 95.00% Confidence Intervall ( 99.89% - 100.11% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 119
0.1% Error 11815
0.1 Scale Factor Error with Delta=300 17438978
0.05 Scale Factor Error with Delta=300 69755912
0.01 Scale Factor Error with Delta=300 1743897781
DPS(e)
Sample Data Sephuz Damage Per Second (Effective)
Count 9999
Mean 1362871.94
Minimum 1177214.32
Maximum 1629150.94
Spread ( max - min ) 451936.62
Range [ ( max - min ) / 2 * 100% ] 16.58%
Damage
Sample Data Sephuz Damage
Count 9999
Mean 327700771.86
Minimum 229890217.45
Maximum 439575149.18
Spread ( max - min ) 209684931.73
Range [ ( max - min ) / 2 * 100% ] 31.99%
DTPS
Sample Data Sephuz Damage Taken Per Second
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HPS
Sample Data Sephuz Healing Per Second
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
HPS(e)
Sample Data Sephuz Healing Per Second (Effective)
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
Sample Data Sephuz Heal
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
Sample Data Sephuz Healing Taken Per Second
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
TMI
Sample Data Sephuz Theck-Meloree Index
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
ETMI
Sample Data SephuzTheck-Meloree Index (Effective)
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
MSD
Sample Data Sephuz Max Spike Value
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 flask,type=whispered_pact
1 0.00 food,type=azshari_salad
2 0.00 summon_pet,if=!talent.grimoire_of_supremacy.enabled&(!talent.grimoire_of_sacrifice.enabled|buff.demonic_power.down)
3 0.00 summon_infernal,if=talent.grimoire_of_supremacy.enabled&artifact.lord_of_flames.rank>0
4 0.00 summon_infernal,if=talent.grimoire_of_supremacy.enabled&active_enemies>1
5 0.00 summon_doomguard,if=talent.grimoire_of_supremacy.enabled&active_enemies=1&artifact.lord_of_flames.rank=0
6 0.00 augmentation,type=defiled
7 0.00 snapshot_stats
8 0.00 grimoire_of_sacrifice,if=talent.grimoire_of_sacrifice.enabled
9 0.00 life_tap,if=talent.empowered_life_tap.enabled&!buff.empowered_life_tap.remains
A 0.00 potion,name=prolonged_power
B 0.00 chaos_bolt
Default action list Executed every time the actor is available.
# count action,conditions
C 14.90 havoc,target=2,if=active_enemies>1&(active_enemies<4|talent.wreak_havoc.enabled&active_enemies<6)&!debuff.havoc.remains
D 1.00 dimensional_rift,if=charges=3
E 10.36 immolate,if=remains<=tick_time
F 0.73 immolate,cycle_targets=1,if=active_enemies>1&remains<=tick_time&(!talent.roaring_blaze.enabled|(!debuff.roaring_blaze.remains&action.conflagrate.charges<2+set_bonus.tier19_4pc))
G 9.14 immolate,if=talent.roaring_blaze.enabled&remains<=duration&!debuff.roaring_blaze.remains&target.time_to_die>10&(action.conflagrate.charges=2+set_bonus.tier19_4pc|(action.conflagrate.charges>=1+set_bonus.tier19_4pc&action.conflagrate.recharge_time<cast_time+gcd)|target.time_to_die<24)
H 2.06 berserking
0.00 blood_fury
0.00 arcane_torrent
I 1.00 potion,name=deadly_grace,if=(buff.soul_harvest.remains|trinket.proc.any.react|target.time_to_die<=45)
0.00 shadowburn,if=buff.conflagration_of_chaos.remains<=action.chaos_bolt.cast_time
0.00 shadowburn,if=(charges=1+set_bonus.tier19_4pc&recharge_time<action.chaos_bolt.cast_time|charges=2+set_bonus.tier19_4pc)&soul_shard<5
J 14.06 conflagrate,if=talent.roaring_blaze.enabled&(charges=2+set_bonus.tier19_4pc|(charges>=1+set_bonus.tier19_4pc&recharge_time<gcd)|target.time_to_die<24)
K 34.68 conflagrate,if=talent.roaring_blaze.enabled&debuff.roaring_blaze.stack>0&dot.immolate.remains>dot.immolate.duration*0.3&(active_enemies=1|soul_shard<3)&soul_shard<5
0.00 conflagrate,if=!talent.roaring_blaze.enabled&buff.backdraft.stack<3&buff.conflagration_of_chaos.remains<=action.chaos_bolt.cast_time
0.00 conflagrate,if=!talent.roaring_blaze.enabled&buff.backdraft.stack<3&(charges=1+set_bonus.tier19_4pc&recharge_time<action.chaos_bolt.cast_time|charges=2+set_bonus.tier19_4pc)&soul_shard<5
0.00 life_tap,if=talent.empowered_life_tap.enabled&buff.empowered_life_tap.remains<=gcd
0.00 dimensional_rift,if=equipped.144369&!buff.lessons_of_spacetime.remains&((!talent.grimoire_of_supremacy.enabled&!cooldown.summon_doomguard.remains)|(talent.grimoire_of_service.enabled&!cooldown.service_pet.remains)|(talent.soul_harvest.enabled&!cooldown.soul_harvest.remains))
L 3.69 service_pet
M 1.00 summon_infernal,if=artifact.lord_of_flames.rank>0&!buff.lord_of_flames.remains
N 1.00 summon_doomguard,if=!talent.grimoire_of_supremacy.enabled&spell_targets.infernal_awakening<=2&(target.time_to_die>180|target.health.pct<=20|target.time_to_die<30)
0.00 summon_infernal,if=!talent.grimoire_of_supremacy.enabled&spell_targets.infernal_awakening>2
0.00 summon_doomguard,if=talent.grimoire_of_supremacy.enabled&spell_targets.summon_infernal=1&artifact.lord_of_flames.rank>0&buff.lord_of_flames.remains&!pet.doomguard.active
0.00 summon_doomguard,if=talent.grimoire_of_supremacy.enabled&spell_targets.summon_infernal=1&equipped.132379&!cooldown.sindorei_spite_icd.remains
0.00 summon_infernal,if=talent.grimoire_of_supremacy.enabled&spell_targets.summon_infernal>1&equipped.132379&!cooldown.sindorei_spite_icd.remains
O 2.90 soul_harvest
0.00 channel_demonfire,if=dot.immolate.remains>cast_time
0.00 havoc,if=active_enemies=1&talent.wreak_havoc.enabled&equipped.132375&!debuff.havoc.remains
0.00 rain_of_fire,if=active_enemies>=3&cooldown.havoc.remains<=12&!talent.wreak_havoc.enabled
0.00 rain_of_fire,if=active_enemies>=6&talent.wreak_havoc.enabled
P 11.94 dimensional_rift,if=!equipped.144369|charges>1|((!talent.grimoire_of_service.enabled|recharge_time<cooldown.service_pet.remains)&(!talent.soul_harvest.enabled|recharge_time<cooldown.soul_harvest.remains)&(!talent.grimoire_of_supremacy.enabled|recharge_time<cooldown.summon_doomguard.remains))
0.00 life_tap,if=talent.empowered_life_tap.enabled&buff.empowered_life_tap.remains<duration*0.3
0.00 cataclysm
Q 62.81 chaos_bolt,if=(cooldown.havoc.remains>12&cooldown.havoc.remains|active_enemies<3|talent.wreak_havoc.enabled&active_enemies<6)&(set_bonus.tier19_4pc=0|!talent.eradication.enabled|buff.embrace_chaos.remains<=cast_time|soul_shard>=3)
0.00 shadowburn
0.00 conflagrate,if=!talent.roaring_blaze.enabled&buff.backdraft.stack<3
0.00 immolate,if=!talent.roaring_blaze.enabled&remains<=duration*0.3
R 76.18 incinerate
S 6.64 life_tap

Sample Sequence

0126ABCDEGHJKLMKOPPQKQQKQRRRKQCQQRRERQRRGJQKKQRQKRCQRKPQRQRREQRRRRCGJKQKRQKQRRKQRCQREQQQPRRLGJQQKCKQKQRKQRQRSEQRRCQROIRGJQKQKPKQRRRKCPQRSERRRRQRGJQCKQKQKRQQKRPQHRRSECFLQRGJQKQKQKQRRQRCKRQRSRRRRERRSRQGCJKKNPQFKQRRQKQORCEQRRRSRRQGJQKKQCJPQRRJQLRRJEQRCJRRQ

Sample Sequence Table

time list # name target resources buffs
Pre precombat 0 flask Sephuz 1100000.0/1100000: 100% mana | 3.0/5: 60% soul_shard
Pre precombat 1 food Sephuz 1100000.0/1100000: 100% mana | 3.0/5: 60% soul_shard
Pre precombat 2 summon_imp Fluffy_Pillow 1100000.0/1100000: 100% mana | 3.0/5: 60% soul_shard
Pre precombat 6 augmentation Sephuz 1100000.0/1100000: 100% mana | 3.0/5: 60% soul_shard
Pre precombat A potion Fluffy_Pillow 1100000.0/1100000: 100% mana | 3.0/5: 60% soul_shard potion_of_prolonged_power
0:00.000 precombat B chaos_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 1.0/5: 20% soul_shard embrace_chaos, accelerando, potion_of_prolonged_power
0:00.000 default C havoc enemy2 1100000.0/1100000: 100% mana | 1.0/5: 20% soul_shard embrace_chaos, accelerando, potion_of_prolonged_power
0:01.132 default D dimensional_rift Fluffy_Pillow 1033489.4/1100000: 94% mana | 1.0/5: 20% soul_shard bloodlust, embrace_chaos, accelerando, potion_of_prolonged_power
0:02.007 default E immolate Fluffy_Pillow 1050350.2/1100000: 95% mana | 1.0/5: 20% soul_shard bloodlust, embrace_chaos, accelerando(2), potion_of_prolonged_power
0:02.868 default G immolate Fluffy_Pillow 1000941.2/1100000: 91% mana | 1.0/5: 20% soul_shard bloodlust, embrace_chaos, accelerando(2), potion_of_prolonged_power
0:03.730 default H berserking Fluffy_Pillow 951551.5/1100000: 87% mana | 1.0/5: 20% soul_shard bloodlust, embrace_chaos, accelerando(2), potion_of_prolonged_power
0:03.730 default J conflagrate Fluffy_Pillow 951551.5/1100000: 87% mana | 1.0/5: 20% soul_shard bloodlust, berserking, embrace_chaos, accelerando(2), potion_of_prolonged_power
0:04.485 default K conflagrate Fluffy_Pillow 968282.2/1100000: 88% mana | 2.0/5: 40% soul_shard bloodlust, berserking, conflagration_of_chaos, accelerando(2), potion_of_prolonged_power
0:05.240 default L service_imp Fluffy_Pillow 985012.9/1100000: 90% mana | 4.0/5: 80% soul_shard bloodlust, berserking, accelerando(2), potion_of_prolonged_power
0:05.994 default M summon_infernal Fluffy_Pillow 1001721.5/1100000: 91% mana | 3.0/5: 60% soul_shard bloodlust, berserking, accelerando(2), potion_of_prolonged_power
0:06.749 default K conflagrate Fluffy_Pillow 1018452.2/1100000: 93% mana | 2.0/5: 40% soul_shard bloodlust, berserking, lord_of_flames, accelerando(2), potion_of_prolonged_power
0:07.503 default O soul_harvest Fluffy_Pillow 1035160.7/1100000: 94% mana | 3.0/5: 60% soul_shard bloodlust, berserking, lord_of_flames, accelerando(2), potion_of_prolonged_power
0:07.503 default P dimensional_rift Fluffy_Pillow 1035160.7/1100000: 94% mana | 3.0/5: 60% soul_shard bloodlust, berserking, soul_harvest, lord_of_flames, accelerando(2), potion_of_prolonged_power
0:08.257 default P dimensional_rift Fluffy_Pillow 1051869.3/1100000: 96% mana | 4.0/5: 80% soul_shard bloodlust, berserking, soul_harvest, lord_of_flames, accelerando(2), potion_of_prolonged_power
0:09.012 default Q chaos_bolt Fluffy_Pillow 1068600.0/1100000: 97% mana | 4.0/5: 80% soul_shard bloodlust, berserking, soul_harvest, lord_of_flames, accelerando(2), potion_of_prolonged_power
0:10.506 default K conflagrate Fluffy_Pillow 1100000.0/1100000: 100% mana | 2.0/5: 40% soul_shard bloodlust, berserking, soul_harvest, lord_of_flames, embrace_chaos, accelerando(3), potion_of_prolonged_power
0:11.260 default Q chaos_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 4.0/5: 80% soul_shard bloodlust, berserking, soul_harvest, lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(3), potion_of_prolonged_power
0:12.144 default Q chaos_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 3.0/5: 60% soul_shard bloodlust, berserking, soul_harvest, lord_of_flames, conflagration_of_chaos, embrace_chaos, potion_of_prolonged_power
0:13.070 default K conflagrate Fluffy_Pillow 1100000.0/1100000: 100% mana | 1.0/5: 20% soul_shard bloodlust, berserking, soul_harvest, lord_of_flames, conflagration_of_chaos, embrace_chaos, potion_of_prolonged_power
0:13.842 default Q chaos_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 3.0/5: 60% soul_shard bloodlust, soul_harvest, lord_of_flames, embrace_chaos, potion_of_prolonged_power
0:14.904 default R incinerate Fluffy_Pillow 1100000.0/1100000: 100% mana | 1.0/5: 20% soul_shard bloodlust, soul_harvest, lord_of_flames, embrace_chaos, potion_of_prolonged_power
0:16.014 default R incinerate Fluffy_Pillow 1034093.5/1100000: 94% mana | 1.0/5: 20% soul_shard bloodlust, soul_harvest, lord_of_flames, embrace_chaos, potion_of_prolonged_power
0:17.123 default R incinerate Fluffy_Pillow 988829.7/1100000: 90% mana | 1.0/5: 20% soul_shard bloodlust, soul_harvest, lord_of_flames, embrace_chaos, potion_of_prolonged_power
0:18.231 default K conflagrate Fluffy_Pillow 943548.0/1100000: 86% mana | 1.0/5: 20% soul_shard bloodlust, soul_harvest, lord_of_flames, embrace_chaos, accelerando, potion_of_prolonged_power
0:19.104 default Q chaos_bolt Fluffy_Pillow 960120.7/1100000: 87% mana | 3.0/5: 60% soul_shard bloodlust, soul_harvest, lord_of_flames, conflagration_of_chaos, accelerando, potion_of_prolonged_power
0:20.846 default C havoc enemy2 993362.5/1100000: 90% mana | 3.0/5: 60% soul_shard bloodlust, soul_harvest, lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(2), potion_of_prolonged_power
0:21.706 default Q chaos_bolt Fluffy_Pillow 921934.2/1100000: 84% mana | 3.0/5: 60% soul_shard bloodlust, soul_harvest, lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(2), potion_of_prolonged_power
0:22.737 default Q chaos_bolt Fluffy_Pillow 941801.0/1100000: 86% mana | 3.0/5: 60% soul_shard bloodlust, soul_harvest, lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(2), potion_of_prolonged_power
0:23.769 default R incinerate Fluffy_Pillow 961687.1/1100000: 87% mana | 1.0/5: 20% soul_shard bloodlust, soul_harvest, lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(2), potion_of_prolonged_power
0:24.846 default R incinerate Fluffy_Pillow 916440.3/1100000: 83% mana | 1.0/5: 20% soul_shard bloodlust, soul_harvest, lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(2), potion_of_prolonged_power
0:25.923 default E immolate Fluffy_Pillow 871193.5/1100000: 79% mana | 1.0/5: 20% soul_shard bloodlust, soul_harvest, lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(2), potion_of_prolonged_power
0:26.783 default R incinerate Fluffy_Pillow 821765.3/1100000: 75% mana | 1.0/5: 20% soul_shard bloodlust, lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(2), potion_of_prolonged_power
0:27.861 default Q chaos_bolt Fluffy_Pillow 776537.8/1100000: 71% mana | 2.0/5: 40% soul_shard bloodlust, lord_of_flames, conflagration_of_chaos, accelerando(2), potion_of_prolonged_power
0:29.578 default R incinerate Fluffy_Pillow 809623.4/1100000: 74% mana | 2.0/5: 40% soul_shard bloodlust, lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(2), potion_of_prolonged_power
0:30.655 default R incinerate Fluffy_Pillow 764166.4/1100000: 69% mana | 2.0/5: 40% soul_shard bloodlust, lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando, potion_of_prolonged_power
0:31.749 default G immolate Fluffy_Pillow 718934.4/1100000: 65% mana | 2.0/5: 40% soul_shard bloodlust, lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando, potion_of_prolonged_power
0:32.620 default J conflagrate Fluffy_Pillow 669469.7/1100000: 61% mana | 2.0/5: 40% soul_shard bloodlust, lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(2), potion_of_prolonged_power
0:33.479 default Q chaos_bolt Fluffy_Pillow 686022.2/1100000: 62% mana | 3.0/5: 60% soul_shard bloodlust, lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(2), potion_of_prolonged_power
0:34.510 default K conflagrate Fluffy_Pillow 705889.0/1100000: 64% mana | 1.0/5: 20% soul_shard bloodlust, lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(2), potion_of_prolonged_power
0:35.370 default K conflagrate Fluffy_Pillow 722460.7/1100000: 66% mana | 2.0/5: 40% soul_shard bloodlust, lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(2), potion_of_prolonged_power
0:36.232 default Q chaos_bolt Fluffy_Pillow 739071.0/1100000: 67% mana | 4.0/5: 80% soul_shard bloodlust, lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(2), potion_of_prolonged_power
0:37.263 default R incinerate Fluffy_Pillow 759011.2/1100000: 69% mana | 2.0/5: 40% soul_shard bloodlust, lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(3), potion_of_prolonged_power
0:38.323 default Q chaos_bolt Fluffy_Pillow 713740.3/1100000: 65% mana | 3.0/5: 60% soul_shard bloodlust, lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(4), potion_of_prolonged_power
0:39.324 default K conflagrate Fluffy_Pillow 733601.0/1100000: 67% mana | 1.0/5: 20% soul_shard bloodlust, lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(4), potion_of_prolonged_power
0:40.160 default R incinerate Fluffy_Pillow 750188.0/1100000: 68% mana | 2.0/5: 40% soul_shard bloodlust, lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(4), potion_of_prolonged_power
0:41.206 default C havoc enemy2 700153.1/1100000: 64% mana | 2.0/5: 40% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(5), potion_of_prolonged_power
0:42.276 default Q chaos_bolt Fluffy_Pillow 628718.6/1100000: 57% mana | 2.0/5: 40% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(5), potion_of_prolonged_power
0:43.557 default R incinerate Fluffy_Pillow 647430.2/1100000: 59% mana | 1.0/5: 20% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, potion_of_prolonged_power
0:44.999 default K conflagrate Fluffy_Pillow 602170.7/1100000: 55% mana | 2.0/5: 40% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, potion_of_prolonged_power
0:46.149 default P dimensional_rift Fluffy_Pillow 618711.3/1100000: 56% mana | 3.0/5: 60% soul_shard lord_of_flames, embrace_chaos, potion_of_prolonged_power
0:47.301 default Q chaos_bolt Fluffy_Pillow 635280.7/1100000: 58% mana | 3.0/5: 60% soul_shard lord_of_flames, embrace_chaos, potion_of_prolonged_power
0:48.682 default R incinerate Fluffy_Pillow 655144.9/1100000: 60% mana | 2.0/5: 40% soul_shard lord_of_flames, embrace_chaos, accelerando, potion_of_prolonged_power
0:50.104 default Q chaos_bolt Fluffy_Pillow 610116.0/1100000: 55% mana | 3.0/5: 60% soul_shard lord_of_flames, embrace_chaos, accelerando(3), potion_of_prolonged_power
0:51.424 default R incinerate Fluffy_Pillow 629971.9/1100000: 57% mana | 1.0/5: 20% soul_shard lord_of_flames, embrace_chaos, accelerando(3), potion_of_prolonged_power
0:52.804 default R incinerate Fluffy_Pillow 584730.2/1100000: 53% mana | 1.0/5: 20% soul_shard lord_of_flames, embrace_chaos, accelerando(3), potion_of_prolonged_power
0:54.182 default E immolate Fluffy_Pillow 539458.5/1100000: 49% mana | 2.0/5: 40% soul_shard lord_of_flames, embrace_chaos, accelerando(3), potion_of_prolonged_power
0:55.282 default Q chaos_bolt Fluffy_Pillow 490005.0/1100000: 45% mana | 2.0/5: 40% soul_shard lord_of_flames, embrace_chaos, accelerando(3), potion_of_prolonged_power
0:56.602 default R incinerate Fluffy_Pillow 509860.8/1100000: 46% mana | 0.0/5: 0% soul_shard lord_of_flames, embrace_chaos, accelerando(3), potion_of_prolonged_power
0:57.979 default R incinerate Fluffy_Pillow 464574.0/1100000: 42% mana | 0.0/5: 0% soul_shard lord_of_flames, embrace_chaos, accelerando(3), potion_of_prolonged_power
0:59.358 default R incinerate Fluffy_Pillow 419317.3/1100000: 38% mana | 0.0/5: 0% soul_shard lord_of_flames, embrace_chaos, accelerando(3)
1:00.739 default R incinerate Fluffy_Pillow 374051.4/1100000: 34% mana | 0.0/5: 0% soul_shard lord_of_flames, accelerando
1:02.160 default C havoc enemy2 328801.9/1100000: 30% mana | 0.0/5: 0% soul_shard lord_of_flames, accelerando
1:03.292 default G immolate Fluffy_Pillow 257332.2/1100000: 23% mana | 1.0/5: 20% soul_shard lord_of_flames, accelerando
1:04.428 default J conflagrate Fluffy_Pillow 207922.5/1100000: 19% mana | 1.0/5: 20% soul_shard lord_of_flames, accelerando(2)
1:05.545 default K conflagrate Fluffy_Pillow 224677.0/1100000: 20% mana | 2.0/5: 40% soul_shard lord_of_flames, accelerando(3)
1:06.646 default Q chaos_bolt Fluffy_Pillow 241238.6/1100000: 22% mana | 3.0/5: 60% soul_shard lord_of_flames, conflagration_of_chaos, accelerando(3)
1:08.842 default K conflagrate Fluffy_Pillow 274271.4/1100000: 25% mana | 1.0/5: 20% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(3)
1:09.943 default R incinerate Fluffy_Pillow 290833.0/1100000: 26% mana | 2.0/5: 40% soul_shard lord_of_flames, embrace_chaos, accelerando(3)
1:11.321 default Q chaos_bolt Fluffy_Pillow 245580.2/1100000: 22% mana | 4.0/5: 80% soul_shard lord_of_flames, embrace_chaos, accelerando(4)
1:12.622 default K conflagrate Fluffy_Pillow 265436.3/1100000: 24% mana | 2.0/5: 40% soul_shard lord_of_flames, embrace_chaos, accelerando(4)
1:13.708 default Q chaos_bolt Fluffy_Pillow 281153.1/1100000: 26% mana | 3.0/5: 60% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos
1:15.087 default R incinerate Fluffy_Pillow 300987.4/1100000: 27% mana | 1.0/5: 20% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos
1:16.529 default R incinerate Fluffy_Pillow 255907.1/1100000: 23% mana | 1.0/5: 20% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando
1:17.949 default K conflagrate Fluffy_Pillow 210643.0/1100000: 19% mana | 1.0/5: 20% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando
1:19.087 default Q chaos_bolt Fluffy_Pillow 227261.0/1100000: 21% mana | 3.0/5: 60% soul_shard lord_of_flames, conflagration_of_chaos, accelerando
1:21.352 default R incinerate Fluffy_Pillow 260336.2/1100000: 24% mana | 1.0/5: 20% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando
1:22.773 default C havoc enemy2 215147.0/1100000: 20% mana | 3.0/5: 60% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(2)
1:23.890 default Q chaos_bolt Fluffy_Pillow 143703.9/1100000: 13% mana | 3.0/5: 60% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(2)
1:25.229 default R incinerate Fluffy_Pillow 163551.4/1100000: 15% mana | 2.0/5: 40% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(2)
1:26.628 default E immolate Fluffy_Pillow 118288.4/1100000: 11% mana | 2.0/5: 40% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(2)
1:27.746 default Q chaos_bolt Fluffy_Pillow 68850.2/1100000: 6% mana | 4.0/5: 80% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando
1:29.104 default Q chaos_bolt Fluffy_Pillow 88680.7/1100000: 8% mana | 3.0/5: 60% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando
1:30.463 default Q chaos_bolt Fluffy_Pillow 108610.1/1100000: 10% mana | 3.0/5: 60% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(2)
1:31.803 default P dimensional_rift Fluffy_Pillow 128516.8/1100000: 12% mana | 1.0/5: 20% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(3)
1:32.903 default R incinerate Fluffy_Pillow 145063.4/1100000: 13% mana | 2.0/5: 40% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(3)
1:34.281 default R incinerate Fluffy_Pillow 99791.6/1100000: 9% mana | 2.0/5: 40% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(3)
1:35.658 default L service_imp Fluffy_Pillow 54504.8/1100000: 5% mana | 3.0/5: 60% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(3)
1:36.757 default G immolate Fluffy_Pillow 71050.6/1100000: 6% mana | 3.0/5: 60% soul_shard lord_of_flames, conflagration_of_chaos, accelerando(4)
1:37.841 default J conflagrate Fluffy_Pillow 21594.8/1100000: 2% mana | 3.0/5: 60% soul_shard lord_of_flames, conflagration_of_chaos, accelerando(4)
1:38.927 default Q chaos_bolt Fluffy_Pillow 38169.6/1100000: 3% mana | 4.0/5: 80% soul_shard lord_of_flames, accelerando(4)
1:41.093 default Q chaos_bolt Fluffy_Pillow 70035.0/1100000: 6% mana | 3.0/5: 60% soul_shard lord_of_flames, embrace_chaos, accelerando
1:42.452 default K conflagrate Fluffy_Pillow 89880.2/1100000: 8% mana | 1.0/5: 20% soul_shard lord_of_flames, embrace_chaos, accelerando
1:43.587 default C havoc enemy2 106454.3/1100000: 10% mana | 2.0/5: 40% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando
1:44.719 default K conflagrate Fluffy_Pillow 34984.6/1100000: 3% mana | 2.0/5: 40% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando
1:45.852 default Q chaos_bolt Fluffy_Pillow 51529.5/1100000: 5% mana | 3.0/5: 60% soul_shard lord_of_flames, embrace_chaos, accelerando
1:47.213 default K conflagrate Fluffy_Pillow 71403.9/1100000: 6% mana | 1.0/5: 20% soul_shard lord_of_flames, embrace_chaos, accelerando
1:48.349 default Q chaos_bolt Fluffy_Pillow 88107.6/1100000: 8% mana | 4.0/5: 80% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(2)
1:49.688 default R incinerate Fluffy_Pillow 107956.1/1100000: 10% mana | 2.0/5: 40% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(3)
1:51.068 default K conflagrate Fluffy_Pillow 62714.4/1100000: 6% mana | 2.0/5: 40% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(3)
1:52.345 default Q chaos_bolt Fluffy_Pillow 81923.4/1100000: 7% mana | 3.0/5: 60% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(3)
1:53.665 default R incinerate Fluffy_Pillow 101371.9/1100000: 9% mana | 2.0/5: 40% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos
1:55.106 default Q chaos_bolt Fluffy_Pillow 56237.4/1100000: 5% mana | 3.0/5: 60% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando
1:56.466 default R incinerate Fluffy_Pillow 76097.2/1100000: 7% mana | 1.0/5: 20% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando
1:57.887 default S life_tap Fluffy_Pillow 30848.8/1100000: 3% mana | 2.0/5: 40% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(2)
1:59.004 default E immolate Fluffy_Pillow 377405.7/1100000: 34% mana | 2.0/5: 40% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(2)
2:00.122 default Q chaos_bolt Fluffy_Pillow 327977.4/1100000: 30% mana | 2.0/5: 40% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(2)
2:01.462 default R incinerate Fluffy_Pillow 347894.1/1100000: 32% mana | 2.0/5: 40% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(3)
2:02.840 default R incinerate Fluffy_Pillow 302622.3/1100000: 28% mana | 2.0/5: 40% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(3)
2:04.219 default C havoc enemy2 257365.6/1100000: 23% mana | 3.0/5: 60% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(3)
2:05.319 default Q chaos_bolt Fluffy_Pillow 185912.1/1100000: 17% mana | 3.0/5: 60% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(3)
2:06.638 default R incinerate Fluffy_Pillow 205642.8/1100000: 19% mana | 1.0/5: 20% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos
2:08.079 default O soul_harvest Fluffy_Pillow 160368.9/1100000: 15% mana | 2.0/5: 40% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos
2:08.079 default I potion Fluffy_Pillow 160368.9/1100000: 15% mana | 2.0/5: 40% soul_shard soul_harvest, lord_of_flames, conflagration_of_chaos, embrace_chaos
2:08.079 default R incinerate Fluffy_Pillow 160368.9/1100000: 15% mana | 2.0/5: 40% soul_shard soul_harvest, lord_of_flames, conflagration_of_chaos, embrace_chaos, potion_of_deadly_grace
2:09.521 default G immolate Fluffy_Pillow 115109.4/1100000: 10% mana | 2.0/5: 40% soul_shard soul_harvest, lord_of_flames, conflagration_of_chaos, embrace_chaos, potion_of_deadly_grace
2:10.672 default J conflagrate Fluffy_Pillow 65664.4/1100000: 6% mana | 2.0/5: 40% soul_shard soul_harvest, lord_of_flames, conflagration_of_chaos, potion_of_deadly_grace
2:11.822 default Q chaos_bolt Fluffy_Pillow 82205.0/1100000: 7% mana | 3.0/5: 60% soul_shard soul_harvest, lord_of_flames, potion_of_deadly_grace
2:14.121 default K conflagrate Fluffy_Pillow 115648.7/1100000: 11% mana | 2.0/5: 40% soul_shard soul_harvest, lord_of_flames, embrace_chaos, accelerando, potion_of_deadly_grace
2:15.255 default Q chaos_bolt Fluffy_Pillow 132208.3/1100000: 12% mana | 3.0/5: 60% soul_shard soul_harvest, lord_of_flames, embrace_chaos, accelerando, potion_of_deadly_grace
2:16.616 default K conflagrate Fluffy_Pillow 152083.9/1100000: 14% mana | 1.0/5: 20% soul_shard soul_harvest, lord_of_flames, embrace_chaos, accelerando(2), potion_of_deadly_grace
2:17.733 default P dimensional_rift Fluffy_Pillow 168640.9/1100000: 15% mana | 2.0/5: 40% soul_shard soul_harvest, lord_of_flames, embrace_chaos, accelerando(2), potion_of_deadly_grace
2:18.850 default K conflagrate Fluffy_Pillow 185443.1/1100000: 17% mana | 2.0/5: 40% soul_shard soul_harvest, lord_of_flames, embrace_chaos, accelerando(3), potion_of_deadly_grace
2:19.951 default Q chaos_bolt Fluffy_Pillow 202189.6/1100000: 18% mana | 3.0/5: 60% soul_shard soul_harvest, lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(4), potion_of_deadly_grace
2:21.251 default R incinerate Fluffy_Pillow 222031.1/1100000: 20% mana | 1.0/5: 20% soul_shard soul_harvest, lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(5), potion_of_deadly_grace
2:22.591 default R incinerate Fluffy_Pillow 176776.7/1100000: 16% mana | 1.0/5: 20% soul_shard soul_harvest, lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(5), potion_of_deadly_grace
2:23.931 default R incinerate Fluffy_Pillow 131522.3/1100000: 12% mana | 2.0/5: 40% soul_shard soul_harvest, lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(5), potion_of_deadly_grace
2:25.270 default K conflagrate Fluffy_Pillow 85302.1/1100000: 8% mana | 2.0/5: 40% soul_shard soul_harvest, lord_of_flames, conflagration_of_chaos, potion_of_deadly_grace
2:26.421 default C havoc enemy2 101857.1/1100000: 9% mana | 3.0/5: 60% soul_shard soul_harvest, lord_of_flames, potion_of_deadly_grace
2:27.573 default P dimensional_rift Fluffy_Pillow 30679.5/1100000: 3% mana | 3.0/5: 60% soul_shard lord_of_flames, accelerando, potion_of_deadly_grace
2:28.708 default Q chaos_bolt Fluffy_Pillow 47253.6/1100000: 4% mana | 3.0/5: 60% soul_shard lord_of_flames, accelerando, potion_of_deadly_grace
2:30.972 default R incinerate Fluffy_Pillow 80499.2/1100000: 7% mana | 1.0/5: 20% soul_shard lord_of_flames, embrace_chaos, accelerando(3), potion_of_deadly_grace
2:32.351 default S life_tap Fluffy_Pillow 35243.6/1100000: 3% mana | 1.0/5: 20% soul_shard lord_of_flames, embrace_chaos, accelerando(4), potion_of_deadly_grace
2:33.436 default E immolate Fluffy_Pillow 381803.1/1100000: 35% mana | 1.0/5: 20% soul_shard lord_of_flames, embrace_chaos, accelerando(4), potion_of_deadly_grace
2:34.521 default R incinerate Fluffy_Pillow 332362.6/1100000: 30% mana | 1.0/5: 20% soul_shard lord_of_flames, embrace_chaos, accelerando(4), potion_of_deadly_grace
2:35.879 default R incinerate Fluffy_Pillow 287088.6/1100000: 26% mana | 1.0/5: 20% soul_shard lord_of_flames, accelerando(4), potion_of_deadly_grace
2:37.236 default R incinerate Fluffy_Pillow 241799.4/1100000: 22% mana | 1.0/5: 20% soul_shard lord_of_flames, accelerando(4), potion_of_deadly_grace
2:38.596 default R incinerate Fluffy_Pillow 196402.2/1100000: 18% mana | 1.0/5: 20% soul_shard lord_of_flames
2:40.038 default Q chaos_bolt Fluffy_Pillow 151143.7/1100000: 14% mana | 2.0/5: 40% soul_shard lord_of_flames, accelerando
2:42.301 default R incinerate Fluffy_Pillow 184189.8/1100000: 17% mana | 1.0/5: 20% soul_shard lord_of_flames, embrace_chaos, accelerando
2:43.721 default G immolate Fluffy_Pillow 138997.6/1100000: 13% mana | 1.0/5: 20% soul_shard lord_of_flames, embrace_chaos, accelerando(2)
2:44.839 default J conflagrate Fluffy_Pillow 89569.3/1100000: 8% mana | 1.0/5: 20% soul_shard lord_of_flames, embrace_chaos, accelerando(2)
2:45.956 default Q chaos_bolt Fluffy_Pillow 106126.3/1100000: 10% mana | 3.0/5: 60% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(2)
2:47.296 default C havoc enemy2 125989.7/1100000: 11% mana | 1.0/5: 20% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(3)
2:48.396 default K conflagrate Fluffy_Pillow 54536.2/1100000: 5% mana | 2.0/5: 40% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(3)
2:49.496 default Q chaos_bolt Fluffy_Pillow 71082.8/1100000: 6% mana | 3.0/5: 60% soul_shard lord_of_flames, embrace_chaos, accelerando(3)
2:50.817 default K conflagrate Fluffy_Pillow 90953.6/1100000: 8% mana | 2.0/5: 40% soul_shard lord_of_flames, embrace_chaos, accelerando(3)
2:51.916 default Q chaos_bolt Fluffy_Pillow 107485.1/1100000: 10% mana | 3.0/5: 60% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(3)
2:53.237 default K conflagrate Fluffy_Pillow 126562.3/1100000: 12% mana | 1.0/5: 20% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos
2:54.386 default R incinerate Fluffy_Pillow 143088.5/1100000: 13% mana | 2.0/5: 40% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos
2:55.827 default Q chaos_bolt Fluffy_Pillow 97814.7/1100000: 9% mana | 3.0/5: 60% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos
2:57.206 default Q chaos_bolt Fluffy_Pillow 117733.8/1100000: 11% mana | 3.0/5: 60% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando
2:58.567 default K conflagrate Fluffy_Pillow 137608.1/1100000: 13% mana | 1.0/5: 20% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando
2:59.701 default R incinerate Fluffy_Pillow 154167.7/1100000: 14% mana | 2.0/5: 40% soul_shard lord_of_flames, embrace_chaos, accelerando
3:01.121 default P dimensional_rift Fluffy_Pillow 109228.6/1100000: 10% mana | 2.0/5: 40% soul_shard lord_of_flames, embrace_chaos, accelerando(3)
3:02.234 default Q chaos_bolt Fluffy_Pillow 125970.6/1100000: 11% mana | 2.0/5: 40% soul_shard lord_of_flames, embrace_chaos, accelerando(3)
3:03.554 default H berserking Fluffy_Pillow 145827.5/1100000: 13% mana | 0.0/5: 0% soul_shard lord_of_flames, embrace_chaos, accelerando(4)
3:03.730 default R incinerate Fluffy_Pillow 148513.7/1100000: 14% mana | 0.0/5: 0% soul_shard berserking, lord_of_flames, embrace_chaos, accelerando(4)
3:04.914 default R incinerate Fluffy_Pillow 103294.7/1100000: 9% mana | 0.0/5: 0% soul_shard berserking, lord_of_flames, embrace_chaos, accelerando(4)
3:06.097 default S life_tap Fluffy_Pillow 58058.1/1100000: 5% mana | 0.0/5: 0% soul_shard berserking, lord_of_flames, embrace_chaos, accelerando(4)
3:07.041 default E immolate Fluffy_Pillow 404626.8/1100000: 37% mana | 0.0/5: 0% soul_shard berserking, lord_of_flames, embrace_chaos, accelerando(4)
3:07.985 default C havoc enemy2 355195.4/1100000: 32% mana | 1.0/5: 20% soul_shard berserking, lord_of_flames, accelerando(4)
3:08.928 default F immolate enemy2 283785.3/1100000: 26% mana | 3.0/5: 60% soul_shard berserking, lord_of_flames
3:09.928 default L service_imp Fluffy_Pillow 234325.9/1100000: 21% mana | 3.0/5: 60% soul_shard berserking, lord_of_flames
3:10.930 default Q chaos_bolt Fluffy_Pillow 250899.6/1100000: 23% mana | 2.0/5: 40% soul_shard berserking, lord_of_flames
3:12.929 default R incinerate Fluffy_Pillow 284219.1/1100000: 26% mana | 0.0/5: 0% soul_shard berserking, lord_of_flames, embrace_chaos, accelerando
3:14.166 default G immolate Fluffy_Pillow 238092.5/1100000: 22% mana | 1.0/5: 20% soul_shard lord_of_flames, embrace_chaos, accelerando(2)
3:15.283 default J conflagrate Fluffy_Pillow 188649.4/1100000: 17% mana | 1.0/5: 20% soul_shard lord_of_flames, embrace_chaos, accelerando(2)
3:16.400 default Q chaos_bolt Fluffy_Pillow 205206.3/1100000: 19% mana | 3.0/5: 60% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(2)
3:17.740 default K conflagrate Fluffy_Pillow 225068.7/1100000: 20% mana | 2.0/5: 40% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(2)
3:18.858 default Q chaos_bolt Fluffy_Pillow 241640.4/1100000: 22% mana | 3.0/5: 60% soul_shard lord_of_flames, embrace_chaos, accelerando(2)
3:20.197 default K conflagrate Fluffy_Pillow 261488.9/1100000: 24% mana | 1.0/5: 20% soul_shard lord_of_flames, embrace_chaos, accelerando(3)
3:21.297 default Q chaos_bolt Fluffy_Pillow 278035.4/1100000: 25% mana | 3.0/5: 60% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(3)
3:22.615 default K conflagrate Fluffy_Pillow 297861.1/1100000: 27% mana | 1.0/5: 20% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(3)
3:23.717 default Q chaos_bolt Fluffy_Pillow 314437.7/1100000: 29% mana | 3.0/5: 60% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(3)
3:25.035 default R incinerate Fluffy_Pillow 333533.5/1100000: 30% mana | 1.0/5: 20% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, nefarious_pact, accelerando
3:26.022 default R incinerate Fluffy_Pillow 281947.8/1100000: 26% mana | 2.0/5: 40% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, nefarious_pact, accelerando(2)
3:26.992 default Q chaos_bolt Fluffy_Pillow 230325.7/1100000: 21% mana | 3.0/5: 60% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, nefarious_pact, accelerando(2)
3:27.921 default R incinerate Fluffy_Pillow 244231.1/1100000: 22% mana | 1.0/5: 20% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, nefarious_pact, accelerando(3)
3:28.878 default C havoc enemy2 192626.5/1100000: 18% mana | 1.0/5: 20% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, nefarious_pact, accelerando(3)
3:29.641 default K conflagrate Fluffy_Pillow 116103.8/1100000: 11% mana | 1.0/5: 20% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, nefarious_pact, accelerando(3)
3:30.404 default R incinerate Fluffy_Pillow 127581.0/1100000: 12% mana | 2.0/5: 40% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, nefarious_pact, accelerando(3)
3:31.357 default Q chaos_bolt Fluffy_Pillow 75916.3/1100000: 7% mana | 3.0/5: 60% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, nefarious_pact, accelerando(3)
3:32.273 default R incinerate Fluffy_Pillow 89695.1/1100000: 8% mana | 1.0/5: 20% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, nefarious_pact, accelerando(3)
3:33.229 default S life_tap Fluffy_Pillow 38075.5/1100000: 3% mana | 1.0/5: 20% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, nefarious_pact, accelerando(3)
3:33.993 default R incinerate Fluffy_Pillow 379567.8/1100000: 35% mana | 1.0/5: 20% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, nefarious_pact, accelerando(3)
3:34.949 default R incinerate Fluffy_Pillow 327948.2/1100000: 30% mana | 1.0/5: 20% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, nefarious_pact, accelerando(3)
3:35.907 default R incinerate Fluffy_Pillow 276379.4/1100000: 25% mana | 1.0/5: 20% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, nefarious_pact, accelerando(4)
3:36.850 default R incinerate Fluffy_Pillow 224771.6/1100000: 20% mana | 1.0/5: 20% soul_shard lord_of_flames, conflagration_of_chaos, nefarious_pact, accelerando(4)
3:37.793 default E immolate Fluffy_Pillow 172477.3/1100000: 16% mana | 1.0/5: 20% soul_shard lord_of_flames, conflagration_of_chaos, devils_due
3:39.150 default R incinerate Fluffy_Pillow 125995.3/1100000: 11% mana | 1.0/5: 20% soul_shard lord_of_flames, conflagration_of_chaos, devils_due
3:40.849 default R incinerate Fluffy_Pillow 84432.2/1100000: 8% mana | 1.0/5: 20% soul_shard lord_of_flames, conflagration_of_chaos, devils_due
3:42.548 default S life_tap Fluffy_Pillow 43023.1/1100000: 4% mana | 1.0/5: 20% soul_shard lord_of_flames, conflagration_of_chaos, devils_due, accelerando
3:43.882 default R incinerate Fluffy_Pillow 392503.2/1100000: 36% mana | 1.0/5: 20% soul_shard lord_of_flames, conflagration_of_chaos, devils_due, accelerando
3:45.555 default Q chaos_bolt Fluffy_Pillow 350934.7/1100000: 32% mana | 2.0/5: 40% soul_shard lord_of_flames, conflagration_of_chaos, accelerando(2)
3:47.786 default G immolate Fluffy_Pillow 384004.1/1100000: 35% mana | 0.0/5: 0% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(2)
3:48.903 default C havoc enemy2 334561.0/1100000: 30% mana | 0.0/5: 0% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(2)
3:50.022 default J conflagrate Fluffy_Pillow 263147.6/1100000: 24% mana | 0.0/5: 0% soul_shard lord_of_flames, embrace_chaos, accelerando(2)
3:51.141 default K conflagrate Fluffy_Pillow 279734.1/1100000: 25% mana | 1.0/5: 20% soul_shard lord_of_flames, embrace_chaos, accelerando(2)
3:52.258 default K conflagrate Fluffy_Pillow 296291.1/1100000: 27% mana | 2.0/5: 40% soul_shard lord_of_flames, accelerando(2)
3:53.375 default N summon_doomguard Fluffy_Pillow 313093.3/1100000: 28% mana | 3.0/5: 60% soul_shard lord_of_flames, conflagration_of_chaos, accelerando(3)
3:54.475 default P dimensional_rift Fluffy_Pillow 329363.3/1100000: 30% mana | 3.0/5: 60% soul_shard lord_of_flames, conflagration_of_chaos, accelerando
3:55.609 default Q chaos_bolt Fluffy_Pillow 345922.8/1100000: 31% mana | 3.0/5: 60% soul_shard lord_of_flames, conflagration_of_chaos, accelerando
3:57.872 default F immolate enemy2 379129.0/1100000: 34% mana | 2.0/5: 40% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(2)
3:58.991 default K conflagrate Fluffy_Pillow 329715.5/1100000: 30% mana | 2.0/5: 40% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(2)
4:00.107 default Q chaos_bolt Fluffy_Pillow 346257.6/1100000: 31% mana | 3.0/5: 60% soul_shard lord_of_flames, embrace_chaos, accelerando(2)
4:01.447 default R incinerate Fluffy_Pillow 366120.0/1100000: 33% mana | 1.0/5: 20% soul_shard lord_of_flames, embrace_chaos, accelerando(2)
4:02.848 default R incinerate Fluffy_Pillow 320887.9/1100000: 29% mana | 1.0/5: 20% soul_shard lord_of_flames, embrace_chaos, accelerando(3)
4:04.226 default Q chaos_bolt Fluffy_Pillow 275616.2/1100000: 25% mana | 3.0/5: 60% soul_shard lord_of_flames, embrace_chaos, accelerando(3)
4:05.547 default K conflagrate Fluffy_Pillow 295487.0/1100000: 27% mana | 2.0/5: 40% soul_shard lord_of_flames, embrace_chaos, accelerando(3)
4:06.647 default Q chaos_bolt Fluffy_Pillow 311507.5/1100000: 28% mana | 3.0/5: 60% soul_shard lord_of_flames, embrace_chaos
4:08.029 default O soul_harvest Fluffy_Pillow 331558.3/1100000: 30% mana | 2.0/5: 40% soul_shard lord_of_flames, embrace_chaos, accelerando(2)
4:08.079 default R incinerate Fluffy_Pillow 332299.4/1100000: 30% mana | 2.0/5: 40% soul_shard soul_harvest, lord_of_flames, embrace_chaos, accelerando(2)
4:09.479 default C havoc enemy2 287051.2/1100000: 26% mana | 2.0/5: 40% soul_shard soul_harvest, lord_of_flames, embrace_chaos, accelerando(2)
4:10.594 default E immolate Fluffy_Pillow 215578.4/1100000: 20% mana | 2.0/5: 40% soul_shard soul_harvest, lord_of_flames, embrace_chaos, accelerando(2)
4:11.712 default Q chaos_bolt Fluffy_Pillow 166150.2/1100000: 15% mana | 2.0/5: 40% soul_shard soul_harvest, lord_of_flames, embrace_chaos, accelerando(2)
4:13.052 default R incinerate Fluffy_Pillow 186012.6/1100000: 17% mana | 1.0/5: 20% soul_shard soul_harvest, lord_of_flames, embrace_chaos, accelerando(2)
4:14.452 default R incinerate Fluffy_Pillow 140764.3/1100000: 13% mana | 1.0/5: 20% soul_shard soul_harvest, lord_of_flames, embrace_chaos, accelerando(2)
4:15.851 default R incinerate Fluffy_Pillow 95502.1/1100000: 9% mana | 1.0/5: 20% soul_shard soul_harvest, lord_of_flames, embrace_chaos, accelerando(3)
4:17.228 default S life_tap Fluffy_Pillow 50215.3/1100000: 5% mana | 1.0/5: 20% soul_shard soul_harvest, lord_of_flames, accelerando(3)
4:18.328 default R incinerate Fluffy_Pillow 396761.8/1100000: 36% mana | 1.0/5: 20% soul_shard soul_harvest, lord_of_flames, accelerando(3)
4:19.706 default R incinerate Fluffy_Pillow 351370.5/1100000: 32% mana | 1.0/5: 20% soul_shard soul_harvest, lord_of_flames
4:21.149 default Q chaos_bolt Fluffy_Pillow 306125.4/1100000: 28% mana | 2.0/5: 40% soul_shard soul_harvest, lord_of_flames
4:23.447 default G immolate Fluffy_Pillow 339177.8/1100000: 31% mana | 0.0/5: 0% soul_shard soul_harvest, lord_of_flames, embrace_chaos
4:24.600 default J conflagrate Fluffy_Pillow 289761.6/1100000: 26% mana | 0.0/5: 0% soul_shard soul_harvest, lord_of_flames, embrace_chaos
4:25.752 default Q chaos_bolt Fluffy_Pillow 306331.0/1100000: 28% mana | 3.0/5: 60% soul_shard soul_harvest, lord_of_flames, conflagration_of_chaos, embrace_chaos
4:27.132 default K conflagrate Fluffy_Pillow 326180.6/1100000: 30% mana | 1.0/5: 20% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando
4:28.264 default K conflagrate Fluffy_Pillow 342710.9/1100000: 31% mana | 2.0/5: 40% soul_shard lord_of_flames, embrace_chaos, accelerando
4:29.396 default Q chaos_bolt Fluffy_Pillow 359241.2/1100000: 33% mana | 3.0/5: 60% soul_shard lord_of_flames, embrace_chaos, accelerando
4:30.757 default C havoc enemy2 379115.6/1100000: 34% mana | 2.0/5: 40% soul_shard lord_of_flames, embrace_chaos, accelerando
4:31.890 default J conflagrate Fluffy_Pillow 307660.5/1100000: 28% mana | 2.0/5: 40% soul_shard lord_of_flames, embrace_chaos, accelerando
4:33.023 default P dimensional_rift Fluffy_Pillow 324317.1/1100000: 29% mana | 3.0/5: 60% soul_shard lord_of_flames, embrace_chaos, accelerando(2)
4:34.142 default Q chaos_bolt Fluffy_Pillow 340903.7/1100000: 31% mana | 3.0/5: 60% soul_shard lord_of_flames, embrace_chaos, accelerando(2)
4:35.482 default R incinerate Fluffy_Pillow 361033.8/1100000: 33% mana | 1.0/5: 20% soul_shard lord_of_flames, embrace_chaos, accelerando(3)
4:36.859 default R incinerate Fluffy_Pillow 315747.0/1100000: 29% mana | 1.0/5: 20% soul_shard lord_of_flames, embrace_chaos, accelerando(3)
4:38.237 default J conflagrate Fluffy_Pillow 270532.4/1100000: 25% mana | 1.0/5: 20% soul_shard lord_of_flames, embrace_chaos, accelerando(4)
4:39.322 default Q chaos_bolt Fluffy_Pillow 286921.4/1100000: 26% mana | 3.0/5: 60% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos
4:40.704 default L service_imp Fluffy_Pillow 306798.9/1100000: 28% mana | 1.0/5: 20% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos
4:41.854 default R incinerate Fluffy_Pillow 323339.5/1100000: 29% mana | 0.0/5: 0% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos
4:43.296 default R incinerate Fluffy_Pillow 278080.0/1100000: 25% mana | 0.0/5: 0% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos
4:44.739 default J conflagrate Fluffy_Pillow 232834.9/1100000: 21% mana | 1.0/5: 20% soul_shard lord_of_flames, conflagration_of_chaos
4:46.087 default E immolate Fluffy_Pillow 252223.3/1100000: 23% mana | 2.0/5: 40% soul_shard lord_of_flames, conflagration_of_chaos
4:47.239 default Q chaos_bolt Fluffy_Pillow 202792.7/1100000: 18% mana | 2.0/5: 40% soul_shard lord_of_flames, conflagration_of_chaos
4:49.538 default R incinerate Fluffy_Pillow 235860.7/1100000: 21% mana | 0.0/5: 0% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando
4:50.957 default C havoc enemy2 190582.6/1100000: 17% mana | 0.0/5: 0% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(2)
4:52.075 default J conflagrate Fluffy_Pillow 119154.4/1100000: 11% mana | 0.0/5: 0% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(2)
4:53.192 default R incinerate Fluffy_Pillow 135711.3/1100000: 12% mana | 1.0/5: 20% soul_shard lord_of_flames, embrace_chaos, accelerando(2)
4:54.592 default R incinerate Fluffy_Pillow 90463.0/1100000: 8% mana | 1.0/5: 20% soul_shard lord_of_flames, accelerando(2)
4:55.992 default Q chaos_bolt Fluffy_Pillow 45214.8/1100000: 4% mana | 2.0/5: 40% soul_shard lord_of_flames, accelerando(2)

Stats

Raid-Buffed Unbuffed Gear Amount
Strength 4201 3876 0
Agility 7254 6929 0
Stamina 54592 54592 34105
Intellect 49775 48068 38456 (1278)
Spirit 1 1 0
Health 3275520 3275520 0
Mana 1100000 1100000 0
Soul Shard 5 5 0
Spell Power 49775 48068 0
Crit 20.62% 20.62% 6248
Haste 30.76% 29.74% 10197
Damage / Heal Versatility 3.41% 3.41% 1620
ManaReg per Second 14383 14271 0
Mastery 66.15% 66.15% 5618
Armor 1954 1954 1954
Run Speed 7 0 0

Gear

Source Slot Average Item Level: 906.00
Local Head Eyes of Azj'Aqir
ilevel: 900, stats: { 253 Armor, +3255 Sta, +2170 Int, +1074 Haste, +578 Vers }
Local Neck Radiant String of Scorpid Eyes
ilevel: 900, stats: { +1831 Sta, +2011 Haste, +922 Crit }, enchant: mark_of_the_hidden_satyr
Local Shoulders Pauldrons of Azj'Aqir
ilevel: 900, stats: { 233 Armor, +2442 Sta, +1628 Int, +752 Mastery, +487 Vers }
Local Chest Robes of Fluctuating Energy
ilevel: 900, stats: { 311 Armor, +3255 Sta, +2170 Int, +1145 Haste, +507 Mastery }
Local Waist Man'ari Skullbuckled Cinch
ilevel: 900, stats: { 175 Armor, +2442 Sta, +1628 Int, +699 Haste, +540 Mastery }
Local Legs Leggings of Azj'Aqir
ilevel: 900, stats: { 272 Armor, +3255 Sta, +2170 Int, +932 Crit, +720 Haste }
Local Feet Outcast Wanderer's Footrags
ilevel: 910, stats: { 222 Armor, +2680 Sta, +1786 Int, +864 Crit, +422 Mastery }
Local Wrists Woven Lasher Tendril Bracers
ilevel: 900, stats: { 136 Armor, +1831 Sta, +1221 Int, +644 Haste, +285 Vers }
Local Hands Clutch of Azj'Aqir
ilevel: 900, stats: { 194 Armor, +2442 Sta, +1628 Int, +859 Crit, +380 Mastery }
Local Finger1 Ring of the Scoured Clan
ilevel: 900, stats: { +1831 Sta, +2095 Mastery, +838 Haste }, enchant: { +200 Haste }
Local Finger2 Sephuz's Secret
ilevel: 940, stats: { +2658 Sta, +1068 Haste, +2671 Crit }, enchant: { +200 Haste }
Local Trinket1 Whispers in the Dark
ilevel: 905, stats: { +2162 Int }
Local Trinket2 Erratic Metronome
ilevel: 900, stats: { +2063 Int }
Local Back Astromancer's Greatcloak
ilevel: 905, stats: { 158 Armor, +1918 Sta, +1278 StrAgiInt, +676 Haste, +270 Vers }, enchant: { +200 Int }
Local Main Hand Scepter of Sargeras
ilevel: 929, weapon: { 7005 - 10509, 3.6 }, stats: { +2843 Int, +4265 Sta, +922 Haste, +922 Mastery, +15509 Int }, relics: { +61 ilevels, +59 ilevels, +61 ilevels }

Talents

Level
15 Backdraft (Destruction Warlock) Roaring Blaze (Destruction Warlock) Shadowburn (Destruction Warlock)
30 Reverse Entropy (Destruction Warlock) Eradication (Destruction Warlock) Empowered Life Tap
45 Demonic Circle Mortal Coil Shadowfury
60 Cataclysm (Destruction Warlock) Fire and Brimstone (Destruction Warlock) Soul Harvest
75 Demon Skin Burning Rush Dark Pact
90 Grimoire of Supremacy Grimoire of Service Grimoire of Sacrifice
100 Wreak Havoc (Destruction Warlock) Channel Demonfire (Destruction Warlock) Soul Conduit

Profile

warlock="Sephuz"
level=110
race=troll
role=spell
position=back
talents=2203021
artifact=38:0:0:0:0:803:1:804:3:805:3:806:3:807:3:808:3:809:3:810:3:811:3:812:3:813:1:814:1:815:1:816:1:817:1:818:1:1355:1:1392:1:1609:4:1610:1:1611:1:1713:1
spec=destruction

# This default action priority list is automatically created based on your character.
# It is a attempt to provide you with a action list that is both simple and practicable,
# while resulting in a meaningful and good simulation. It may not result in the absolutely highest possible dps.
# Feel free to edit, adapt and improve it to your own needs.
# SimulationCraft is always looking for updates and improvements to the default action lists.

# Executed before combat begins. Accepts non-harmful actions only.
actions.precombat=flask,type=whispered_pact
actions.precombat+=/food,type=azshari_salad
actions.precombat+=/summon_pet,if=!talent.grimoire_of_supremacy.enabled&(!talent.grimoire_of_sacrifice.enabled|buff.demonic_power.down)
actions.precombat+=/summon_infernal,if=talent.grimoire_of_supremacy.enabled&artifact.lord_of_flames.rank>0
actions.precombat+=/summon_infernal,if=talent.grimoire_of_supremacy.enabled&active_enemies>1
actions.precombat+=/summon_doomguard,if=talent.grimoire_of_supremacy.enabled&active_enemies=1&artifact.lord_of_flames.rank=0
actions.precombat+=/augmentation,type=defiled
actions.precombat+=/snapshot_stats
actions.precombat+=/grimoire_of_sacrifice,if=talent.grimoire_of_sacrifice.enabled
actions.precombat+=/life_tap,if=talent.empowered_life_tap.enabled&!buff.empowered_life_tap.remains
actions.precombat+=/potion,name=prolonged_power
actions.precombat+=/chaos_bolt

# Executed every time the actor is available.
actions=havoc,target=2,if=active_enemies>1&(active_enemies<4|talent.wreak_havoc.enabled&active_enemies<6)&!debuff.havoc.remains
actions+=/dimensional_rift,if=charges=3
actions+=/immolate,if=remains<=tick_time
actions+=/immolate,cycle_targets=1,if=active_enemies>1&remains<=tick_time&(!talent.roaring_blaze.enabled|(!debuff.roaring_blaze.remains&action.conflagrate.charges<2+set_bonus.tier19_4pc))
actions+=/immolate,if=talent.roaring_blaze.enabled&remains<=duration&!debuff.roaring_blaze.remains&target.time_to_die>10&(action.conflagrate.charges=2+set_bonus.tier19_4pc|(action.conflagrate.charges>=1+set_bonus.tier19_4pc&action.conflagrate.recharge_time<cast_time+gcd)|target.time_to_die<24)
actions+=/berserking
actions+=/blood_fury
actions+=/arcane_torrent
actions+=/potion,name=deadly_grace,if=(buff.soul_harvest.remains|trinket.proc.any.react|target.time_to_die<=45)
actions+=/shadowburn,if=buff.conflagration_of_chaos.remains<=action.chaos_bolt.cast_time
actions+=/shadowburn,if=(charges=1+set_bonus.tier19_4pc&recharge_time<action.chaos_bolt.cast_time|charges=2+set_bonus.tier19_4pc)&soul_shard<5
actions+=/conflagrate,if=talent.roaring_blaze.enabled&(charges=2+set_bonus.tier19_4pc|(charges>=1+set_bonus.tier19_4pc&recharge_time<gcd)|target.time_to_die<24)
actions+=/conflagrate,if=talent.roaring_blaze.enabled&debuff.roaring_blaze.stack>0&dot.immolate.remains>dot.immolate.duration*0.3&(active_enemies=1|soul_shard<3)&soul_shard<5
actions+=/conflagrate,if=!talent.roaring_blaze.enabled&buff.backdraft.stack<3&buff.conflagration_of_chaos.remains<=action.chaos_bolt.cast_time
actions+=/conflagrate,if=!talent.roaring_blaze.enabled&buff.backdraft.stack<3&(charges=1+set_bonus.tier19_4pc&recharge_time<action.chaos_bolt.cast_time|charges=2+set_bonus.tier19_4pc)&soul_shard<5
actions+=/life_tap,if=talent.empowered_life_tap.enabled&buff.empowered_life_tap.remains<=gcd
actions+=/dimensional_rift,if=equipped.144369&!buff.lessons_of_spacetime.remains&((!talent.grimoire_of_supremacy.enabled&!cooldown.summon_doomguard.remains)|(talent.grimoire_of_service.enabled&!cooldown.service_pet.remains)|(talent.soul_harvest.enabled&!cooldown.soul_harvest.remains))
actions+=/service_pet
actions+=/summon_infernal,if=artifact.lord_of_flames.rank>0&!buff.lord_of_flames.remains
actions+=/summon_doomguard,if=!talent.grimoire_of_supremacy.enabled&spell_targets.infernal_awakening<=2&(target.time_to_die>180|target.health.pct<=20|target.time_to_die<30)
actions+=/summon_infernal,if=!talent.grimoire_of_supremacy.enabled&spell_targets.infernal_awakening>2
actions+=/summon_doomguard,if=talent.grimoire_of_supremacy.enabled&spell_targets.summon_infernal=1&artifact.lord_of_flames.rank>0&buff.lord_of_flames.remains&!pet.doomguard.active
actions+=/summon_doomguard,if=talent.grimoire_of_supremacy.enabled&spell_targets.summon_infernal=1&equipped.132379&!cooldown.sindorei_spite_icd.remains
actions+=/summon_infernal,if=talent.grimoire_of_supremacy.enabled&spell_targets.summon_infernal>1&equipped.132379&!cooldown.sindorei_spite_icd.remains
actions+=/soul_harvest
actions+=/channel_demonfire,if=dot.immolate.remains>cast_time
actions+=/havoc,if=active_enemies=1&talent.wreak_havoc.enabled&equipped.132375&!debuff.havoc.remains
actions+=/rain_of_fire,if=active_enemies>=3&cooldown.havoc.remains<=12&!talent.wreak_havoc.enabled
actions+=/rain_of_fire,if=active_enemies>=6&talent.wreak_havoc.enabled
actions+=/dimensional_rift,if=!equipped.144369|charges>1|((!talent.grimoire_of_service.enabled|recharge_time<cooldown.service_pet.remains)&(!talent.soul_harvest.enabled|recharge_time<cooldown.soul_harvest.remains)&(!talent.grimoire_of_supremacy.enabled|recharge_time<cooldown.summon_doomguard.remains))
actions+=/life_tap,if=talent.empowered_life_tap.enabled&buff.empowered_life_tap.remains<duration*0.3
actions+=/cataclysm
actions+=/chaos_bolt,if=(cooldown.havoc.remains>12&cooldown.havoc.remains|active_enemies<3|talent.wreak_havoc.enabled&active_enemies<6)&(set_bonus.tier19_4pc=0|!talent.eradication.enabled|buff.embrace_chaos.remains<=cast_time|soul_shard>=3)
actions+=/shadowburn
actions+=/conflagrate,if=!talent.roaring_blaze.enabled&buff.backdraft.stack<3
actions+=/immolate,if=!talent.roaring_blaze.enabled&remains<=duration*0.3
actions+=/incinerate
actions+=/life_tap

head=eyes_of_azjaqir,id=138314,bonus_id=3445
neck=radiant_string_of_scorpid_eyes,id=140898,bonus_id=3445,enchant_id=5439
shoulders=pauldrons_of_azjaqir,id=138323,bonus_id=3445
back=astromancers_greatcloak,id=140909,bonus_id=3518,enchant_id=5436
chest=robes_of_fluctuating_energy,id=140848,bonus_id=3445
wrists=woven_lasher_tendril_bracers,id=140886,bonus_id=3445
hands=clutch_of_azjaqir,id=138311,bonus_id=3445
waist=manari_skullbuckled_cinch,id=140887,bonus_id=3445
legs=leggings_of_azjaqir,id=138317,bonus_id=3445
feet=outcast_wanderers_footrags,id=140914,bonus_id=3519
finger1=ring_of_the_scoured_clan,id=140897,bonus_id=3445,enchant=binding_of_haste
finger2=sephuzs_secret,id=132452,ilevel=940,enchant=binding_of_haste
trinket1=whispers_in_the_dark,id=140809,ilevel=905
trinket2=erratic_metronome,id=140792,ilevel=900
main_hand=scepter_of_sargeras,id=128941,ilevel=929,gem_id=140826/140837/140826,relic_id=3519/3518:3518/3519

# Gear Summary
# gear_ilvl=905.93
# gear_stamina=34105
# gear_intellect=38456
# gear_crit_rating=6248
# gear_haste_rating=10197
# gear_mastery_rating=5618
# gear_versatility_rating=1620
# gear_armor=1954
# set_bonus=tier19_2pc=1
# set_bonus=tier19_4pc=1
default_pet=imp

Shoulders : 1397796 dps, 837874 dps to main target

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR
1397795.9 1397795.9 1253.5 / 0.090% 249899.9 / 17.9% 44.0
RPS Out RPS In Primary Resource Waiting APM Active Skill
25248.2 25248.2 Mana 0.00% 50.0 100.0% 100%
Talents
  • 15: Roaring Blaze (Destruction Warlock)
  • 30: Eradication (Destruction Warlock)
  • 60: Soul Harvest
  • 90: Grimoire of Service
  • 100: Wreak Havoc (Destruction Warlock)
  • Talent Calculator
Artifact

Charts

Abilities

Damage Stats DPS DPS% Execute Interval DPE DPET Type Count Hit Crit Avg Crit% Up%
Shoulders 1397796
Chaos Bolt 410970 29.5% 60.6 4.83sec 2037693 1358707 Direct 115.8 0 1066751 1066751 100.0%  

Stats details: chaos_bolt

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 60.64 115.83 0.00 0.00 1.4997 0.0000 123562140.48 123562140.48 0.00 1358706.64 1358706.64
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
crit 115.83 100.00% 1066750.67 659569 1736083 1067177.52 993090 1153790 123562140 123562140 0.00
 
 

Action details: chaos_bolt

Static Values
  • id:116858
  • school:chromatic
  • resource:soul_shard
  • range:40.0
  • travel_speed:16.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:2.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:3.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:116858
  • name:Chaos Bolt
  • school:chromatic
  • tooltip:
  • description:Unleashes a devastating blast of chaos, causing {$s1=1} Chaos damage. Chaos Bolt always critically strikes and your critical strike chance increases its damage.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:4.000000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
Conflagrate 172698 12.4% 48.3 6.22sec 1074067 1032383 Direct 96.0 318051 720410 539914 55.1%  

Stats details: conflagrate

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 48.28 96.04 0.00 0.00 1.0404 0.0000 51853494.52 51853494.52 0.00 1032382.87 1032382.87
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 43.08 44.86% 318050.91 198565 522634 318288.15 281042 364785 13702625 13702625 0.00
crit 52.96 55.14% 720409.75 397128 1207351 720747.11 639461 799462 38150869 38150869 0.00
 
 

Action details: conflagrate

Static Values
  • id:17962
  • school:fire
  • resource:chi
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:9.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:talent.roaring_blaze.enabled&(charges=2+set_bonus.tier19_4pc|(charges>=1+set_bonus.tier19_4pc&recharge_time<gcd)|target.time_to_die<24)
Spelldata
  • id:17962
  • name:Conflagrate
  • school:fire
  • tooltip:
  • description:Triggers an explosion on the target, dealing {$s1=1} Fire damage.{$?s196406=false}[ Reduces the cast time of Incinerate and Chaos Bolt by {$117828s1=30}% for {$117828d=10 seconds}.][] |cFFFFFFFFGenerates 1 Soul Shard.|r
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:2.265510
  • base_dd_min:1.00
  • base_dd_max:1.00
 
Cry Havoc 42234 3.0% 52.3 5.55sec 242802 0 Direct 104.6 105146 210105 121401 15.5%  

Stats details: cry_havoc

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 52.30 104.61 0.00 0.00 0.0000 0.0000 12699574.49 12699574.49 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 88.41 84.51% 105146.22 71506 168049 105212.87 97076 115150 9295706 9295706 0.00
crit 16.20 15.49% 210104.60 143015 336093 210241.32 173714 256895 3403868 3403868 0.00
 
 

Action details: cry_havoc

Static Values
  • id:243011
  • school:chromatic
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:243011
  • name:Cry Havoc
  • school:chromatic
  • tooltip:
  • description:Deals {$s2=0} Chaos damage to enemies within $A2 yards.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:1.000000
  • base_dd_min:0.00
  • base_dd_max:0.00
 
Deadly Grace 6312 0.4% 14.3 2.06sec 130167 0 Direct 14.3 112693 226025 130166 15.4%  

Stats details: deadly_grace

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 14.31 14.31 0.00 0.00 0.0000 0.0000 1862758.78 1862758.78 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 12.10 84.58% 112692.62 95954 126659 112693.95 101437 125251 1364014 1364014 0.00
crit 2.21 15.42% 226024.92 191907 253317 204222.19 0 253317 498745 498745 0.00
 
 

Action details: deadly_grace

Static Values
  • id:188091
  • school:arcane
  • resource:none
  • range:40.0
  • travel_speed:25.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:188091
  • name:Deadly Grace
  • school:arcane
  • tooltip:
  • description:Deal {$s1=63339 to 95008} Arcane damage.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:63338.72
  • base_dd_max:95008.08
 
Immolate 319421 22.9% 20.0 15.23sec 4805397 4557226 Direct 38.6 166307 332910 272098 63.5%  
Periodic 292.7 178459 356834 291742 63.5% 196.0%

Stats details: immolate

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 19.96 38.60 292.75 292.75 1.0545 2.0150 95911385.21 95911385.21 0.00 156989.09 4557226.32
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 14.09 36.50% 166306.69 104369 274646 166339.03 135048 199253 2343497 2343497 0.00
crit 24.51 63.50% 332910.27 208732 549340 332942.14 283956 387222 8160324 8160324 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 106.8 36.49% 178458.98 79 545774 178751.92 147700 220711 19063887 19063887 0.00
crit 185.9 63.51% 356833.66 129 1091526 357483.84 307706 409882 66343676 66343676 0.00
 
 

Action details: immolate

Static Values
  • id:348
  • school:fire
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:66000.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:1.50
  • base_crit:0.48
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:remains<=tick_time
Spelldata
  • id:348
  • name:Immolate
  • school:fire
  • tooltip:
  • description:Burns the enemy, causing {$s1=1} Fire damage immediately and an additional $157736o1 Fire damage over {$157736d=18 seconds}. |cFFFFFFFFPeriodic damage has a {$193541s1=15}% chance to generate 1 Soul Shard. Chance doubled on critical strikes.|r
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:1.332000
  • base_dd_min:1.00
  • base_dd_max:1.00
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.721500
  • base_td:0.00
  • dot_duration:18.00
  • base_tick_time:3.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
 
Incinerate 151874 10.9% 75.3 3.84sec 606308 473012 Direct 144.1 274394 548758 316968 15.5%  

Stats details: incinerate

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 75.34 144.11 0.00 0.00 1.2818 0.0000 45679690.80 45679690.80 0.00 473011.75 473011.75
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 121.75 84.48% 274393.91 168705 444056 274537.35 254928 297156 33407563 33407563 0.00
crit 22.36 15.52% 548758.13 337435 888095 549033.23 466712 685986 12272127 12272127 0.00
 
 

Action details: incinerate

Static Values
  • id:29722
  • school:fire
  • resource:mana
  • range:40.0
  • travel_speed:20.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:66000.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:1.88
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:29722
  • name:Incinerate
  • school:fire
  • tooltip:
  • description:Draws fire toward the enemy, dealing {$s2=0} Fire damage.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:2.331000
  • base_dd_min:0.00
  • base_dd_max:0.00
 
Mark of the Hidden Satyr 10632 0.8% 19.9 15.12sec 160873 0 Direct 19.9 139374 278752 160877 15.4%  

Stats details: mark_of_the_hidden_satyr

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 19.86 19.86 0.00 0.00 0.0000 0.0000 3194369.22 3194369.22 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 16.79 84.58% 139374.16 127689 177284 139421.18 129304 157265 2340607 2340607 0.00
crit 3.06 15.42% 278751.58 255377 354568 265745.62 0 354568 853762 853762 0.00
 
 

Action details: mark_of_the_hidden_satyr

Static Values
  • id:191259
  • school:fire
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:191259
  • name:Mark of the Hidden Satyr
  • school:fire
  • tooltip:
  • description:Deals fire damage.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:2.500000
  • spell_power_mod.direct:2.000000
  • base_dd_min:0.00
  • base_dd_max:0.00
 
pet - imp 50941 / 50941
Firebolt 50941 3.6% 108.5 2.77sec 141038 115560 Direct 107.7 123052 245968 142127 15.5%  

Stats details: firebolt

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 108.51 107.68 0.00 0.00 1.2205 0.0000 15304267.59 15304267.59 0.00 115559.72 115559.72
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 90.97 84.48% 123051.97 75338 156899 123110.20 118862 128384 11193694 11193694 0.00
crit 16.71 15.52% 245968.10 150676 313798 246067.20 216433 277126 4110574 4110574 0.00
 
 

Action details: firebolt

Static Values
  • id:3110
  • school:fire
  • resource:energy
  • range:40.0
  • travel_speed:16.0000
  • trigger_gcd:0.5000
  • min_gcd:0.7500
  • base_cost:40.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:1.75
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:3110
  • name:Firebolt
  • school:fire
  • tooltip:
  • description:Deals {$s1=1} Fire damage to a target.$?a231795[ Damage increased by {$231795s1=50}% if you have Immolated the target.][] |cFF777777(Right-Click to toggle)|r
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:1.000000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
pet - service_imp 149249 / 47741
Firebolt 149249 3.4% 49.1 5.53sec 290994 254453 Direct 48.9 253506 506739 292695 15.5%  

Stats details: firebolt

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 49.14 48.86 0.00 0.00 1.1436 0.0000 14300791.43 14300791.43 0.00 254453.43 254453.43
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 41.30 84.53% 253506.20 150676 313798 253828.32 238176 270440 10469573 10469573 0.00
crit 7.56 15.47% 506739.25 301351 627596 507159.12 0 627596 3831218 3831218 0.00
 
 

Action details: firebolt

Static Values
  • id:3110
  • school:fire
  • resource:energy
  • range:40.0
  • travel_speed:16.0000
  • trigger_gcd:0.5000
  • min_gcd:0.7500
  • base_cost:40.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:1.75
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:3110
  • name:Firebolt
  • school:fire
  • tooltip:
  • description:Deals {$s1=1} Fire damage to a target.$?a231795[ Damage increased by {$231795s1=50}% if you have Immolated the target.][] |cFF777777(Right-Click to toggle)|r
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:1.000000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
pet - infernal 144956 / 12277
Immolation 112868 0.7% 1.0 0.00sec 2821818 0 Periodic 46.4 52625 105240 60800 15.5% 8.1%

Stats details: immolation

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 23.21 46.41 0.0000 1.0507 2821817.67 2821817.67 0.00 115738.39 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 39.2 84.46% 52625.33 41971 55401 52627.56 49148 54726 2062968 2062968 0.00
crit 7.2 15.54% 105240.36 83941 110802 105178.80 0 110802 758849 758849 0.00
 
 

Action details: immolation

Static Values
  • id:19483
  • school:fire
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:!ticking
Spelldata
  • id:19483
  • name:Immolation
  • school:fire
  • tooltip:Burns nearby enemies for {$20153s1=0} fire damage every $t1 seconds.
  • description:Burns nearby enemies for {$20153s1=0} fire damage every $t1 seconds.
 

Action details: immolation_tick

Static Values
  • id:20153
  • school:fire
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:20153
  • name:Immolation
  • school:fire
  • tooltip:
  • description:Deals Fire damage to all enemies near the caster.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.650000
  • base_dd_min:0.00
  • base_dd_max:0.00
 
melee 32088 0.2% 22.0 1.11sec 36446 32989 Direct 22.0 31502 62995 36446 15.7%  

Stats details: melee

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 22.01 22.01 0.00 0.00 1.1048 0.0000 802227.01 1179349.69 31.98 32989.02 32989.02
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 18.56 84.30% 31502.41 25099 33130 31502.95 29583 33130 584559 859358 31.98
crit 3.46 15.70% 62994.56 50197 66260 61434.74 0 66260 217668 319992 31.19
 
 

Action details: melee

Static Values
  • id:0
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Weapon
  • normalized:false
  • weapon_power_mod:0.285714
  • weapon_multiplier:1.00
 
pet - doomguard 112941 / 9557
Doom Bolt 112941 0.7% 10.9 2.20sec 259319 120057 Direct 10.9 224385 448896 259337 15.6%  

Stats details: doom_bolt

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 10.89 10.89 0.00 0.00 2.1601 0.0000 2823622.87 2823622.87 0.00 120057.10 120057.10
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 9.19 84.43% 224385.26 210688 278108 224431.11 210688 270149 2062791 2062791 0.00
crit 1.69 15.57% 448896.24 421376 556216 373941.22 0 556216 760832 760832 0.00
 
 

Action details: doom_bolt

Static Values
  • id:85692
  • school:shadow
  • resource:energy
  • range:30.0
  • travel_speed:20.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:35.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:3.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:85692
  • name:Doom Bolt
  • school:shadow
  • tooltip:
  • description:Sends a shadowy bolt at the enemy, causing {$s1=1} Shadow damage. Deals {$s2=20}% additional damage to targets below 20% health.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:2.750000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
pet - lord_of_flames_infernal 144781 / 12262
Immolation 112757 0.7% 1.0 0.00sec 2819027 0 Periodic 46.4 52627 105218 60740 15.4% 8.1%

Stats details: immolation

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 23.21 46.41 0.0000 1.0507 2819026.85 2819026.85 0.00 115623.92 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 39.3 84.57% 52627.32 41971 55401 52629.60 49259 54824 2065759 2065759 0.00
crit 7.2 15.43% 105218.48 83941 110802 105178.32 0 110802 753268 753268 0.00
 
 

Action details: immolation

Static Values
  • id:19483
  • school:fire
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:!ticking
Spelldata
  • id:19483
  • name:Immolation
  • school:fire
  • tooltip:Burns nearby enemies for {$20153s1=0} fire damage every $t1 seconds.
  • description:Burns nearby enemies for {$20153s1=0} fire damage every $t1 seconds.
 

Action details: immolation_tick

Static Values
  • id:20153
  • school:fire
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:20153
  • name:Immolation
  • school:fire
  • tooltip:
  • description:Deals Fire damage to all enemies near the caster.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.650000
  • base_dd_min:0.00
  • base_dd_max:0.00
 
melee 32025 0.2% 22.0 1.11sec 36374 32924 Direct 22.0 31505 62969 36375 15.5%  

Stats details: melee

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 22.01 22.01 0.00 0.00 1.1048 0.0000 800652.52 1177035.05 31.98 32924.28 32924.28
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 18.60 84.52% 31504.76 25099 33130 31505.31 29114 33130 586134 861672 31.98
crit 3.41 15.48% 62968.65 50197 66260 61391.32 0 66260 214519 315363 31.17
 
 

Action details: melee

Static Values
  • id:0
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Weapon
  • normalized:false
  • weapon_power_mod:0.285714
  • weapon_multiplier:1.00
 
pet - lord_of_flames_infernal 144947 / 12276
Immolation 112907 0.7% 1.0 0.00sec 2822796 0 Periodic 46.4 52625 105241 60822 15.6% 8.1%

Stats details: immolation

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 23.21 46.41 0.0000 1.0507 2822795.51 2822795.51 0.00 115778.50 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 39.2 84.42% 52625.27 41971 55401 52627.88 49505 54691 2061991 2061991 0.00
crit 7.2 15.58% 105241.04 83941 110802 105194.73 0 110802 760805 760805 0.00
 
 

Action details: immolation

Static Values
  • id:19483
  • school:fire
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:!ticking
Spelldata
  • id:19483
  • name:Immolation
  • school:fire
  • tooltip:Burns nearby enemies for {$20153s1=0} fire damage every $t1 seconds.
  • description:Burns nearby enemies for {$20153s1=0} fire damage every $t1 seconds.
 

Action details: immolation_tick

Static Values
  • id:20153
  • school:fire
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:20153
  • name:Immolation
  • school:fire
  • tooltip:
  • description:Deals Fire damage to all enemies near the caster.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.650000
  • base_dd_min:0.00
  • base_dd_max:0.00
 
melee 32039 0.2% 22.0 1.11sec 36391 32939 Direct 22.0 31501 63013 36391 15.5%  

Stats details: melee

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 22.01 22.01 0.00 0.00 1.1048 0.0000 801016.79 1177570.55 31.98 32939.25 32939.25
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 18.60 84.48% 31500.71 25099 33130 31501.73 29365 32898 585770 861137 31.98
crit 3.42 15.52% 63012.87 50197 66260 61649.80 0 66260 215247 316434 31.28
 
 

Action details: melee

Static Values
  • id:0
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Weapon
  • normalized:false
  • weapon_power_mod:0.285714
  • weapon_multiplier:1.00
 
pet - lord_of_flames_infernal 144868 / 12270
Immolation 112872 0.7% 1.0 0.00sec 2821911 0 Periodic 46.4 52624 105252 60803 15.5% 8.1%

Stats details: immolation

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 23.21 46.41 0.0000 1.0507 2821911.35 2821911.35 0.00 115742.23 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 39.2 84.46% 52624.30 41971 55401 52626.09 48494 54726 2062875 2062875 0.00
crit 7.2 15.54% 105251.52 83941 110802 105225.36 0 110802 759037 759037 0.00
 
 

Action details: immolation

Static Values
  • id:19483
  • school:fire
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:!ticking
Spelldata
  • id:19483
  • name:Immolation
  • school:fire
  • tooltip:Burns nearby enemies for {$20153s1=0} fire damage every $t1 seconds.
  • description:Burns nearby enemies for {$20153s1=0} fire damage every $t1 seconds.
 

Action details: immolation_tick

Static Values
  • id:20153
  • school:fire
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:20153
  • name:Immolation
  • school:fire
  • tooltip:
  • description:Deals Fire damage to all enemies near the caster.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.650000
  • base_dd_min:0.00
  • base_dd_max:0.00
 
melee 31996 0.2% 22.0 1.11sec 36341 32894 Direct 22.0 31500 63016 36342 15.4%  

Stats details: melee

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 22.01 22.01 0.00 0.00 1.1048 0.0000 799923.44 1175963.22 31.98 32894.29 32894.29
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 18.63 84.64% 31500.45 25099 33130 31500.25 29491 33130 586863 862744 31.98
crit 3.38 15.36% 63015.92 50197 66260 61411.00 0 66260 213060 313219 31.17
 
 

Action details: melee

Static Values
  • id:0
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Weapon
  • normalized:false
  • weapon_power_mod:0.285714
  • weapon_multiplier:1.00
 
pet - shadowy_tear 133866 / 19560
Shadow Bolt 133866 1.4% 3.3 71.37sec 1754668 0 Periodic 36.6 138333 276651 159886 15.6% 15.1%

Stats details: shadow_bolt

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 3.33 0.00 36.80 36.60 0.0000 1.2349 5851245.03 5851245.03 0.00 128762.93 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 30.9 84.42% 138333.19 67 170467 137727.01 0 170467 4273661 4273661 0.00
crit 5.7 15.58% 276650.82 161 340934 268577.34 0 340934 1577584 1577584 0.00
 
 

Action details: shadow_bolt

Static Values
  • id:196657
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:20.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:196657
  • name:Shadow Bolt
  • school:shadow
  • tooltip:
  • description:Sends a shadowy bolt at the enemy, causing {$s1=1} Shadow damage.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • dot_duration:14.00
  • base_tick_time:2.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
 
pet - flame_rift 302763 / 83994
Searing Bolt 302763 6.0% 66.3 2.57sec 378964 1142546 Direct 65.9 72390 0 72390 0.0%  
Periodic 140.7 125196 250323 144641 15.5% 46.2%

Stats details: searing_bolt

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 66.28 65.90 140.68 140.68 0.3317 0.9892 25117740.14 25117740.14 0.00 155882.04 1142546.40
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 65.90 100.00% 72390.08 61390 85234 72431.43 0 85234 4770629 4770629 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 118.8 84.46% 125195.88 123 170497 124615.57 0 151303 14875015 14875015 0.00
crit 21.9 15.54% 250323.09 284 340994 249015.36 0 340994 5472096 5472096 0.00
 
 

Action details: searing_bolt

Static Values
  • id:243050
  • school:fire
  • resource:energy
  • range:100.0
  • travel_speed:20.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:1.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:243050
  • name:Searing Bolt
  • school:fire
  • tooltip:Burning for $w2 Fire damage every $t2 sec.
  • description:Sends a searing bolt at the enemy, causing {$s1=1} Fire damage, and an additional $o2 Fire damage over {$d=30 seconds}, stacking up to {$u=20} times.
Direct Damage
  • may_crit:false
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:1.000000
  • base_dd_min:1.00
  • base_dd_max:1.00
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.100000
  • base_td:1.00
  • dot_duration:30.00
  • base_tick_time:1.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
 
pet - chaos_tear 167359 / 9068
Chaos Bolt 167359 0.6% 3.3 70.49sec 833950 413708 Direct 3.2 0 839512 839512 100.0%  

Stats details: chaos_bolt

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 3.26 3.24 0.00 0.00 2.0160 0.0000 2718472.20 2718472.20 0.00 413707.53 413707.53
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
crit 3.24 100.00% 839511.79 779981 984483 840632.71 0 984483 2718472 2718472 0.00
 
 

Action details: chaos_bolt

Static Values
  • id:215279
  • school:chromatic
  • resource:none
  • range:100.0
  • travel_speed:16.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:5.500
  • base_execute_time:3.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:215279
  • name:Chaos Bolt
  • school:chromatic
  • tooltip:
  • description:Unleashes a devastating blast of chaos, causing {$s1=1} Chaos damage. Chaos Bolt always critically strikes and your critical strike chance increases its damage.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:5.000000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
pet - chaos_portal 291617 / 17626
Chaos Barrage 291617 1.3% 3.3 70.36sec 1581577 0 Periodic 114.9 39753 79481 45917 15.5% 6.0%

Stats details: chaos_barrage

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 3.34 0.00 115.43 114.90 0.0000 0.1570 5276115.02 5276115.02 0.00 291144.19 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 97.1 84.48% 39752.54 164 46880 39614.53 0 46880 3858881 3858881 0.00
crit 17.8 15.52% 79481.02 347 93759 79148.47 0 93759 1417234 1417234 0.00
 
 

Action details: chaos_barrage

Static Values
  • id:187394
  • school:magic
  • resource:none
  • range:100.0
  • travel_speed:24.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:187394
  • name:Chaos Barrage
  • school:magic
  • tooltip:
  • description:Deals {$s1=1} Chaos damage.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • dot_duration:5.50
  • base_tick_time:0.25
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
 
Simple Action Stats Execute Interval
Shoulders
augmentation 1.0 0.00sec

Stats details: augmentation

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: augmentation

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Shoulders
  • harmful:false
  • if_expr:
 
Berserking 2.1 180.62sec

Stats details: berserking

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.06 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: berserking

Static Values
  • id:26297
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:180.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:26297
  • name:Berserking
  • school:physical
  • tooltip:Haste increased by {$s1=15}%.
  • description:Increases your haste by {$s1=15}% for {$d=10 seconds}.
 
Dimensional Rift 12.9 23.65sec

Stats details: dimensional_rift

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 12.88 0.00 0.00 0.00 1.0230 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: dimensional_rift

Static Values
  • id:196586
  • school:none
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:45.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:charges=3
Spelldata
  • id:196586
  • name:Dimensional Rift
  • school:chaos
  • tooltip:
  • description:Rips a hole in time and space, opening a portal that damages your target.
 
flask 1.0 0.00sec

Stats details: flask

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: flask

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Shoulders
  • harmful:false
  • if_expr:
 
food 1.0 0.00sec

Stats details: food

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: food

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Shoulders
  • harmful:false
  • if_expr:
 
Havoc 14.9 20.92sec

Stats details: havoc

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 14.89 0.00 0.00 0.00 1.0691 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: havoc

Static Values
  • id:80240
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:88000.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:active_enemies>1&(active_enemies<4|talent.wreak_havoc.enabled&active_enemies<6)&!debuff.havoc.remains
Spelldata
  • id:80240
  • name:Havoc
  • school:shadow
  • tooltip:Spells cast by the Warlock also hit this target.
  • description:Marks a target with Havoc for {$d=8 seconds}, causing your single target spells to also strike the Havoc victim. Limit 1.
 
Life Tap 6.6 33.65sec

Stats details: life_tap

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 6.56 0.00 0.00 0.00 1.0438 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: life_tap

Static Values
  • id:1454
  • school:shadow
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:talent.empowered_life_tap.enabled&!buff.empowered_life_tap.remains
Spelldata
  • id:1454
  • name:Life Tap
  • school:shadow
  • tooltip:
  • description:Restores {$s1=30}% of your maximum mana, at the cost of {$s2=10}% of your maximum health.
 
potion 2.0 0.00sec

Stats details: potion

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: potion

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:60.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
 
Grimoire: Imp (service_imp) 3.7 91.41sec

Stats details: service_imp

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 3.69 0.00 0.00 0.00 0.9726 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: service_imp

Static Values
  • id:111859
  • school:shadow
  • resource:soul_shard
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:1.0
  • secondary_cost:0.0
  • cooldown:90.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:111859
  • name:Grimoire: Imp
  • school:shadow
  • tooltip:
  • description:Summons an Imp who attacks the target for {$108501s1=25} sec. Imps cast ranged Firebolts and cleanse a hostile magic effect from their master.
 
Soul Harvest 2.9 120.97sec

Stats details: soul_harvest

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.89 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: soul_harvest

Static Values
  • id:196098
  • school:shadow
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:120.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:196098
  • name:Soul Harvest
  • school:shadow
  • tooltip:Damage increased by {$s1=20}%.
  • description:Increases your damage and your pets' damage by {$s1=20}%. Lasts {$d=15 seconds}, increased by {$s2=2} sec for each target afflicted by your {$?s137043=false}[Agony][]{$?s137044=false}[Doom][]{$?s137046=false}[Immolate][], up to a maximum of {$s3=35} sec.
 
Summon Doomguard 1.0 0.00sec

Stats details: summon_doomguard

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 1.0823 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: summon_doomguard

Static Values
  • id:18540
  • school:shadow
  • resource:soul_shard
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:1.0
  • secondary_cost:0.0
  • cooldown:180.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:talent.grimoire_of_supremacy.enabled&active_enemies=1&artifact.lord_of_flames.rank=0
Spelldata
  • id:18540
  • name:Summon Doomguard
  • school:shadow
  • tooltip:
  • description:Summons a Doomguard for {$60478d=25 seconds} to assault the target with its Doom Bolts.
 
Summon Imp 1.0 0.00sec

Stats details: summon_imp

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: summon_imp

Static Values
  • id:688
  • school:shadow
  • resource:soul_shard
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:1.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:2.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:!talent.grimoire_of_supremacy.enabled&(!talent.grimoire_of_sacrifice.enabled|buff.demonic_power.down)
Spelldata
  • id:688
  • name:Summon Imp
  • school:shadow
  • tooltip:
  • description:Summons an Imp under your command that casts ranged Firebolts.$?s74434[ |cFFFFFFFFSoulburn:|r |cFF8282FFInstant cast.|r][]
 
Summon Infernal 1.0 0.00sec

Stats details: summon_infernal

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.7587 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: summon_infernal

Static Values
  • id:1122
  • school:shadow
  • resource:soul_shard
  • range:30.0
  • travel_speed:1.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:1.0
  • secondary_cost:0.0
  • cooldown:180.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:talent.grimoire_of_supremacy.enabled&artifact.lord_of_flames.rank>0
Spelldata
  • id:1122
  • name:Summon Infernal
  • school:shadow
  • tooltip:
  • description:Summons an Infernal from the Twisting Nether, impacting for {$22703s1=0} Fire damage and stunning all enemy targets in the area for {$22703d=2 seconds}. The Infernal will serve you for {$111685d=25 seconds}, dealing strong area-of-effect damage.
 

Buffs

Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit Overflow Expiry
Accelerando 20.1 0.0 15.4sec 15.4sec 78.39% 78.39% 1.5(1.5) 19.3

Buff details

  • buff initial source:Shoulders
  • cooldown name:buff_accelerando
  • max_stacks:5
  • duration:12.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00

Stat Buff details

  • stat:haste_rating
  • amount:734.41

Stack Uptimes

  • accelerando_1:29.54%
  • accelerando_2:24.50%
  • accelerando_3:14.68%
  • accelerando_4:6.62%
  • accelerando_5:3.04%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:225719
  • name:Accelerando
  • tooltip:Haste increased by $w1.
  • description:{$@spelldesc225125=Your damaging spells have a chance to grant you {$225719s1=528} Haste for {$225719d=12 seconds}, stacking up to 5 times. Stacking does not refresh duration.}
  • max_stacks:5
  • duration:12.00
  • cooldown:0.00
  • default_chance:101.00%
Berserking 2.1 0.0 180.6sec 180.6sec 6.86% 8.54% 0.0(0.0) 2.0

Buff details

  • buff initial source:Shoulders
  • cooldown name:buff_berserking
  • max_stacks:1
  • duration:10.00
  • cooldown:180.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • berserking_1:6.86%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:26297
  • name:Berserking
  • tooltip:Haste increased by {$s1=15}%.
  • description:Increases your haste by {$s1=15}% for {$d=10 seconds}.
  • max_stacks:0
  • duration:10.00
  • cooldown:180.00
  • default_chance:0.00%
Bloodlust 1.0 0.0 0.0sec 0.0sec 13.55% 13.55% 0.0(0.0) 1.0

Buff details

  • buff initial source:Shoulders
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • duration:40.00
  • cooldown:300.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • bloodlust_1:13.55%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:2825
  • name:Bloodlust
  • tooltip:Haste increased by {$s1=30}%.
  • description:Increases Haste by {$s1=30}% for all party and raid members for {$d=40 seconds}. Allies receiving this effect will become Sated and unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.
  • max_stacks:0
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
Conflagration of Chaos 24.1 0.0 12.4sec 12.4sec 49.21% 46.96% 0.0(0.0) 0.9

Buff details

  • buff initial source:Shoulders
  • cooldown name:buff_conflagration_of_chaos
  • max_stacks:1
  • duration:20.00
  • cooldown:0.00
  • default_chance:50.00%
  • default_value:-0.00

Stack Uptimes

  • conflagration_of_chaos_1:49.21%

Trigger Attempt Success

  • trigger_pct:49.90%

Spelldata details

  • id:196546
  • name:Conflagration of Chaos
  • tooltip:Your {$?s17877=false}[Shadowburn][Conflagrate] will always critically strike. Critical strike chance will increase the critical strike damage of {$?s17877=false}[Shadowburn][Conflagrate].
  • description:{$@spelldesc219195={$?s17877=false}[Shadowburn][Conflagrate] has a chance to guarantee your next {$?s17877=false}[Shadowburn][Conflagrate] critically strikes, and to increase its damage by your critical strike chance.}
  • max_stacks:0
  • duration:20.00
  • cooldown:0.00
  • default_chance:100.00%
Devil's Due 3.5 0.0 69.9sec 69.9sec 8.69% 8.69% 0.0(0.0) 3.2

Buff details

  • buff initial source:Shoulders
  • cooldown name:buff_devils_due
  • max_stacks:1
  • duration:8.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.18

Stack Uptimes

  • devils_due_1:8.69%

Trigger Attempt Success

  • trigger_pct:99.96%

Spelldata details

  • id:225776
  • name:Devil's Due
  • tooltip:Cast speed slowed by {$s1=7}%.
  • description:{$@spelldesc225142=Your damaging spells have a chance to grant Nefarious Pact, increasing your casting speed by {$225774s1=17}% for {$225774d=12 seconds}. When Nefarious Pact expires, your casting speed is decreased by {$225776s1=7}% for {$225776d=8 seconds}.}
  • max_stacks:0
  • duration:8.00
  • cooldown:0.00
  • default_chance:0.00%
Embrace Chaos 33.6 28.1 9.1sec 4.8sec 67.15% 79.67% 28.1(28.1) 32.9

Buff details

  • buff initial source:Shoulders
  • cooldown name:buff_embrace_chaos
  • max_stacks:1
  • duration:4.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • embrace_chaos_1:67.15%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:212019
  • name:Embrace Chaos
  • tooltip:Chaos Bolt has {$s1=40}% reduced cast time.
  • description:{$@spelldesc212018=Casting Chaos Bolt reduces the cast time of your next Chaos Bolt by {$212019s1=40}% for {$212019d=4 seconds}.}
  • max_stacks:0
  • duration:4.00
  • cooldown:0.00
  • default_chance:0.00%
Lessons of Space-Time 11.8 1.1 26.1sec 23.8sec 39.58% 39.58% 1.1(1.1) 11.5

Buff details

  • buff initial source:Shoulders
  • cooldown name:buff_lessons_of_spacetime
  • max_stacks:1
  • duration:5.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10

Stack Uptimes

  • lessons_of_spacetime_1:39.58%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:236176
  • name:Lessons of Space-Time
  • tooltip:You and your minions deal {$s1=10}% increased damage.
  • description:{$@spelldesc236174=While you have a Dimensional Rift open, all of your damage is increased by {$236176s1=10}%.}
  • max_stacks:0
  • duration:5.00
  • cooldown:0.00
  • default_chance:0.00%
Lord of Flames 1.0 0.0 0.0sec 0.0sec 97.85% 97.85% 0.0(0.0) 0.0

Buff details

  • buff initial source:Shoulders
  • cooldown name:buff_lord_of_flames
  • max_stacks:1
  • duration:600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • lord_of_flames_1:97.85%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:226802
  • name:Lord of Flames
  • tooltip:Recently activated Lord of Flames.
  • description:{$@spelldesc224103=Once every {$s2=10} minutes, {$?s152107=false}[your Infernal's Meteor Strike][Summon Infernal] will summon {$s3=3} additional Infernals to serve you for {$226804d=25 seconds}.}
  • max_stacks:0
  • duration:600.00
  • cooldown:0.00
  • default_chance:0.00%
Nefarious Pact 3.5 0.0 70.2sec 69.5sec 13.50% 13.50% 0.0(0.0) 3.3

Buff details

  • buff initial source:Shoulders
  • cooldown name:buff_nefarious_pact
  • max_stacks:1
  • duration:12.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.44

Stack Uptimes

  • nefarious_pact_1:13.50%

Trigger Attempt Success

  • trigger_pct:99.96%

Spelldata details

  • id:225774
  • name:Nefarious Pact
  • tooltip:Cast speed increased by {$s1=17}%.
  • description:{$@spelldesc225142=Your damaging spells have a chance to grant Nefarious Pact, increasing your casting speed by {$225774s1=17}% for {$225774d=12 seconds}. When Nefarious Pact expires, your casting speed is decreased by {$225776s1=7}% for {$225776d=8 seconds}.}
  • max_stacks:0
  • duration:12.00
  • cooldown:0.00
  • default_chance:0.00%
Potion of Deadly Grace 1.0 0.0 0.0sec 0.0sec 10.16% 10.16% 0.0(0.0) 1.0

Buff details

  • buff initial source:Shoulders
  • cooldown name:buff_potion_of_deadly_grace
  • max_stacks:1
  • duration:30.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • potion_of_deadly_grace_1:10.16%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:188027
  • name:Potion of Deadly Grace
  • tooltip:Your attacks have a chance to unleash a bolt of energy at your target.
  • description:Grants your attacks a chance to unleash a bolt of energy at your target. Staying away from enemies for the entire duration of the effect will extend the effect by an additional 5 seconds.
  • max_stacks:0
  • duration:25.00
  • cooldown:1.00
  • default_chance:101.00%
Potion of Prolonged Power 1.0 0.0 0.0sec 0.0sec 19.64% 19.64% 0.0(0.0) 1.0

Buff details

  • buff initial source:Shoulders
  • cooldown name:buff_potion_of_prolonged_power
  • max_stacks:1
  • duration:60.00
  • cooldown:1.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:all
  • amount:2500.00

Stack Uptimes

  • potion_of_prolonged_power_1:19.64%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:229206
  • name:Potion of Prolonged Power
  • tooltip:All stats increased by {$s1=2500}.
  • description:Drink to increase all stats by {$s1=2500} for {$d=60 seconds}.
  • max_stacks:0
  • duration:60.00
  • cooldown:1.00
  • default_chance:0.00%
Soul Harvest 2.9 0.0 121.0sec 121.0sec 17.77% 17.77% 0.0(0.0) 2.7

Buff details

  • buff initial source:Shoulders
  • cooldown name:buff_soul_harvest
  • max_stacks:1
  • duration:15.00
  • cooldown:120.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • soul_harvest_1:17.77%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:196098
  • name:Soul Harvest
  • tooltip:Damage increased by {$s1=20}%.
  • description:Increases your damage and your pets' damage by {$s1=20}%. Lasts {$d=15 seconds}, increased by {$s2=2} sec for each target afflicted by your {$?s137043=false}[Agony][]{$?s137044=false}[Doom][]{$?s137046=false}[Immolate][], up to a maximum of {$s3=35} sec.
  • max_stacks:0
  • duration:15.00
  • cooldown:120.00
  • default_chance:0.00%
Constant Buffs
Well Fed (azshari_salad)

Buff details

  • buff initial source:Shoulders
  • cooldown name:buff_azshari_salad
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:haste_rating
  • amount:375.00

Stack Uptimes

  • azshari_salad_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:225603
  • name:Well Fed
  • tooltip:Haste increased by $w1.
  • description:Increases haste by {$s1=375} for {$d=3600 seconds}.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Defiled Augmentation

Buff details

  • buff initial source:Shoulders
  • cooldown name:buff_defiled_augmentation
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:agility
  • amount:325.00
  • stat:strength
  • amount:325.00
  • stat:intellect
  • amount:325.00

Stack Uptimes

  • defiled_augmentation_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:224001
  • name:Defiled Augmentation
  • tooltip:Agility, Intellect and Strength increased by $w1.
  • description:Increases Agility, Intellect and Strength by {$s1=325} for {$d=3600 seconds}. Augment Rune.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Flask of the Whispered Pact

Buff details

  • buff initial source:Shoulders
  • cooldown name:buff_flask_of_the_whispered_pact
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:intellect
  • amount:1300.00

Stack Uptimes

  • flask_of_the_whispered_pact_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:188031
  • name:Flask of the Whispered Pact
  • tooltip:Intellect increased by $w1.
  • description:Increases Intellect by {$s1=1300} for {$d=3600 seconds}. Counts as both a Battle and Guardian elixir. This effect persists through death.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:101.00%
Tormented Souls

Buff details

  • buff initial source:Shoulders
  • cooldown name:buff_tormented_souls
  • max_stacks:12
  • duration:0.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00

Stack Uptimes

  • tormented_souls_2:0.37%
  • tormented_souls_3:99.63%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:216695
  • name:Tormented Souls
  • tooltip:Activate Reap Souls to consume all Tormented Souls collected by |cFFFFCC99Ulthalesh|r, increasing your damage by 10% and doubling the effect of all of |cFFFFCC99Ulthalesh|r's other traits for {$216708d=5 seconds} per soul consumed.
  • description:Activate Reap Souls to consume all Tormented Souls collected by |cFFFFCC99Ulthalesh|r, increasing your damage by 10% and doubling the effect of all of |cFFFFCC99Ulthalesh|r's other traits for {$216708d=5 seconds} per soul consumed.
  • max_stacks:12
  • duration:-0.00
  • cooldown:0.00
  • default_chance:101.00%

Procs

Count Interval
shadowy_tear 3.2 70.7sec
flame_rift 3.2 69.9sec
chaos_tear 3.2 70.7sec
chaos_portal 3.2 70.0sec
dimension_ripper 3.8 56.3sec
t19_2pc_chaos_bolt 42.9 6.8sec

Resources

Resource Usage Type Count Total Average RPE APR
Shoulders
chaos_bolt Soul Shard 61.6 123.3 2.0 2.0 1002298.2
havoc Mana 14.9 1310138.2 88000.0 88000.3 0.0
immolate Mana 20.0 1317301.4 66000.0 66000.1 72.8
incinerate Mana 75.3 4972426.7 66000.0 65999.2 9.2
service_imp Soul Shard 3.7 3.7 1.0 1.0 0.0
summon_doomguard Soul Shard 1.0 1.0 1.0 1.0 0.0
summon_infernal Soul Shard 1.0 1.0 1.0 1.0 0.0
pet - imp
firebolt Energy 108.5 4340.4 40.0 40.0 3526.0
pet - service_imp
firebolt Energy 49.1 1965.8 40.0 40.0 7274.7
pet - doomguard
doom_bolt Energy 10.9 381.1 35.0 35.0 7409.2
pet - flame_rift
searing_bolt Energy 64.3 64.3 1.0 1.0 390357.4
Resource Gains Type Count Total Average Overflow
life_tap Mana 6.56 2163358.99 (32.14%) 330000.00 0.00 0.00%
immolate Soul Shard 71.84 70.81 (55.21%) 0.99 1.03 1.43%
conflagrate Soul Shard 48.28 48.18 (37.57%) 1.00 0.10 0.20%
mp5_regen Mana 519.19 4567675.11 (67.86%) 8797.72 49172.55 1.07%
soulsnatcher Soul Shard 9.26 9.26 (7.22%) 1.00 0.00 0.00%
pet - imp
energy_regen Energy 1899.69 4174.11 (100.00%) 2.20 21.56 0.51%
pet - service_imp
energy_regen Energy 443.50 1344.28 (100.00%) 3.03 61.89 4.40%
pet - doomguard
energy_regen Energy 15.76 340.10 (100.00%) 21.58 42.74 11.16%
Resource RPS-Gain RPS-Loss
Health 0.00 7225.85
Mana 22361.77 25248.20
Soul Shard 0.43 0.43
Combat End Resource Mean Min Max
Mana 233193.54 5975.40 474990.32
Soul Shard 2.28 0.00 5.00

Benefits & Uptimes

Benefits %
Uptimes %
Mana Cap 0.7%

Statistics & Data Analysis

Fight Length
Sample Data Shoulders Fight Length
Count 9999
Mean 301.01
Minimum 217.68
Maximum 385.07
Spread ( max - min ) 167.39
Range [ ( max - min ) / 2 * 100% ] 27.80%
DPS
Sample Data Shoulders Damage Per Second
Count 9999
Mean 1397795.92
Minimum 1148551.57
Maximum 1733726.55
Spread ( max - min ) 585174.98
Range [ ( max - min ) / 2 * 100% ] 20.93%
Standard Deviation 63952.7783
5th Percentile 1298399.73
95th Percentile 1508574.75
( 95th Percentile - 5th Percentile ) 210175.02
Mean Distribution
Standard Deviation 639.5598
95.00% Confidence Intervall ( 1396542.41 - 1399049.43 )
Normalized 95.00% Confidence Intervall ( 99.91% - 100.09% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 81
0.1% Error 8042
0.1 Scale Factor Error with Delta=300 34914233
0.05 Scale Factor Error with Delta=300 139656931
0.01 Scale Factor Error with Delta=300 3491423260
Priority Target DPS
Sample Data Shoulders Priority Target Damage Per Second
Count 9999
Mean 837873.93
Minimum 686398.72
Maximum 1056002.14
Spread ( max - min ) 369603.42
Range [ ( max - min ) / 2 * 100% ] 22.06%
Standard Deviation 48673.6338
5th Percentile 762542.15
95th Percentile 923126.91
( 95th Percentile - 5th Percentile ) 160584.75
Mean Distribution
Standard Deviation 486.7607
95.00% Confidence Intervall ( 836919.90 - 838827.97 )
Normalized 95.00% Confidence Intervall ( 99.89% - 100.11% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 130
0.1% Error 12964
0.1 Scale Factor Error with Delta=300 20224194
0.05 Scale Factor Error with Delta=300 80896774
0.01 Scale Factor Error with Delta=300 2022419339
DPS(e)
Sample Data Shoulders Damage Per Second (Effective)
Count 9999
Mean 1397795.92
Minimum 1148551.57
Maximum 1733726.55
Spread ( max - min ) 585174.98
Range [ ( max - min ) / 2 * 100% ] 20.93%
Damage
Sample Data Shoulders Damage
Count 9999
Mean 334763413.49
Minimum 231492075.43
Maximum 442872538.78
Spread ( max - min ) 211380463.35
Range [ ( max - min ) / 2 * 100% ] 31.57%
DTPS
Sample Data Shoulders Damage Taken Per Second
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HPS
Sample Data Shoulders Healing Per Second
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
HPS(e)
Sample Data Shoulders Healing Per Second (Effective)
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
Sample Data Shoulders Heal
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
Sample Data Shoulders Healing Taken Per Second
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
TMI
Sample Data Shoulders Theck-Meloree Index
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
ETMI
Sample Data ShouldersTheck-Meloree Index (Effective)
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
MSD
Sample Data Shoulders Max Spike Value
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 flask,type=whispered_pact
1 0.00 food,type=azshari_salad
2 0.00 summon_pet,if=!talent.grimoire_of_supremacy.enabled&(!talent.grimoire_of_sacrifice.enabled|buff.demonic_power.down)
3 0.00 summon_infernal,if=talent.grimoire_of_supremacy.enabled&artifact.lord_of_flames.rank>0
4 0.00 summon_infernal,if=talent.grimoire_of_supremacy.enabled&active_enemies>1
5 0.00 summon_doomguard,if=talent.grimoire_of_supremacy.enabled&active_enemies=1&artifact.lord_of_flames.rank=0
6 0.00 augmentation,type=defiled
7 0.00 snapshot_stats
8 0.00 grimoire_of_sacrifice,if=talent.grimoire_of_sacrifice.enabled
9 0.00 life_tap,if=talent.empowered_life_tap.enabled&!buff.empowered_life_tap.remains
A 0.00 potion,name=prolonged_power
B 0.00 chaos_bolt
Default action list Executed every time the actor is available.
# count action,conditions
C 14.89 havoc,target=2,if=active_enemies>1&(active_enemies<4|talent.wreak_havoc.enabled&active_enemies<6)&!debuff.havoc.remains
D 1.00 dimensional_rift,if=charges=3
E 10.33 immolate,if=remains<=tick_time
F 0.65 immolate,cycle_targets=1,if=active_enemies>1&remains<=tick_time&(!talent.roaring_blaze.enabled|(!debuff.roaring_blaze.remains&action.conflagrate.charges<2+set_bonus.tier19_4pc))
G 9.03 immolate,if=talent.roaring_blaze.enabled&remains<=duration&!debuff.roaring_blaze.remains&target.time_to_die>10&(action.conflagrate.charges=2+set_bonus.tier19_4pc|(action.conflagrate.charges>=1+set_bonus.tier19_4pc&action.conflagrate.recharge_time<cast_time+gcd)|target.time_to_die<24)
H 2.06 berserking
0.00 blood_fury
0.00 arcane_torrent
I 1.00 potion,name=deadly_grace,if=(buff.soul_harvest.remains|trinket.proc.any.react|target.time_to_die<=45)
0.00 shadowburn,if=buff.conflagration_of_chaos.remains<=action.chaos_bolt.cast_time
0.00 shadowburn,if=(charges=1+set_bonus.tier19_4pc&recharge_time<action.chaos_bolt.cast_time|charges=2+set_bonus.tier19_4pc)&soul_shard<5
J 14.00 conflagrate,if=talent.roaring_blaze.enabled&(charges=2+set_bonus.tier19_4pc|(charges>=1+set_bonus.tier19_4pc&recharge_time<gcd)|target.time_to_die<24)
K 34.28 conflagrate,if=talent.roaring_blaze.enabled&debuff.roaring_blaze.stack>0&dot.immolate.remains>dot.immolate.duration*0.3&(active_enemies=1|soul_shard<3)&soul_shard<5
0.00 conflagrate,if=!talent.roaring_blaze.enabled&buff.backdraft.stack<3&buff.conflagration_of_chaos.remains<=action.chaos_bolt.cast_time
0.00 conflagrate,if=!talent.roaring_blaze.enabled&buff.backdraft.stack<3&(charges=1+set_bonus.tier19_4pc&recharge_time<action.chaos_bolt.cast_time|charges=2+set_bonus.tier19_4pc)&soul_shard<5
0.00 life_tap,if=talent.empowered_life_tap.enabled&buff.empowered_life_tap.remains<=gcd
L 10.81 dimensional_rift,if=equipped.144369&!buff.lessons_of_spacetime.remains&((!talent.grimoire_of_supremacy.enabled&!cooldown.summon_doomguard.remains)|(talent.grimoire_of_service.enabled&!cooldown.service_pet.remains)|(talent.soul_harvest.enabled&!cooldown.soul_harvest.remains))
M 3.69 service_pet
N 1.00 summon_infernal,if=artifact.lord_of_flames.rank>0&!buff.lord_of_flames.remains
O 1.00 summon_doomguard,if=!talent.grimoire_of_supremacy.enabled&spell_targets.infernal_awakening<=2&(target.time_to_die>180|target.health.pct<=20|target.time_to_die<30)
0.00 summon_infernal,if=!talent.grimoire_of_supremacy.enabled&spell_targets.infernal_awakening>2
0.00 summon_doomguard,if=talent.grimoire_of_supremacy.enabled&spell_targets.summon_infernal=1&artifact.lord_of_flames.rank>0&buff.lord_of_flames.remains&!pet.doomguard.active
0.00 summon_doomguard,if=talent.grimoire_of_supremacy.enabled&spell_targets.summon_infernal=1&equipped.132379&!cooldown.sindorei_spite_icd.remains
0.00 summon_infernal,if=talent.grimoire_of_supremacy.enabled&spell_targets.summon_infernal>1&equipped.132379&!cooldown.sindorei_spite_icd.remains
P 2.89 soul_harvest
0.00 channel_demonfire,if=dot.immolate.remains>cast_time
0.00 havoc,if=active_enemies=1&talent.wreak_havoc.enabled&equipped.132375&!debuff.havoc.remains
0.00 rain_of_fire,if=active_enemies>=3&cooldown.havoc.remains<=12&!talent.wreak_havoc.enabled
0.00 rain_of_fire,if=active_enemies>=6&talent.wreak_havoc.enabled
Q 1.08 dimensional_rift,if=!equipped.144369|charges>1|((!talent.grimoire_of_service.enabled|recharge_time<cooldown.service_pet.remains)&(!talent.soul_harvest.enabled|recharge_time<cooldown.soul_harvest.remains)&(!talent.grimoire_of_supremacy.enabled|recharge_time<cooldown.summon_doomguard.remains))
0.00 life_tap,if=talent.empowered_life_tap.enabled&buff.empowered_life_tap.remains<duration*0.3
0.00 cataclysm
R 60.96 chaos_bolt,if=(cooldown.havoc.remains>12&cooldown.havoc.remains|active_enemies<3|talent.wreak_havoc.enabled&active_enemies<6)&(set_bonus.tier19_4pc=0|!talent.eradication.enabled|buff.embrace_chaos.remains<=cast_time|soul_shard>=3)
0.00 shadowburn
0.00 conflagrate,if=!talent.roaring_blaze.enabled&buff.backdraft.stack<3
0.00 immolate,if=!talent.roaring_blaze.enabled&remains<=duration*0.3
S 75.66 incinerate
T 6.56 life_tap

Sample Sequence

0126ABCDEGHJKMKNPQKRSQRKSSRSKSRCLSSSRSQERSSSGJLRKRKRCKRKRLSSKRESSRSCSSSSSGJRKRKSRSKRSTCRKSSELSSMRSSLCGJRRKRKRKRSKRSSCTEPISRSSSRGJKKLRCKRSSSKRSLSERTCSRSSGJRKRKRKLHRMCKRSSSRSESRSTSGJKCRKRKRSSRRKSRSSSSLRCOTESSGJKRKRSSRKSPSCRTKSSSSESSRSSTCRGJJJLMRRSJSRSSJRCSJER

Sample Sequence Table

time list # name target resources buffs
Pre precombat 0 flask Shoulders 1100000.0/1100000: 100% mana | 3.0/5: 60% soul_shard
Pre precombat 1 food Shoulders 1100000.0/1100000: 100% mana | 3.0/5: 60% soul_shard
Pre precombat 2 summon_imp Fluffy_Pillow 1100000.0/1100000: 100% mana | 3.0/5: 60% soul_shard
Pre precombat 6 augmentation Shoulders 1100000.0/1100000: 100% mana | 3.0/5: 60% soul_shard
Pre precombat A potion Fluffy_Pillow 1100000.0/1100000: 100% mana | 3.0/5: 60% soul_shard potion_of_prolonged_power
0:00.000 precombat B chaos_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 1.0/5: 20% soul_shard embrace_chaos, accelerando, potion_of_prolonged_power
0:00.000 default C havoc enemy2 1100000.0/1100000: 100% mana | 1.0/5: 20% soul_shard embrace_chaos, accelerando, potion_of_prolonged_power
0:01.148 default D dimensional_rift Fluffy_Pillow 1033551.0/1100000: 94% mana | 1.0/5: 20% soul_shard bloodlust, embrace_chaos, accelerando, potion_of_prolonged_power
0:02.030 default E immolate Fluffy_Pillow 1050108.5/1100000: 95% mana | 1.0/5: 20% soul_shard bloodlust, lessons_of_spacetime, embrace_chaos, accelerando, potion_of_prolonged_power
0:02.914 default G immolate Fluffy_Pillow 1000705.2/1100000: 91% mana | 1.0/5: 20% soul_shard bloodlust, lessons_of_spacetime, embrace_chaos, accelerando(2), potion_of_prolonged_power
0:03.785 default H berserking Fluffy_Pillow 951300.3/1100000: 86% mana | 1.0/5: 20% soul_shard bloodlust, lessons_of_spacetime, embrace_chaos, accelerando(2), potion_of_prolonged_power
0:03.785 default J conflagrate Fluffy_Pillow 951300.3/1100000: 86% mana | 1.0/5: 20% soul_shard bloodlust, berserking, lessons_of_spacetime, embrace_chaos, accelerando(2), potion_of_prolonged_power
0:04.543 default K conflagrate Fluffy_Pillow 967908.8/1100000: 88% mana | 2.0/5: 40% soul_shard bloodlust, berserking, lessons_of_spacetime, accelerando(2), potion_of_prolonged_power
0:05.302 default M service_imp Fluffy_Pillow 984539.1/1100000: 90% mana | 3.0/5: 60% soul_shard bloodlust, berserking, lessons_of_spacetime, accelerando(2), potion_of_prolonged_power
0:06.061 default K conflagrate Fluffy_Pillow 1001169.5/1100000: 91% mana | 2.0/5: 40% soul_shard bloodlust, berserking, lessons_of_spacetime, accelerando(2), potion_of_prolonged_power
0:06.819 default N summon_infernal Fluffy_Pillow 1018230.8/1100000: 93% mana | 3.0/5: 60% soul_shard bloodlust, berserking, lessons_of_spacetime, conflagration_of_chaos, accelerando(4), potion_of_prolonged_power
0:07.572 default P soul_harvest Fluffy_Pillow 1035214.8/1100000: 94% mana | 2.0/5: 40% soul_shard bloodlust, berserking, lessons_of_spacetime, lord_of_flames, conflagration_of_chaos, accelerando(4), potion_of_prolonged_power
0:07.572 default Q dimensional_rift Fluffy_Pillow 1035214.8/1100000: 94% mana | 2.0/5: 40% soul_shard bloodlust, berserking, soul_harvest, lessons_of_spacetime, lord_of_flames, conflagration_of_chaos, accelerando(4), potion_of_prolonged_power
0:08.325 default K conflagrate Fluffy_Pillow 1052198.7/1100000: 96% mana | 2.0/5: 40% soul_shard bloodlust, berserking, soul_harvest, lessons_of_spacetime, lord_of_flames, conflagration_of_chaos, accelerando(4), potion_of_prolonged_power
0:09.078 default R chaos_bolt Fluffy_Pillow 1069182.7/1100000: 97% mana | 3.0/5: 60% soul_shard bloodlust, berserking, soul_harvest, lessons_of_spacetime, lord_of_flames, accelerando(4), potion_of_prolonged_power
0:10.545 default S incinerate Fluffy_Pillow 1100000.0/1100000: 100% mana | 1.0/5: 20% soul_shard bloodlust, berserking, soul_harvest, lessons_of_spacetime, lord_of_flames, embrace_chaos, accelerando(4), potion_of_prolonged_power
0:11.465 default Q dimensional_rift Fluffy_Pillow 1034090.2/1100000: 94% mana | 2.0/5: 40% soul_shard bloodlust, berserking, soul_harvest, lessons_of_spacetime, lord_of_flames, embrace_chaos, accelerando(4), potion_of_prolonged_power
0:12.220 default R chaos_bolt Fluffy_Pillow 1050835.9/1100000: 96% mana | 3.0/5: 60% soul_shard bloodlust, berserking, soul_harvest, lessons_of_spacetime, lord_of_flames, embrace_chaos, potion_of_prolonged_power
0:13.154 default K conflagrate Fluffy_Pillow 1070698.9/1100000: 97% mana | 1.0/5: 20% soul_shard bloodlust, berserking, soul_harvest, lessons_of_spacetime, lord_of_flames, embrace_chaos, potion_of_prolonged_power
0:13.933 default S incinerate Fluffy_Pillow 1086855.1/1100000: 99% mana | 2.0/5: 40% soul_shard bloodlust, soul_harvest, lessons_of_spacetime, lord_of_flames, embrace_chaos, potion_of_prolonged_power
0:15.056 default S incinerate Fluffy_Pillow 1034092.5/1100000: 94% mana | 2.0/5: 40% soul_shard bloodlust, soul_harvest, lessons_of_spacetime, lord_of_flames, embrace_chaos, potion_of_prolonged_power
0:16.177 default R chaos_bolt Fluffy_Pillow 988823.7/1100000: 90% mana | 3.0/5: 60% soul_shard bloodlust, soul_harvest, lessons_of_spacetime, lord_of_flames, embrace_chaos, nefarious_pact, accelerando, potion_of_prolonged_power
0:16.931 default S incinerate Fluffy_Pillow 1002978.3/1100000: 91% mana | 1.0/5: 20% soul_shard bloodlust, soul_harvest, lessons_of_spacetime, lord_of_flames, embrace_chaos, nefarious_pact, accelerando, potion_of_prolonged_power
0:17.699 default K conflagrate Fluffy_Pillow 951397.1/1100000: 86% mana | 1.0/5: 20% soul_shard bloodlust, soul_harvest, lessons_of_spacetime, lord_of_flames, embrace_chaos, nefarious_pact, accelerando(2), potion_of_prolonged_power
0:18.580 default S incinerate Fluffy_Pillow 968182.7/1100000: 88% mana | 2.0/5: 40% soul_shard bloodlust, soul_harvest, lessons_of_spacetime, lord_of_flames, embrace_chaos, nefarious_pact, accelerando(2), potion_of_prolonged_power
0:19.337 default R chaos_bolt Fluffy_Pillow 916605.8/1100000: 83% mana | 3.0/5: 60% soul_shard bloodlust, soul_harvest, lessons_of_spacetime, lord_of_flames, embrace_chaos, nefarious_pact, accelerando(2), potion_of_prolonged_power
0:20.092 default C havoc enemy2 930990.8/1100000: 85% mana | 1.0/5: 20% soul_shard bloodlust, soul_harvest, lessons_of_spacetime, lord_of_flames, embrace_chaos, nefarious_pact, accelerando(2), potion_of_prolonged_power
0:20.848 default L dimensional_rift Fluffy_Pillow 857484.9/1100000: 78% mana | 1.0/5: 20% soul_shard bloodlust, soul_harvest, lord_of_flames, embrace_chaos, nefarious_pact, accelerando(3), potion_of_prolonged_power
0:21.602 default S incinerate Fluffy_Pillow 872061.9/1100000: 79% mana | 1.0/5: 20% soul_shard bloodlust, soul_harvest, lessons_of_spacetime, lord_of_flames, embrace_chaos, nefarious_pact, accelerando(3), potion_of_prolonged_power
0:22.356 default S incinerate Fluffy_Pillow 820638.8/1100000: 75% mana | 1.0/5: 20% soul_shard bloodlust, soul_harvest, lessons_of_spacetime, lord_of_flames, embrace_chaos, nefarious_pact, accelerando(3), potion_of_prolonged_power
0:23.112 default S incinerate Fluffy_Pillow 769254.5/1100000: 70% mana | 2.0/5: 40% soul_shard bloodlust, soul_harvest, lessons_of_spacetime, lord_of_flames, embrace_chaos, nefarious_pact, accelerando(3), potion_of_prolonged_power
0:23.865 default R chaos_bolt Fluffy_Pillow 717812.1/1100000: 65% mana | 2.0/5: 40% soul_shard bloodlust, soul_harvest, lessons_of_spacetime, lord_of_flames, embrace_chaos, nefarious_pact, accelerando(3), potion_of_prolonged_power
0:24.619 default S incinerate Fluffy_Pillow 732389.0/1100000: 67% mana | 1.0/5: 20% soul_shard bloodlust, soul_harvest, lessons_of_spacetime, lord_of_flames, embrace_chaos, nefarious_pact, accelerando(3), potion_of_prolonged_power
0:25.375 default Q dimensional_rift Fluffy_Pillow 681033.5/1100000: 62% mana | 2.0/5: 40% soul_shard bloodlust, soul_harvest, lessons_of_spacetime, lord_of_flames, embrace_chaos, nefarious_pact, accelerando(4), potion_of_prolonged_power
0:26.130 default E immolate Fluffy_Pillow 695841.4/1100000: 63% mana | 3.0/5: 60% soul_shard bloodlust, soul_harvest, lessons_of_spacetime, lord_of_flames, embrace_chaos, nefarious_pact, accelerando(4), potion_of_prolonged_power
0:26.887 default R chaos_bolt Fluffy_Pillow 644688.6/1100000: 59% mana | 3.0/5: 60% soul_shard bloodlust, lessons_of_spacetime, lord_of_flames, embrace_chaos, nefarious_pact, accelerando(4), potion_of_prolonged_power
0:27.640 default S incinerate Fluffy_Pillow 659457.2/1100000: 60% mana | 1.0/5: 20% soul_shard bloodlust, lessons_of_spacetime, lord_of_flames, embrace_chaos, devils_due, accelerando(4), potion_of_prolonged_power
0:28.886 default S incinerate Fluffy_Pillow 617097.5/1100000: 56% mana | 2.0/5: 40% soul_shard bloodlust, lessons_of_spacetime, lord_of_flames, embrace_chaos, devils_due, potion_of_prolonged_power
0:30.207 default S incinerate Fluffy_Pillow 575526.4/1100000: 52% mana | 2.0/5: 40% soul_shard bloodlust, lessons_of_spacetime, lord_of_flames, embrace_chaos, devils_due, potion_of_prolonged_power
0:31.527 default G immolate Fluffy_Pillow 533936.9/1100000: 49% mana | 2.0/5: 40% soul_shard bloodlust, lord_of_flames, embrace_chaos, devils_due, potion_of_prolonged_power
0:32.582 default J conflagrate Fluffy_Pillow 487475.8/1100000: 44% mana | 2.0/5: 40% soul_shard bloodlust, lord_of_flames, devils_due, accelerando, potion_of_prolonged_power
0:33.623 default L dimensional_rift Fluffy_Pillow 507018.2/1100000: 46% mana | 3.0/5: 60% soul_shard bloodlust, lord_of_flames, conflagration_of_chaos, devils_due, accelerando, potion_of_prolonged_power
0:34.663 default R chaos_bolt Fluffy_Pillow 526541.7/1100000: 48% mana | 3.0/5: 60% soul_shard bloodlust, lessons_of_spacetime, lord_of_flames, conflagration_of_chaos, devils_due, accelerando, potion_of_prolonged_power
0:36.738 default K conflagrate Fluffy_Pillow 565884.0/1100000: 51% mana | 2.0/5: 40% soul_shard bloodlust, lessons_of_spacetime, lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(3), potion_of_prolonged_power
0:37.594 default R chaos_bolt Fluffy_Pillow 582432.9/1100000: 53% mana | 3.0/5: 60% soul_shard bloodlust, lessons_of_spacetime, lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(3), potion_of_prolonged_power
0:38.622 default K conflagrate Fluffy_Pillow 602307.1/1100000: 55% mana | 2.0/5: 40% soul_shard bloodlust, lessons_of_spacetime, lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(3), potion_of_prolonged_power
0:39.479 default R chaos_bolt Fluffy_Pillow 618875.3/1100000: 56% mana | 3.0/5: 60% soul_shard bloodlust, lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(3), potion_of_prolonged_power
0:40.507 default C havoc enemy2 638749.5/1100000: 58% mana | 2.0/5: 40% soul_shard bloodlust, lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(3), potion_of_prolonged_power
0:41.365 default K conflagrate Fluffy_Pillow 563562.6/1100000: 51% mana | 2.0/5: 40% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(4), potion_of_prolonged_power
0:42.463 default R chaos_bolt Fluffy_Pillow 580364.6/1100000: 53% mana | 3.0/5: 60% soul_shard lord_of_flames, embrace_chaos, accelerando(5), potion_of_prolonged_power
0:43.761 default K conflagrate Fluffy_Pillow 600227.0/1100000: 55% mana | 2.0/5: 40% soul_shard lord_of_flames, embrace_chaos, accelerando(5), potion_of_prolonged_power
0:44.843 default R chaos_bolt Fluffy_Pillow 616390.9/1100000: 56% mana | 4.0/5: 80% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, potion_of_prolonged_power
0:46.239 default L dimensional_rift Fluffy_Pillow 636249.3/1100000: 58% mana | 2.0/5: 40% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, potion_of_prolonged_power
0:47.403 default S incinerate Fluffy_Pillow 652807.4/1100000: 59% mana | 2.0/5: 40% soul_shard lessons_of_spacetime, lord_of_flames, conflagration_of_chaos, embrace_chaos, potion_of_prolonged_power
0:48.859 default S incinerate Fluffy_Pillow 607612.6/1100000: 55% mana | 2.0/5: 40% soul_shard lessons_of_spacetime, lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando, potion_of_prolonged_power
0:50.295 default K conflagrate Fluffy_Pillow 562349.1/1100000: 51% mana | 2.0/5: 40% soul_shard lessons_of_spacetime, lord_of_flames, conflagration_of_chaos, accelerando, potion_of_prolonged_power
0:51.590 default R chaos_bolt Fluffy_Pillow 581049.6/1100000: 53% mana | 4.0/5: 80% soul_shard lord_of_flames, accelerando, potion_of_prolonged_power
0:53.878 default E immolate Fluffy_Pillow 614089.5/1100000: 56% mana | 2.0/5: 40% soul_shard lord_of_flames, embrace_chaos, accelerando, potion_of_prolonged_power
0:55.024 default S incinerate Fluffy_Pillow 564638.3/1100000: 51% mana | 2.0/5: 40% soul_shard lord_of_flames, embrace_chaos, accelerando, potion_of_prolonged_power
0:56.460 default S incinerate Fluffy_Pillow 519374.9/1100000: 47% mana | 2.0/5: 40% soul_shard lord_of_flames, embrace_chaos, accelerando, potion_of_prolonged_power
0:57.897 default R chaos_bolt Fluffy_Pillow 474189.9/1100000: 43% mana | 2.0/5: 40% soul_shard lord_of_flames, accelerando(2), potion_of_prolonged_power
1:00.153 default S incinerate Fluffy_Pillow 507757.5/1100000: 46% mana | 0.0/5: 0% soul_shard lord_of_flames, embrace_chaos, accelerando(4)
1:01.528 default C havoc enemy2 461552.5/1100000: 42% mana | 0.0/5: 0% soul_shard lord_of_flames, embrace_chaos
1:02.691 default S incinerate Fluffy_Pillow 390096.4/1100000: 35% mana | 0.0/5: 0% soul_shard lord_of_flames, embrace_chaos
1:04.147 default S incinerate Fluffy_Pillow 344808.3/1100000: 31% mana | 0.0/5: 0% soul_shard lord_of_flames, embrace_chaos
1:05.606 default S incinerate Fluffy_Pillow 299564.1/1100000: 27% mana | 0.0/5: 0% soul_shard lord_of_flames, accelerando
1:07.043 default S incinerate Fluffy_Pillow 254315.1/1100000: 23% mana | 1.0/5: 20% soul_shard lord_of_flames, accelerando
1:08.480 default S incinerate Fluffy_Pillow 209066.1/1100000: 19% mana | 1.0/5: 20% soul_shard lord_of_flames, accelerando
1:09.916 default G immolate Fluffy_Pillow 163802.7/1100000: 15% mana | 1.0/5: 20% soul_shard lord_of_flames, nefarious_pact, accelerando
1:10.711 default J conflagrate Fluffy_Pillow 109282.9/1100000: 10% mana | 1.0/5: 20% soul_shard lord_of_flames, nefarious_pact, accelerando
1:11.506 default R chaos_bolt Fluffy_Pillow 120763.1/1100000: 11% mana | 3.0/5: 60% soul_shard lord_of_flames, nefarious_pact, accelerando
1:13.093 default K conflagrate Fluffy_Pillow 143784.3/1100000: 13% mana | 2.0/5: 40% soul_shard lord_of_flames, embrace_chaos, nefarious_pact, accelerando(2)
1:13.878 default R chaos_bolt Fluffy_Pillow 155289.4/1100000: 14% mana | 3.0/5: 60% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, nefarious_pact, accelerando(2)
1:14.820 default K conflagrate Fluffy_Pillow 169230.4/1100000: 15% mana | 1.0/5: 20% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, nefarious_pact, accelerando(3)
1:15.592 default S incinerate Fluffy_Pillow 180711.2/1100000: 16% mana | 2.0/5: 40% soul_shard lord_of_flames, embrace_chaos, nefarious_pact, accelerando(3)
1:16.560 default R chaos_bolt Fluffy_Pillow 129106.7/1100000: 12% mana | 3.0/5: 60% soul_shard lord_of_flames, embrace_chaos, nefarious_pact, accelerando(3)
1:17.487 default S incinerate Fluffy_Pillow 142935.0/1100000: 13% mana | 1.0/5: 20% soul_shard lord_of_flames, embrace_chaos, nefarious_pact, accelerando(4)
1:18.440 default K conflagrate Fluffy_Pillow 90589.0/1100000: 8% mana | 2.0/5: 40% soul_shard lord_of_flames, embrace_chaos, nefarious_pact
1:19.249 default R chaos_bolt Fluffy_Pillow 102097.1/1100000: 9% mana | 3.0/5: 60% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, nefarious_pact
1:20.217 default S incinerate Fluffy_Pillow 115867.1/1100000: 11% mana | 1.0/5: 20% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, nefarious_pact
1:21.228 default T life_tap Fluffy_Pillow 64248.8/1100000: 6% mana | 2.0/5: 40% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, devils_due
1:22.598 default C havoc enemy2 413737.3/1100000: 38% mana | 2.0/5: 40% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, devils_due
1:23.969 default R chaos_bolt Fluffy_Pillow 345240.1/1100000: 31% mana | 2.0/5: 40% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, devils_due
1:25.613 default K conflagrate Fluffy_Pillow 368626.3/1100000: 34% mana | 0.0/5: 0% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, devils_due
1:26.983 default S incinerate Fluffy_Pillow 388114.8/1100000: 35% mana | 1.0/5: 20% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, devils_due
1:28.697 default S incinerate Fluffy_Pillow 346753.0/1100000: 32% mana | 1.0/5: 20% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, devils_due, accelerando
1:30.388 default E immolate Fluffy_Pillow 305203.9/1100000: 28% mana | 1.0/5: 20% soul_shard lord_of_flames, conflagration_of_chaos, accelerando(2)
1:31.517 default L dimensional_rift Fluffy_Pillow 255750.6/1100000: 23% mana | 1.0/5: 20% soul_shard lord_of_flames, conflagration_of_chaos, accelerando(2)
1:32.646 default S incinerate Fluffy_Pillow 272297.3/1100000: 25% mana | 1.0/5: 20% soul_shard lessons_of_spacetime, lord_of_flames, conflagration_of_chaos, accelerando(2)
1:34.063 default S incinerate Fluffy_Pillow 227066.3/1100000: 21% mana | 1.0/5: 20% soul_shard lessons_of_spacetime, lord_of_flames, conflagration_of_chaos, accelerando(3)
1:35.458 default M service_imp Fluffy_Pillow 181812.0/1100000: 17% mana | 2.0/5: 40% soul_shard lessons_of_spacetime, lord_of_flames, conflagration_of_chaos, accelerando(3)
1:36.573 default R chaos_bolt Fluffy_Pillow 198393.6/1100000: 18% mana | 2.0/5: 40% soul_shard lessons_of_spacetime, lord_of_flames, conflagration_of_chaos, accelerando(3)
1:38.795 default S incinerate Fluffy_Pillow 231465.5/1100000: 21% mana | 1.0/5: 20% soul_shard lessons_of_spacetime, lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(4)
1:40.170 default S incinerate Fluffy_Pillow 185639.8/1100000: 17% mana | 1.0/5: 20% soul_shard lessons_of_spacetime, lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando
1:41.607 default L dimensional_rift Fluffy_Pillow 140390.8/1100000: 13% mana | 1.0/5: 20% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando
1:42.753 default C havoc enemy2 156939.6/1100000: 14% mana | 1.0/5: 20% soul_shard lessons_of_spacetime, lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando
1:43.899 default G immolate Fluffy_Pillow 85488.4/1100000: 8% mana | 3.0/5: 60% soul_shard lessons_of_spacetime, lord_of_flames, conflagration_of_chaos, accelerando
1:45.045 default J conflagrate Fluffy_Pillow 36038.1/1100000: 3% mana | 3.0/5: 60% soul_shard lessons_of_spacetime, lord_of_flames, conflagration_of_chaos, accelerando(2)
1:46.174 default R chaos_bolt Fluffy_Pillow 52584.9/1100000: 5% mana | 4.0/5: 80% soul_shard lessons_of_spacetime, lord_of_flames, accelerando(2)
1:48.429 default R chaos_bolt Fluffy_Pillow 85796.7/1100000: 8% mana | 4.0/5: 80% soul_shard lessons_of_spacetime, lord_of_flames, embrace_chaos, accelerando(3)
1:49.765 default K conflagrate Fluffy_Pillow 105666.0/1100000: 10% mana | 2.0/5: 40% soul_shard lessons_of_spacetime, lord_of_flames, embrace_chaos, accelerando(4)
1:50.861 default R chaos_bolt Fluffy_Pillow 122201.4/1100000: 11% mana | 3.0/5: 60% soul_shard lessons_of_spacetime, lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(4)
1:52.177 default K conflagrate Fluffy_Pillow 142045.6/1100000: 13% mana | 2.0/5: 40% soul_shard lessons_of_spacetime, lord_of_flames, conflagration_of_chaos, embrace_chaos
1:53.341 default R chaos_bolt Fluffy_Pillow 158603.7/1100000: 14% mana | 3.0/5: 60% soul_shard lessons_of_spacetime, lord_of_flames, embrace_chaos
1:54.738 default K conflagrate Fluffy_Pillow 178476.3/1100000: 16% mana | 2.0/5: 40% soul_shard lessons_of_spacetime, lord_of_flames, embrace_chaos
1:55.902 default R chaos_bolt Fluffy_Pillow 195034.4/1100000: 18% mana | 3.0/5: 60% soul_shard lessons_of_spacetime, lord_of_flames, conflagration_of_chaos, embrace_chaos
1:57.295 default S incinerate Fluffy_Pillow 214850.1/1100000: 20% mana | 2.0/5: 40% soul_shard lessons_of_spacetime, lord_of_flames, conflagration_of_chaos, embrace_chaos
1:58.753 default K conflagrate Fluffy_Pillow 169591.5/1100000: 15% mana | 2.0/5: 40% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando
1:59.901 default R chaos_bolt Fluffy_Pillow 186169.2/1100000: 17% mana | 3.0/5: 60% soul_shard lord_of_flames, embrace_chaos, accelerando
2:01.276 default S incinerate Fluffy_Pillow 206024.9/1100000: 19% mana | 1.0/5: 20% soul_shard lord_of_flames, embrace_chaos, accelerando
2:02.712 default S incinerate Fluffy_Pillow 160761.5/1100000: 15% mana | 1.0/5: 20% soul_shard lord_of_flames, embrace_chaos, accelerando
2:04.148 default C havoc enemy2 115498.1/1100000: 10% mana | 1.0/5: 20% soul_shard lord_of_flames, embrace_chaos, accelerando
2:05.295 default T life_tap Fluffy_Pillow 44061.3/1100000: 4% mana | 1.0/5: 20% soul_shard lord_of_flames, accelerando
2:06.443 default E immolate Fluffy_Pillow 390639.0/1100000: 36% mana | 1.0/5: 20% soul_shard lord_of_flames, accelerando
2:07.591 default P soul_harvest Fluffy_Pillow 341218.0/1100000: 31% mana | 1.0/5: 20% soul_shard lord_of_flames, accelerando(2)
2:07.591 default I potion Fluffy_Pillow 341218.0/1100000: 31% mana | 1.0/5: 20% soul_shard soul_harvest, lord_of_flames, accelerando(2)
2:07.591 default S incinerate Fluffy_Pillow 341218.0/1100000: 31% mana | 1.0/5: 20% soul_shard soul_harvest, lord_of_flames, accelerando(2), potion_of_deadly_grace
2:09.007 default R chaos_bolt Fluffy_Pillow 295971.1/1100000: 27% mana | 2.0/5: 40% soul_shard soul_harvest, lord_of_flames, accelerando(2), potion_of_deadly_grace
2:11.261 default S incinerate Fluffy_Pillow 328784.9/1100000: 30% mana | 0.0/5: 0% soul_shard soul_harvest, lord_of_flames, embrace_chaos, potion_of_deadly_grace
2:12.717 default S incinerate Fluffy_Pillow 283496.8/1100000: 26% mana | 1.0/5: 20% soul_shard soul_harvest, lord_of_flames, embrace_chaos, potion_of_deadly_grace
2:14.175 default S incinerate Fluffy_Pillow 238237.1/1100000: 22% mana | 1.0/5: 20% soul_shard soul_harvest, lord_of_flames, embrace_chaos, potion_of_deadly_grace
2:15.632 default R chaos_bolt Fluffy_Pillow 192964.1/1100000: 18% mana | 2.0/5: 40% soul_shard soul_harvest, lord_of_flames, accelerando, potion_of_deadly_grace
2:17.922 default G immolate Fluffy_Pillow 226032.9/1100000: 21% mana | 0.0/5: 0% soul_shard soul_harvest, lord_of_flames, embrace_chaos, accelerando, potion_of_deadly_grace
2:19.068 default J conflagrate Fluffy_Pillow 176581.7/1100000: 16% mana | 0.0/5: 0% soul_shard soul_harvest, lord_of_flames, embrace_chaos, accelerando, potion_of_deadly_grace
2:20.215 default K conflagrate Fluffy_Pillow 193144.9/1100000: 18% mana | 1.0/5: 20% soul_shard soul_harvest, lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando, potion_of_deadly_grace
2:21.360 default K conflagrate Fluffy_Pillow 209679.3/1100000: 19% mana | 2.0/5: 40% soul_shard soul_harvest, lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando, potion_of_deadly_grace
2:22.506 default L dimensional_rift Fluffy_Pillow 226228.1/1100000: 21% mana | 3.0/5: 60% soul_shard soul_harvest, lord_of_flames, accelerando, potion_of_deadly_grace
2:23.652 default R chaos_bolt Fluffy_Pillow 242777.0/1100000: 22% mana | 3.0/5: 60% soul_shard soul_harvest, lessons_of_spacetime, lord_of_flames, accelerando, potion_of_deadly_grace
2:25.943 default C havoc enemy2 275861.5/1100000: 25% mana | 1.0/5: 20% soul_shard soul_harvest, lessons_of_spacetime, lord_of_flames, embrace_chaos, accelerando(2), potion_of_deadly_grace
2:27.073 default K conflagrate Fluffy_Pillow 204422.9/1100000: 19% mana | 2.0/5: 40% soul_shard lessons_of_spacetime, lord_of_flames, embrace_chaos, accelerando(2), potion_of_deadly_grace
2:28.202 default R chaos_bolt Fluffy_Pillow 220722.3/1100000: 20% mana | 3.0/5: 60% soul_shard lessons_of_spacetime, lord_of_flames, embrace_chaos, potion_of_deadly_grace
2:29.598 default S incinerate Fluffy_Pillow 240580.6/1100000: 22% mana | 1.0/5: 20% soul_shard lessons_of_spacetime, lord_of_flames, embrace_chaos, potion_of_deadly_grace
2:31.056 default S incinerate Fluffy_Pillow 195321.0/1100000: 18% mana | 1.0/5: 20% soul_shard lessons_of_spacetime, lord_of_flames, embrace_chaos, potion_of_deadly_grace
2:32.512 default S incinerate Fluffy_Pillow 150032.9/1100000: 14% mana | 1.0/5: 20% soul_shard lessons_of_spacetime, lord_of_flames, embrace_chaos, potion_of_deadly_grace
2:33.970 default K conflagrate Fluffy_Pillow 104773.2/1100000: 10% mana | 1.0/5: 20% soul_shard lessons_of_spacetime, lord_of_flames, potion_of_deadly_grace
2:35.134 default R chaos_bolt Fluffy_Pillow 121331.4/1100000: 11% mana | 2.0/5: 40% soul_shard lessons_of_spacetime, lord_of_flames, conflagration_of_chaos, potion_of_deadly_grace
2:37.459 default S incinerate Fluffy_Pillow 154406.2/1100000: 14% mana | 1.0/5: 20% soul_shard lessons_of_spacetime, lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando, potion_of_deadly_grace
2:38.895 default L dimensional_rift Fluffy_Pillow 109142.8/1100000: 10% mana | 1.0/5: 20% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando
2:40.043 default S incinerate Fluffy_Pillow 125739.9/1100000: 11% mana | 1.0/5: 20% soul_shard lessons_of_spacetime, lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(2)
2:41.457 default E immolate Fluffy_Pillow 80463.6/1100000: 7% mana | 2.0/5: 40% soul_shard lessons_of_spacetime, lord_of_flames, conflagration_of_chaos, accelerando(2)
2:42.585 default R chaos_bolt Fluffy_Pillow 30995.7/1100000: 3% mana | 4.0/5: 80% soul_shard lessons_of_spacetime, lord_of_flames, conflagration_of_chaos, accelerando(2)
2:44.841 default T life_tap Fluffy_Pillow 64061.6/1100000: 6% mana | 2.0/5: 40% soul_shard lessons_of_spacetime, lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(3)
2:45.955 default C havoc enemy2 410628.4/1100000: 37% mana | 2.0/5: 40% soul_shard lessons_of_spacetime, lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(3)
2:47.068 default S incinerate Fluffy_Pillow 339423.7/1100000: 31% mana | 2.0/5: 40% soul_shard lessons_of_spacetime, lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(5)
2:48.424 default R chaos_bolt Fluffy_Pillow 294173.6/1100000: 27% mana | 2.0/5: 40% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(5)
2:49.723 default S incinerate Fluffy_Pillow 313760.5/1100000: 29% mana | 0.0/5: 0% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos
2:51.179 default S incinerate Fluffy_Pillow 268472.4/1100000: 24% mana | 0.0/5: 0% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos
2:52.637 default G immolate Fluffy_Pillow 223212.7/1100000: 20% mana | 1.0/5: 20% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos
2:53.800 default J conflagrate Fluffy_Pillow 173756.7/1100000: 16% mana | 2.0/5: 40% soul_shard lord_of_flames, conflagration_of_chaos
2:54.964 default R chaos_bolt Fluffy_Pillow 190314.8/1100000: 17% mana | 3.0/5: 60% soul_shard lord_of_flames
2:57.287 default K conflagrate Fluffy_Pillow 223630.8/1100000: 20% mana | 2.0/5: 40% soul_shard lord_of_flames, embrace_chaos, accelerando(2)
2:58.417 default R chaos_bolt Fluffy_Pillow 240192.2/1100000: 22% mana | 4.0/5: 80% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(2)
2:59.771 default K conflagrate Fluffy_Pillow 260037.4/1100000: 24% mana | 2.0/5: 40% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(3)
3:00.885 default R chaos_bolt Fluffy_Pillow 276604.2/1100000: 25% mana | 4.0/5: 80% soul_shard lord_of_flames, embrace_chaos, accelerando(3)
3:02.223 default K conflagrate Fluffy_Pillow 296502.1/1100000: 27% mana | 2.0/5: 40% soul_shard lord_of_flames, embrace_chaos, accelerando(3)
3:03.334 default L dimensional_rift Fluffy_Pillow 313024.3/1100000: 28% mana | 3.0/5: 60% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(3)
3:04.445 default H berserking Fluffy_Pillow 329546.4/1100000: 30% mana | 3.0/5: 60% soul_shard lessons_of_spacetime, lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(3)
3:04.445 default R chaos_bolt Fluffy_Pillow 329546.4/1100000: 30% mana | 3.0/5: 60% soul_shard berserking, lessons_of_spacetime, lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(3)
3:05.606 default M service_imp Fluffy_Pillow 349403.0/1100000: 32% mana | 2.0/5: 40% soul_shard berserking, lessons_of_spacetime, lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(4)
3:06.561 default C havoc enemy2 365972.3/1100000: 33% mana | 1.0/5: 20% soul_shard berserking, lessons_of_spacetime, lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(4)
3:07.517 default K conflagrate Fluffy_Pillow 294558.9/1100000: 27% mana | 1.0/5: 20% soul_shard berserking, lessons_of_spacetime, lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(4)
3:08.474 default R chaos_bolt Fluffy_Pillow 310818.0/1100000: 28% mana | 2.0/5: 40% soul_shard berserking, lessons_of_spacetime, lord_of_flames, embrace_chaos, accelerando
3:09.670 default S incinerate Fluffy_Pillow 330679.5/1100000: 30% mana | 1.0/5: 20% soul_shard berserking, lessons_of_spacetime, lord_of_flames, embrace_chaos, accelerando
3:10.918 default S incinerate Fluffy_Pillow 285404.5/1100000: 26% mana | 2.0/5: 40% soul_shard berserking, lessons_of_spacetime, lord_of_flames, embrace_chaos, accelerando
3:12.169 default S incinerate Fluffy_Pillow 240179.3/1100000: 22% mana | 2.0/5: 40% soul_shard berserking, lessons_of_spacetime, lord_of_flames, embrace_chaos, accelerando
3:13.419 default R chaos_bolt Fluffy_Pillow 194937.5/1100000: 18% mana | 3.0/5: 60% soul_shard berserking, lord_of_flames, embrace_chaos, accelerando
3:14.615 default S incinerate Fluffy_Pillow 214431.6/1100000: 19% mana | 1.0/5: 20% soul_shard lord_of_flames, embrace_chaos, accelerando(2)
3:16.031 default E immolate Fluffy_Pillow 169184.7/1100000: 15% mana | 1.0/5: 20% soul_shard lord_of_flames, embrace_chaos, accelerando(2)
3:17.161 default S incinerate Fluffy_Pillow 119769.8/1100000: 11% mana | 1.0/5: 20% soul_shard lord_of_flames, embrace_chaos, accelerando(3)
3:18.555 default R chaos_bolt Fluffy_Pillow 74500.5/1100000: 7% mana | 2.0/5: 40% soul_shard lord_of_flames, embrace_chaos, accelerando(3)
3:19.890 default S incinerate Fluffy_Pillow 94353.9/1100000: 9% mana | 0.0/5: 0% soul_shard lord_of_flames, embrace_chaos, accelerando(3)
3:21.286 default T life_tap Fluffy_Pillow 48349.2/1100000: 4% mana | 0.0/5: 0% soul_shard lord_of_flames, embrace_chaos
3:22.451 default S incinerate Fluffy_Pillow 394921.6/1100000: 36% mana | 1.0/5: 20% soul_shard lord_of_flames, embrace_chaos
3:23.909 default G immolate Fluffy_Pillow 349663.0/1100000: 32% mana | 1.0/5: 20% soul_shard lord_of_flames, accelerando
3:25.056 default J conflagrate Fluffy_Pillow 300226.3/1100000: 27% mana | 1.0/5: 20% soul_shard lord_of_flames, accelerando
3:26.203 default K conflagrate Fluffy_Pillow 316789.5/1100000: 29% mana | 2.0/5: 40% soul_shard lord_of_flames, accelerando
3:27.350 default C havoc enemy2 333352.8/1100000: 30% mana | 4.0/5: 80% soul_shard lord_of_flames, conflagration_of_chaos, accelerando
3:28.495 default R chaos_bolt Fluffy_Pillow 261887.2/1100000: 24% mana | 4.0/5: 80% soul_shard lord_of_flames, conflagration_of_chaos, accelerando
3:30.786 default K conflagrate Fluffy_Pillow 294970.4/1100000: 27% mana | 2.0/5: 40% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando
3:31.934 default R chaos_bolt Fluffy_Pillow 311548.1/1100000: 28% mana | 4.0/5: 80% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando
3:33.310 default K conflagrate Fluffy_Pillow 331465.0/1100000: 30% mana | 2.0/5: 40% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(2)
3:34.440 default R chaos_bolt Fluffy_Pillow 348026.4/1100000: 32% mana | 3.0/5: 60% soul_shard lord_of_flames, embrace_chaos, accelerando(2)
3:35.794 default S incinerate Fluffy_Pillow 367967.7/1100000: 33% mana | 2.0/5: 40% soul_shard lord_of_flames, embrace_chaos, nefarious_pact, accelerando(3)
3:36.761 default S incinerate Fluffy_Pillow 315794.5/1100000: 29% mana | 2.0/5: 40% soul_shard lord_of_flames, embrace_chaos, nefarious_pact
3:37.775 default R chaos_bolt Fluffy_Pillow 264257.6/1100000: 24% mana | 4.0/5: 80% soul_shard lord_of_flames, embrace_chaos, nefarious_pact, accelerando
3:38.730 default R chaos_bolt Fluffy_Pillow 278143.2/1100000: 25% mana | 3.0/5: 60% soul_shard lord_of_flames, embrace_chaos, nefarious_pact, accelerando(2)
3:39.670 default K conflagrate Fluffy_Pillow 291919.9/1100000: 27% mana | 1.0/5: 20% soul_shard lord_of_flames, embrace_chaos, nefarious_pact, accelerando(2)
3:40.454 default S incinerate Fluffy_Pillow 303410.3/1100000: 28% mana | 2.0/5: 40% soul_shard lord_of_flames, embrace_chaos, nefarious_pact, accelerando(2)
3:41.437 default R chaos_bolt Fluffy_Pillow 251863.1/1100000: 23% mana | 3.0/5: 60% soul_shard lord_of_flames, embrace_chaos, nefarious_pact, accelerando(3)
3:42.365 default S incinerate Fluffy_Pillow 265706.7/1100000: 24% mana | 1.0/5: 20% soul_shard lord_of_flames, embrace_chaos, nefarious_pact, accelerando(4)
3:43.318 default S incinerate Fluffy_Pillow 214114.5/1100000: 19% mana | 1.0/5: 20% soul_shard lord_of_flames, embrace_chaos, nefarious_pact, accelerando(5)
3:44.259 default S incinerate Fluffy_Pillow 162514.0/1100000: 15% mana | 2.0/5: 40% soul_shard lord_of_flames, embrace_chaos, nefarious_pact, accelerando(5)
3:45.201 default S incinerate Fluffy_Pillow 110928.8/1100000: 10% mana | 2.0/5: 40% soul_shard lord_of_flames, embrace_chaos, nefarious_pact, accelerando(5)
3:46.141 default L dimensional_rift Fluffy_Pillow 59313.0/1100000: 5% mana | 2.0/5: 40% soul_shard lord_of_flames, embrace_chaos, nefarious_pact, accelerando(5)
3:46.903 default R chaos_bolt Fluffy_Pillow 70973.4/1100000: 6% mana | 3.0/5: 60% soul_shard lessons_of_spacetime, lord_of_flames, nefarious_pact, accelerando(5)
3:48.402 default C havoc enemy2 93911.5/1100000: 9% mana | 1.0/5: 20% soul_shard lessons_of_spacetime, lord_of_flames, embrace_chaos, devils_due, accelerando(5)
3:49.678 default O summon_doomguard Fluffy_Pillow 25347.9/1100000: 2% mana | 1.0/5: 20% soul_shard lessons_of_spacetime, lord_of_flames, embrace_chaos, devils_due
3:51.049 default T life_tap Fluffy_Pillow 44850.6/1100000: 4% mana | 0.0/5: 0% soul_shard lessons_of_spacetime, lord_of_flames, embrace_chaos, devils_due
3:52.419 default E immolate Fluffy_Pillow 394339.2/1100000: 36% mana | 0.0/5: 0% soul_shard lessons_of_spacetime, lord_of_flames, devils_due
3:53.791 default S incinerate Fluffy_Pillow 347857.4/1100000: 32% mana | 0.0/5: 0% soul_shard lessons_of_spacetime, lord_of_flames, devils_due, accelerando
3:55.483 default S incinerate Fluffy_Pillow 306290.8/1100000: 28% mana | 0.0/5: 0% soul_shard lessons_of_spacetime, lord_of_flames, accelerando
3:56.920 default G immolate Fluffy_Pillow 261129.5/1100000: 24% mana | 0.0/5: 0% soul_shard lessons_of_spacetime, lord_of_flames, accelerando(3)
3:58.033 default J conflagrate Fluffy_Pillow 211681.4/1100000: 19% mana | 0.0/5: 0% soul_shard lessons_of_spacetime, lord_of_flames, accelerando(3)
3:59.148 default K conflagrate Fluffy_Pillow 228263.0/1100000: 21% mana | 2.0/5: 40% soul_shard lessons_of_spacetime, lord_of_flames, nefarious_pact, accelerando(3)
3:59.923 default R chaos_bolt Fluffy_Pillow 239788.4/1100000: 22% mana | 3.0/5: 60% soul_shard lessons_of_spacetime, lord_of_flames, conflagration_of_chaos, nefarious_pact, accelerando(3)
4:01.465 default K conflagrate Fluffy_Pillow 262720.1/1100000: 24% mana | 2.0/5: 40% soul_shard lessons_of_spacetime, lord_of_flames, conflagration_of_chaos, embrace_chaos, nefarious_pact, accelerando(3)
4:02.238 default R chaos_bolt Fluffy_Pillow 274215.7/1100000: 25% mana | 3.0/5: 60% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, nefarious_pact, accelerando(3)
4:03.165 default S incinerate Fluffy_Pillow 288001.5/1100000: 26% mana | 1.0/5: 20% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, nefarious_pact, accelerando(3)
4:04.133 default S incinerate Fluffy_Pillow 236397.0/1100000: 21% mana | 2.0/5: 40% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, nefarious_pact, accelerando(3)
4:05.102 default R chaos_bolt Fluffy_Pillow 184807.4/1100000: 17% mana | 3.0/5: 60% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, nefarious_pact, accelerando(3)
4:06.028 default K conflagrate Fluffy_Pillow 198461.4/1100000: 18% mana | 1.0/5: 20% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, nefarious_pact
4:06.837 default S incinerate Fluffy_Pillow 209969.6/1100000: 19% mana | 2.0/5: 40% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, nefarious_pact
4:07.848 default P soul_harvest Fluffy_Pillow 158504.6/1100000: 14% mana | 2.0/5: 40% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, nefarious_pact, accelerando
4:07.848 default S incinerate Fluffy_Pillow 158504.6/1100000: 14% mana | 2.0/5: 40% soul_shard soul_harvest, lord_of_flames, conflagration_of_chaos, embrace_chaos, nefarious_pact, accelerando
4:08.844 default C havoc enemy2 106887.3/1100000: 10% mana | 2.0/5: 40% soul_shard soul_harvest, lord_of_flames, conflagration_of_chaos, embrace_chaos, nefarious_pact, accelerando
4:09.641 default R chaos_bolt Fluffy_Pillow 30396.4/1100000: 3% mana | 2.0/5: 40% soul_shard soul_harvest, lord_of_flames, conflagration_of_chaos, embrace_chaos, nefarious_pact, accelerando
4:10.595 default T life_tap Fluffy_Pillow 44172.7/1100000: 4% mana | 0.0/5: 0% soul_shard soul_harvest, lord_of_flames, conflagration_of_chaos, embrace_chaos, nefarious_pact, accelerando
4:11.390 default K conflagrate Fluffy_Pillow 385652.9/1100000: 35% mana | 0.0/5: 0% soul_shard soul_harvest, lord_of_flames, conflagration_of_chaos, embrace_chaos, devils_due, accelerando
4:12.960 default S incinerate Fluffy_Pillow 408324.5/1100000: 37% mana | 1.0/5: 20% soul_shard soul_harvest, lord_of_flames, embrace_chaos, devils_due, accelerando
4:14.652 default S incinerate Fluffy_Pillow 366757.8/1100000: 33% mana | 1.0/5: 20% soul_shard soul_harvest, lord_of_flames, devils_due, accelerando
4:16.343 default S incinerate Fluffy_Pillow 325176.7/1100000: 30% mana | 1.0/5: 20% soul_shard soul_harvest, lord_of_flames, devils_due, accelerando
4:18.033 default S incinerate Fluffy_Pillow 283880.4/1100000: 26% mana | 1.0/5: 20% soul_shard soul_harvest, lord_of_flames, devils_due, accelerando(2)
4:19.700 default E immolate Fluffy_Pillow 242147.3/1100000: 22% mana | 1.0/5: 20% soul_shard soul_harvest, lord_of_flames, accelerando
4:20.847 default S incinerate Fluffy_Pillow 192904.8/1100000: 18% mana | 1.0/5: 20% soul_shard soul_harvest, lord_of_flames, accelerando(2)
4:22.263 default S incinerate Fluffy_Pillow 147657.8/1100000: 13% mana | 1.0/5: 20% soul_shard soul_harvest, lord_of_flames, accelerando(2)
4:23.680 default R chaos_bolt Fluffy_Pillow 102425.5/1100000: 9% mana | 2.0/5: 40% soul_shard soul_harvest, lord_of_flames, accelerando(2)
4:25.936 default S incinerate Fluffy_Pillow 135489.7/1100000: 12% mana | 1.0/5: 20% soul_shard soul_harvest, lord_of_flames, embrace_chaos, accelerando(2)
4:27.351 default S incinerate Fluffy_Pillow 90228.1/1100000: 8% mana | 1.0/5: 20% soul_shard lord_of_flames, embrace_chaos, accelerando(2)
4:28.769 default T life_tap Fluffy_Pillow 45136.8/1100000: 4% mana | 1.0/5: 20% soul_shard lord_of_flames, embrace_chaos, nefarious_pact, accelerando(3)
4:29.542 default C havoc enemy2 386632.4/1100000: 35% mana | 1.0/5: 20% soul_shard lord_of_flames, embrace_chaos, nefarious_pact, accelerando(3)
4:30.315 default R chaos_bolt Fluffy_Pillow 310294.7/1100000: 28% mana | 2.0/5: 40% soul_shard lord_of_flames, nefarious_pact, accelerando(4)
4:31.834 default G immolate Fluffy_Pillow 332783.5/1100000: 30% mana | 1.0/5: 20% soul_shard lord_of_flames, embrace_chaos, nefarious_pact
4:32.642 default J conflagrate Fluffy_Pillow 278277.5/1100000: 25% mana | 1.0/5: 20% soul_shard lord_of_flames, embrace_chaos, nefarious_pact
4:33.450 default J conflagrate Fluffy_Pillow 289771.5/1100000: 26% mana | 2.0/5: 40% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, nefarious_pact
4:34.259 default J conflagrate Fluffy_Pillow 301453.8/1100000: 27% mana | 3.0/5: 60% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, nefarious_pact, accelerando
4:35.053 default L dimensional_rift Fluffy_Pillow 312919.6/1100000: 28% mana | 5.0/5: 100% soul_shard lord_of_flames, embrace_chaos, nefarious_pact, accelerando
4:35.850 default M service_imp Fluffy_Pillow 324428.7/1100000: 29% mana | 5.0/5: 100% soul_shard lessons_of_spacetime, lord_of_flames, nefarious_pact, accelerando
4:36.644 default R chaos_bolt Fluffy_Pillow 336046.4/1100000: 31% mana | 4.0/5: 80% soul_shard lessons_of_spacetime, lord_of_flames, nefarious_pact, accelerando(2)
4:38.210 default R chaos_bolt Fluffy_Pillow 358997.9/1100000: 33% mana | 3.0/5: 60% soul_shard lessons_of_spacetime, lord_of_flames, embrace_chaos, nefarious_pact, accelerando(2)
4:39.150 default S incinerate Fluffy_Pillow 372976.4/1100000: 34% mana | 1.0/5: 20% soul_shard lessons_of_spacetime, lord_of_flames, embrace_chaos, nefarious_pact, accelerando(4)
4:40.103 default J conflagrate Fluffy_Pillow 321354.3/1100000: 29% mana | 1.0/5: 20% soul_shard lessons_of_spacetime, lord_of_flames, embrace_chaos, nefarious_pact, accelerando(4)
4:40.865 default S incinerate Fluffy_Pillow 332850.6/1100000: 30% mana | 2.0/5: 40% soul_shard lessons_of_spacetime, lord_of_flames, conflagration_of_chaos, embrace_chaos, devils_due, accelerando(4)
4:42.486 default R chaos_bolt Fluffy_Pillow 291550.0/1100000: 27% mana | 2.0/5: 40% soul_shard lessons_of_spacetime, lord_of_flames, conflagration_of_chaos, embrace_chaos, devils_due, accelerando(5)
4:44.015 default S incinerate Fluffy_Pillow 314947.2/1100000: 29% mana | 1.0/5: 20% soul_shard lessons_of_spacetime, lord_of_flames, conflagration_of_chaos, embrace_chaos, devils_due, accelerando(5)
4:45.612 default S incinerate Fluffy_Pillow 273210.5/1100000: 25% mana | 1.0/5: 20% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, devils_due
4:47.329 default J conflagrate Fluffy_Pillow 231635.2/1100000: 21% mana | 2.0/5: 40% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, devils_due
4:48.700 default R chaos_bolt Fluffy_Pillow 251138.0/1100000: 23% mana | 3.0/5: 60% soul_shard lord_of_flames, conflagration_of_chaos
4:51.024 default C havoc enemy2 284197.3/1100000: 26% mana | 2.0/5: 40% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos
4:52.187 default S incinerate Fluffy_Pillow 212741.2/1100000: 19% mana | 2.0/5: 40% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos
4:53.644 default J conflagrate Fluffy_Pillow 167582.8/1100000: 15% mana | 2.0/5: 40% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando
4:54.791 default E immolate Fluffy_Pillow 184350.0/1100000: 17% mana | 3.0/5: 60% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(2)
4:55.921 default R chaos_bolt Fluffy_Pillow 134912.5/1100000: 12% mana | 3.0/5: 60% soul_shard lord_of_flames, conflagration_of_chaos, accelerando(3)

Stats

Raid-Buffed Unbuffed Gear Amount
Strength 4201 3876 0
Agility 7254 6929 0
Stamina 55291 55291 34622
Intellect 50653 48947 39293 (1278)
Spirit 1 1 0
Health 3317460 3317460 0
Mana 1100000 1100000 0
Soul Shard 5 5 0
Spell Power 50653 48947 0
Crit 15.51% 15.51% 4202
Haste 29.32% 28.32% 10620
Damage / Heal Versatility 4.93% 4.93% 2342
ManaReg per Second 14225 14115 0
Mastery 69.27% 69.27% 6034
Armor 1996 1996 1996
Run Speed 7 0 0

Gear

Source Slot Average Item Level: 907.00
Local Head Eyes of Azj'Aqir
ilevel: 900, stats: { 253 Armor, +3255 Sta, +2170 Int, +1074 Haste, +578 Vers }
Local Neck Radiant String of Scorpid Eyes
ilevel: 900, stats: { +1831 Sta, +2011 Haste, +922 Crit }, enchant: mark_of_the_hidden_satyr
Local Shoulders Lessons of Space-Time
ilevel: 940, stats: { 269 Armor, +3544 Sta, +2362 Int, +822 Haste, +617 Mastery }
Local Chest Finery of Azj'Aqir
ilevel: 905, stats: { 317 Armor, +3410 Sta, +2273 Int, +1058 Mastery, +625 Crit }
Local Waist Man'ari Skullbuckled Cinch
ilevel: 900, stats: { 175 Armor, +2442 Sta, +1628 Int, +699 Haste, +540 Mastery }
Local Legs Leggings of Azj'Aqir
ilevel: 900, stats: { 272 Armor, +3255 Sta, +2170 Int, +932 Crit, +720 Haste }
Local Feet Outcast Wanderer's Footrags
ilevel: 910, stats: { 222 Armor, +2680 Sta, +1786 Int, +864 Crit, +422 Mastery }
Local Wrists Woven Lasher Tendril Bracers
ilevel: 900, stats: { 136 Armor, +1831 Sta, +1221 Int, +644 Haste, +285 Vers }
Local Hands Clutch of Azj'Aqir
ilevel: 900, stats: { 194 Armor, +2442 Sta, +1628 Int, +859 Crit, +380 Mastery }
Local Finger1 Ring of the Scoured Clan
ilevel: 900, stats: { +1831 Sta, +2095 Mastery, +838 Haste }, enchant: { +200 Haste }
Local Finger2 Ring of Braided Stems
ilevel: 905, stats: { +1918 Sta, +1814 Haste, +1209 Vers }, enchant: { +200 Haste }
Local Trinket1 Whispers in the Dark
ilevel: 905, stats: { +2162 Int }
Local Trinket2 Erratic Metronome
ilevel: 900, stats: { +2063 Int }
Local Back Astromancer's Greatcloak
ilevel: 905, stats: { 158 Armor, +1918 Sta, +1278 StrAgiInt, +676 Haste, +270 Vers }, enchant: { +200 Int }
Local Main Hand Scepter of Sargeras
ilevel: 929, weapon: { 7005 - 10509, 3.6 }, stats: { +2843 Int, +4265 Sta, +922 Haste, +922 Mastery, +15509 Int }, relics: { +61 ilevels, +59 ilevels, +61 ilevels }

Talents

Level
15 Backdraft (Destruction Warlock) Roaring Blaze (Destruction Warlock) Shadowburn (Destruction Warlock)
30 Reverse Entropy (Destruction Warlock) Eradication (Destruction Warlock) Empowered Life Tap
45 Demonic Circle Mortal Coil Shadowfury
60 Cataclysm (Destruction Warlock) Fire and Brimstone (Destruction Warlock) Soul Harvest
75 Demon Skin Burning Rush Dark Pact
90 Grimoire of Supremacy Grimoire of Service Grimoire of Sacrifice
100 Wreak Havoc (Destruction Warlock) Channel Demonfire (Destruction Warlock) Soul Conduit

Profile

warlock="Shoulders"
level=110
race=troll
role=spell
position=back
talents=2203021
artifact=38:0:0:0:0:803:1:804:3:805:3:806:3:807:3:808:3:809:3:810:3:811:3:812:3:813:1:814:1:815:1:816:1:817:1:818:1:1355:1:1392:1:1609:4:1610:1:1611:1:1713:1
spec=destruction

# This default action priority list is automatically created based on your character.
# It is a attempt to provide you with a action list that is both simple and practicable,
# while resulting in a meaningful and good simulation. It may not result in the absolutely highest possible dps.
# Feel free to edit, adapt and improve it to your own needs.
# SimulationCraft is always looking for updates and improvements to the default action lists.

# Executed before combat begins. Accepts non-harmful actions only.
actions.precombat=flask,type=whispered_pact
actions.precombat+=/food,type=azshari_salad
actions.precombat+=/summon_pet,if=!talent.grimoire_of_supremacy.enabled&(!talent.grimoire_of_sacrifice.enabled|buff.demonic_power.down)
actions.precombat+=/summon_infernal,if=talent.grimoire_of_supremacy.enabled&artifact.lord_of_flames.rank>0
actions.precombat+=/summon_infernal,if=talent.grimoire_of_supremacy.enabled&active_enemies>1
actions.precombat+=/summon_doomguard,if=talent.grimoire_of_supremacy.enabled&active_enemies=1&artifact.lord_of_flames.rank=0
actions.precombat+=/augmentation,type=defiled
actions.precombat+=/snapshot_stats
actions.precombat+=/grimoire_of_sacrifice,if=talent.grimoire_of_sacrifice.enabled
actions.precombat+=/life_tap,if=talent.empowered_life_tap.enabled&!buff.empowered_life_tap.remains
actions.precombat+=/potion,name=prolonged_power
actions.precombat+=/chaos_bolt

# Executed every time the actor is available.
actions=havoc,target=2,if=active_enemies>1&(active_enemies<4|talent.wreak_havoc.enabled&active_enemies<6)&!debuff.havoc.remains
actions+=/dimensional_rift,if=charges=3
actions+=/immolate,if=remains<=tick_time
actions+=/immolate,cycle_targets=1,if=active_enemies>1&remains<=tick_time&(!talent.roaring_blaze.enabled|(!debuff.roaring_blaze.remains&action.conflagrate.charges<2+set_bonus.tier19_4pc))
actions+=/immolate,if=talent.roaring_blaze.enabled&remains<=duration&!debuff.roaring_blaze.remains&target.time_to_die>10&(action.conflagrate.charges=2+set_bonus.tier19_4pc|(action.conflagrate.charges>=1+set_bonus.tier19_4pc&action.conflagrate.recharge_time<cast_time+gcd)|target.time_to_die<24)
actions+=/berserking
actions+=/blood_fury
actions+=/arcane_torrent
actions+=/potion,name=deadly_grace,if=(buff.soul_harvest.remains|trinket.proc.any.react|target.time_to_die<=45)
actions+=/shadowburn,if=buff.conflagration_of_chaos.remains<=action.chaos_bolt.cast_time
actions+=/shadowburn,if=(charges=1+set_bonus.tier19_4pc&recharge_time<action.chaos_bolt.cast_time|charges=2+set_bonus.tier19_4pc)&soul_shard<5
actions+=/conflagrate,if=talent.roaring_blaze.enabled&(charges=2+set_bonus.tier19_4pc|(charges>=1+set_bonus.tier19_4pc&recharge_time<gcd)|target.time_to_die<24)
actions+=/conflagrate,if=talent.roaring_blaze.enabled&debuff.roaring_blaze.stack>0&dot.immolate.remains>dot.immolate.duration*0.3&(active_enemies=1|soul_shard<3)&soul_shard<5
actions+=/conflagrate,if=!talent.roaring_blaze.enabled&buff.backdraft.stack<3&buff.conflagration_of_chaos.remains<=action.chaos_bolt.cast_time
actions+=/conflagrate,if=!talent.roaring_blaze.enabled&buff.backdraft.stack<3&(charges=1+set_bonus.tier19_4pc&recharge_time<action.chaos_bolt.cast_time|charges=2+set_bonus.tier19_4pc)&soul_shard<5
actions+=/life_tap,if=talent.empowered_life_tap.enabled&buff.empowered_life_tap.remains<=gcd
actions+=/dimensional_rift,if=equipped.144369&!buff.lessons_of_spacetime.remains&((!talent.grimoire_of_supremacy.enabled&!cooldown.summon_doomguard.remains)|(talent.grimoire_of_service.enabled&!cooldown.service_pet.remains)|(talent.soul_harvest.enabled&!cooldown.soul_harvest.remains))
actions+=/service_pet
actions+=/summon_infernal,if=artifact.lord_of_flames.rank>0&!buff.lord_of_flames.remains
actions+=/summon_doomguard,if=!talent.grimoire_of_supremacy.enabled&spell_targets.infernal_awakening<=2&(target.time_to_die>180|target.health.pct<=20|target.time_to_die<30)
actions+=/summon_infernal,if=!talent.grimoire_of_supremacy.enabled&spell_targets.infernal_awakening>2
actions+=/summon_doomguard,if=talent.grimoire_of_supremacy.enabled&spell_targets.summon_infernal=1&artifact.lord_of_flames.rank>0&buff.lord_of_flames.remains&!pet.doomguard.active
actions+=/summon_doomguard,if=talent.grimoire_of_supremacy.enabled&spell_targets.summon_infernal=1&equipped.132379&!cooldown.sindorei_spite_icd.remains
actions+=/summon_infernal,if=talent.grimoire_of_supremacy.enabled&spell_targets.summon_infernal>1&equipped.132379&!cooldown.sindorei_spite_icd.remains
actions+=/soul_harvest
actions+=/channel_demonfire,if=dot.immolate.remains>cast_time
actions+=/havoc,if=active_enemies=1&talent.wreak_havoc.enabled&equipped.132375&!debuff.havoc.remains
actions+=/rain_of_fire,if=active_enemies>=3&cooldown.havoc.remains<=12&!talent.wreak_havoc.enabled
actions+=/rain_of_fire,if=active_enemies>=6&talent.wreak_havoc.enabled
actions+=/dimensional_rift,if=!equipped.144369|charges>1|((!talent.grimoire_of_service.enabled|recharge_time<cooldown.service_pet.remains)&(!talent.soul_harvest.enabled|recharge_time<cooldown.soul_harvest.remains)&(!talent.grimoire_of_supremacy.enabled|recharge_time<cooldown.summon_doomguard.remains))
actions+=/life_tap,if=talent.empowered_life_tap.enabled&buff.empowered_life_tap.remains<duration*0.3
actions+=/cataclysm
actions+=/chaos_bolt,if=(cooldown.havoc.remains>12&cooldown.havoc.remains|active_enemies<3|talent.wreak_havoc.enabled&active_enemies<6)&(set_bonus.tier19_4pc=0|!talent.eradication.enabled|buff.embrace_chaos.remains<=cast_time|soul_shard>=3)
actions+=/shadowburn
actions+=/conflagrate,if=!talent.roaring_blaze.enabled&buff.backdraft.stack<3
actions+=/immolate,if=!talent.roaring_blaze.enabled&remains<=duration*0.3
actions+=/incinerate
actions+=/life_tap

head=eyes_of_azjaqir,id=138314,bonus_id=3445
neck=radiant_string_of_scorpid_eyes,id=140898,bonus_id=3445,enchant_id=5439
shoulders=lessons_of_spacetime,id=144369,ilevel=940
back=astromancers_greatcloak,id=140909,bonus_id=3518,enchant_id=5436
chest=finery_of_azjaqir,id=138320,bonus_id=3518
wrists=woven_lasher_tendril_bracers,id=140886,bonus_id=3445
hands=clutch_of_azjaqir,id=138311,bonus_id=3445
waist=manari_skullbuckled_cinch,id=140887,bonus_id=3445
legs=leggings_of_azjaqir,id=138317,bonus_id=3445
feet=outcast_wanderers_footrags,id=140914,bonus_id=3519
finger1=ring_of_the_scoured_clan,id=140897,bonus_id=3445,enchant=binding_of_haste
finger2=ring_of_braided_stems,id=140896,bonus_id=3518,enchant=binding_of_haste
trinket1=whispers_in_the_dark,id=140809,ilevel=905
trinket2=erratic_metronome,id=140792,ilevel=900
main_hand=scepter_of_sargeras,id=128941,ilevel=929,gem_id=140826/140837/140826,relic_id=3519/3518:3518/3519

# Gear Summary
# gear_ilvl=906.60
# gear_stamina=34622
# gear_intellect=39293
# gear_crit_rating=4202
# gear_haste_rating=10620
# gear_mastery_rating=6034
# gear_versatility_rating=2342
# gear_armor=1996
# set_bonus=tier19_2pc=1
# set_bonus=tier19_4pc=1
default_pet=imp

Spite : 1379147 dps, 827968 dps to main target

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR
1379147.1 1379147.1 1233.3 / 0.089% 244072.8 / 17.7% 43.2
RPS Out RPS In Primary Resource Waiting APM Active Skill
25255.0 25255.0 Mana 0.00% 50.1 100.0% 100%
Talents
  • 15: Roaring Blaze (Destruction Warlock)
  • 30: Eradication (Destruction Warlock)
  • 60: Soul Harvest
  • 90: Grimoire of Service
  • 100: Wreak Havoc (Destruction Warlock)
  • Talent Calculator
Artifact

Charts

Abilities

Damage Stats DPS DPS% Execute Interval DPE DPET Type Count Hit Crit Avg Crit% Up%
Spite 1379147
Chaos Bolt 403774 29.3% 60.8 4.82sec 1996920 1335451 Direct 116.1 0 1044804 1044804 100.0%  

Stats details: chaos_bolt

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 60.76 116.13 0.00 0.00 1.4953 0.0000 121328400.03 121328400.03 0.00 1335451.06 1335451.06
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
crit 116.13 100.00% 1044804.09 659301 1781341 1045709.36 978617 1118866 121328400 121328400 0.00
 
 

Action details: chaos_bolt

Static Values
  • id:116858
  • school:chromatic
  • resource:soul_shard
  • range:40.0
  • travel_speed:16.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:2.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:3.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:116858
  • name:Chaos Bolt
  • school:chromatic
  • tooltip:
  • description:Unleashes a devastating blast of chaos, causing {$s1=1} Chaos damage. Chaos Bolt always critically strikes and your critical strike chance increases its damage.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:4.000000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
Conflagrate 168510 12.2% 48.3 6.21sec 1046619 1006769 Direct 96.1 308671 701919 526223 55.3%  

Stats details: conflagrate

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 48.33 96.12 0.00 0.00 1.0396 0.0000 50579064.78 50579064.78 0.00 1006768.94 1006768.94
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 42.94 44.68% 308671.00 198191 535472 308940.48 272858 352299 13255395 13255395 0.00
crit 53.17 55.32% 701918.71 396397 1238838 702439.24 622407 793349 37323670 37323670 0.00
 
 

Action details: conflagrate

Static Values
  • id:17962
  • school:fire
  • resource:chi
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:9.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:talent.roaring_blaze.enabled&(charges=2+set_bonus.tier19_4pc|(charges>=1+set_bonus.tier19_4pc&recharge_time<gcd)|target.time_to_die<24)
Spelldata
  • id:17962
  • name:Conflagrate
  • school:fire
  • tooltip:
  • description:Triggers an explosion on the target, dealing {$s1=1} Fire damage.{$?s196406=false}[ Reduces the cast time of Incinerate and Chaos Bolt by {$117828s1=30}% for {$117828d=10 seconds}.][] |cFFFFFFFFGenerates 1 Soul Shard.|r
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:2.265510
  • base_dd_min:1.00
  • base_dd_max:1.00
 
Cry Havoc 41562 3.0% 52.5 5.53sec 237973 0 Direct 105.0 102846 205478 118988 15.7%  

Stats details: cry_havoc

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 52.48 104.96 0.00 0.00 0.0000 0.0000 12488818.96 12488818.96 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 88.45 84.27% 102845.70 71370 172173 102957.71 95454 111834 9097016 9097016 0.00
crit 16.51 15.73% 205477.71 142741 344331 205663.69 169260 254274 3391803 3391803 0.00
 
 

Action details: cry_havoc

Static Values
  • id:243011
  • school:chromatic
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:243011
  • name:Cry Havoc
  • school:chromatic
  • tooltip:
  • description:Deals {$s2=0} Chaos damage to enemies within $A2 yards.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:1.000000
  • base_dd_min:0.00
  • base_dd_max:0.00
 
Deadly Grace 6120 0.4% 14.4 2.07sec 125764 0 Direct 14.4 108662 217305 125763 15.7%  

Stats details: deadly_grace

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 14.36 14.36 0.00 0.00 0.0000 0.0000 1806184.55 1806184.55 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 12.10 84.26% 108662.23 96342 115611 108673.32 100196 115611 1314924 1314924 0.00
crit 2.26 15.74% 217304.70 192685 231222 197324.74 0 231222 491261 491261 0.00
 
 

Action details: deadly_grace

Static Values
  • id:188091
  • school:arcane
  • resource:none
  • range:40.0
  • travel_speed:25.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:188091
  • name:Deadly Grace
  • school:arcane
  • tooltip:
  • description:Deal {$s1=63339 to 95008} Arcane damage.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:63338.72
  • base_dd_max:95008.08
 
Immolate 313015 22.7% 20.0 15.22sec 4702463 4464212 Direct 38.6 160864 321719 263080 63.5%  
Periodic 293.0 174617 349409 286002 63.7% 195.9%

Stats details: immolate

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 19.98 38.62 292.98 292.98 1.0534 2.0130 93953796.18 93953796.18 0.00 153814.84 4464211.55
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 14.08 36.46% 160864.09 104167 281268 160896.82 134349 201684 2264759 2264759 0.00
crit 24.54 63.54% 321718.91 208338 562833 321785.59 276520 364857 7895134 7895134 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 106.3 36.28% 174616.94 50 559163 175003.97 140078 211983 18558305 18558305 0.00
crit 186.7 63.72% 349409.40 87 1118343 350160.05 304185 403509 65235597 65235597 0.00
 
 

Action details: immolate

Static Values
  • id:348
  • school:fire
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:66000.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:1.50
  • base_crit:0.48
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:remains<=tick_time
Spelldata
  • id:348
  • name:Immolate
  • school:fire
  • tooltip:
  • description:Burns the enemy, causing {$s1=1} Fire damage immediately and an additional $157736o1 Fire damage over {$157736d=18 seconds}. |cFFFFFFFFPeriodic damage has a {$193541s1=15}% chance to generate 1 Soul Shard. Chance doubled on critical strikes.|r
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:1.332000
  • base_dd_min:1.00
  • base_dd_max:1.00
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.721500
  • base_td:0.00
  • dot_duration:18.00
  • base_tick_time:3.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
 
Incinerate 149720 10.9% 75.4 3.81sec 597449 465916 Direct 144.0 270177 540176 312560 15.7%  

Stats details: incinerate

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 75.35 144.04 0.00 0.00 1.2823 0.0000 45020055.99 45020055.99 0.00 465915.90 465915.90
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 121.42 84.30% 270176.70 168385 454950 270409.72 254253 292253 32805939 32805939 0.00
crit 22.61 15.70% 540175.98 336783 909905 540743.31 458084 684230 12214117 12214117 0.00
 
 

Action details: incinerate

Static Values
  • id:29722
  • school:fire
  • resource:mana
  • range:40.0
  • travel_speed:20.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:66000.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:1.88
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:29722
  • name:Incinerate
  • school:fire
  • tooltip:
  • description:Draws fire toward the enemy, dealing {$s2=0} Fire damage.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:2.331000
  • base_dd_min:0.00
  • base_dd_max:0.00
 
Mark of the Hidden Satyr 10578 0.8% 19.9 15.03sec 159229 0 Direct 19.9 137595 275641 159227 15.7%  

Stats details: mark_of_the_hidden_satyr

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 19.95 19.95 0.00 0.00 0.0000 0.0000 3176489.81 3176489.81 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 16.82 84.33% 137594.52 127447 185045 137662.28 127447 156484 2314715 2314715 0.00
crit 3.13 15.67% 275640.76 254894 370091 264727.89 0 370091 861775 861775 0.00
 
 

Action details: mark_of_the_hidden_satyr

Static Values
  • id:191259
  • school:fire
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:191259
  • name:Mark of the Hidden Satyr
  • school:fire
  • tooltip:
  • description:Deals fire damage.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:2.500000
  • spell_power_mod.direct:2.000000
  • base_dd_min:0.00
  • base_dd_max:0.00
 
pet - imp 50393 / 50393
Firebolt 50393 3.7% 108.6 2.77sec 139328 114313 Direct 107.8 121343 242589 140400 15.7%  

Stats details: firebolt

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 108.64 107.81 0.00 0.00 1.2188 0.0000 15135890.80 15135890.80 0.00 114313.37 114313.37
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 90.86 84.28% 121343.46 75195 163768 121432.47 117097 126004 11025683 11025683 0.00
crit 16.94 15.72% 242588.84 150390 327537 242722.30 216320 300020 4110208 4110208 0.00
 
 

Action details: firebolt

Static Values
  • id:3110
  • school:fire
  • resource:energy
  • range:40.0
  • travel_speed:16.0000
  • trigger_gcd:0.5000
  • min_gcd:0.7500
  • base_cost:40.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:1.75
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:3110
  • name:Firebolt
  • school:fire
  • tooltip:
  • description:Deals {$s1=1} Fire damage to a target.$?a231795[ Damage increased by {$231795s1=50}% if you have Immolated the target.][] |cFF777777(Right-Click to toggle)|r
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:1.000000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
pet - service_imp 150931 / 48289
Firebolt 150931 3.5% 49.2 5.52sec 293717 257070 Direct 48.9 255563 511357 295465 15.6%  

Stats details: firebolt

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 49.22 48.92 0.00 0.00 1.1426 0.0000 14455576.77 14455576.77 0.00 257070.29 257070.29
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 41.29 84.40% 255563.33 150390 327537 256045.98 238997 276179 10553090 10553090 0.00
crit 7.63 15.60% 511356.56 300781 655073 512078.89 0 655073 3902487 3902487 0.00
 
 

Action details: firebolt

Static Values
  • id:3110
  • school:fire
  • resource:energy
  • range:40.0
  • travel_speed:16.0000
  • trigger_gcd:0.5000
  • min_gcd:0.7500
  • base_cost:40.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:1.75
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:3110
  • name:Firebolt
  • school:fire
  • tooltip:
  • description:Deals {$s1=1} Fire damage to a target.$?a231795[ Damage increased by {$231795s1=50}% if you have Immolated the target.][] |cFF777777(Right-Click to toggle)|r
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:1.000000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
pet - infernal 154025 / 13045
Immolation 119952 0.7% 1.0 0.00sec 2998925 0 Periodic 46.5 55793 111592 64541 15.7% 8.1%

Stats details: immolation

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 23.23 46.47 0.0000 1.0486 2998924.97 2998924.97 0.00 123103.52 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 39.2 84.32% 55793.45 41903 57827 55798.96 54315 57378 2185991 2185991 0.00
crit 7.3 15.68% 111591.62 96378 115653 111536.51 0 115653 812934 812934 0.00
 
 

Action details: immolation

Static Values
  • id:19483
  • school:fire
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:!ticking
Spelldata
  • id:19483
  • name:Immolation
  • school:fire
  • tooltip:Burns nearby enemies for {$20153s1=0} fire damage every $t1 seconds.
  • description:Burns nearby enemies for {$20153s1=0} fire damage every $t1 seconds.
 

Action details: immolation_tick

Static Values
  • id:20153
  • school:fire
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:20153
  • name:Immolation
  • school:fire
  • tooltip:
  • description:Deals Fire damage to all enemies near the caster.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.650000
  • base_dd_min:0.00
  • base_dd_max:0.00
 
melee 34073 0.2% 22.0 1.11sec 38681 35073 Direct 22.0 33402 66837 38682 15.8%  

Stats details: melee

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 22.02 22.02 0.00 0.00 1.1029 0.0000 851854.43 1252306.70 31.98 35073.06 35073.06
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 18.54 84.21% 33401.96 25058 34581 33401.91 32522 34581 619436 910630 31.98
crit 3.48 15.79% 66837.47 57634 69161 65301.78 0 69161 232418 341677 31.22
 
 

Action details: melee

Static Values
  • id:0
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Weapon
  • normalized:false
  • weapon_power_mod:0.285714
  • weapon_multiplier:1.00
 
pet - doomguard 126391 / 10696
Doom Bolt 126391 0.8% 10.9 2.20sec 289359 134014 Direct 10.9 250153 499971 289363 15.7%  

Stats details: doom_bolt

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 10.92 10.92 0.00 0.00 2.1593 0.0000 3159908.46 3159908.46 0.00 134013.68 134013.68
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 9.21 84.30% 250152.91 210289 290199 250172.48 237889 290199 2302777 2302777 0.00
crit 1.71 15.70% 499971.24 420578 580397 420931.26 0 580397 857132 857132 0.00
 
 

Action details: doom_bolt

Static Values
  • id:85692
  • school:shadow
  • resource:energy
  • range:30.0
  • travel_speed:20.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:35.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:3.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:85692
  • name:Doom Bolt
  • school:shadow
  • tooltip:
  • description:Sends a shadowy bolt at the enemy, causing {$s1=1} Shadow damage. Deals {$s2=20}% additional damage to targets below 20% health.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:2.750000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
pet - lord_of_flames_infernal 153991 / 13042
Immolation 119982 0.7% 1.0 0.00sec 2999666 0 Periodic 46.5 55794 111583 64557 15.7% 8.1%

Stats details: immolation

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 23.23 46.47 0.0000 1.0486 2999665.89 2999665.89 0.00 123133.94 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 39.2 84.29% 55794.24 41903 57827 55799.00 54440 57170 2185250 2185250 0.00
crit 7.3 15.71% 111583.07 83807 115653 111553.92 0 115653 814416 814416 0.00
 
 

Action details: immolation

Static Values
  • id:19483
  • school:fire
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:!ticking
Spelldata
  • id:19483
  • name:Immolation
  • school:fire
  • tooltip:Burns nearby enemies for {$20153s1=0} fire damage every $t1 seconds.
  • description:Burns nearby enemies for {$20153s1=0} fire damage every $t1 seconds.
 

Action details: immolation_tick

Static Values
  • id:20153
  • school:fire
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:20153
  • name:Immolation
  • school:fire
  • tooltip:
  • description:Deals Fire damage to all enemies near the caster.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.650000
  • base_dd_min:0.00
  • base_dd_max:0.00
 
melee 34009 0.2% 22.0 1.11sec 38609 35008 Direct 22.0 33403 66827 38609 15.6%  

Stats details: melee

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 22.02 22.02 0.00 0.00 1.1029 0.0000 850262.99 1249967.13 31.98 35007.53 35007.53
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 18.59 84.42% 33402.96 25058 34581 33402.82 32364 34581 621028 912969 31.98
crit 3.43 15.58% 66827.07 57634 69161 65253.95 0 69161 229235 336998 31.23
 
 

Action details: melee

Static Values
  • id:0
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Weapon
  • normalized:false
  • weapon_power_mod:0.285714
  • weapon_multiplier:1.00
 
pet - lord_of_flames_infernal 153924 / 13036
Immolation 119896 0.7% 1.0 0.00sec 2997532 0 Periodic 46.5 55792 111606 64512 15.6% 8.1%

Stats details: immolation

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 23.23 46.47 0.0000 1.0486 2997531.88 2997531.88 0.00 123046.34 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 39.2 84.38% 55792.13 41903 57827 55796.79 54180 57205 2187384 2187384 0.00
crit 7.3 15.62% 111605.81 83807 115653 111580.71 0 115653 810148 810148 0.00
 
 

Action details: immolation

Static Values
  • id:19483
  • school:fire
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:!ticking
Spelldata
  • id:19483
  • name:Immolation
  • school:fire
  • tooltip:Burns nearby enemies for {$20153s1=0} fire damage every $t1 seconds.
  • description:Burns nearby enemies for {$20153s1=0} fire damage every $t1 seconds.
 

Action details: immolation_tick

Static Values
  • id:20153
  • school:fire
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:20153
  • name:Immolation
  • school:fire
  • tooltip:
  • description:Deals Fire damage to all enemies near the caster.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.650000
  • base_dd_min:0.00
  • base_dd_max:0.00
 
melee 34028 0.2% 22.0 1.11sec 38630 35027 Direct 22.0 33405 66805 38631 15.6%  

Stats details: melee

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 22.02 22.02 0.00 0.00 1.1029 0.0000 850731.80 1250656.33 31.98 35026.84 35026.84
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 18.58 84.35% 33404.96 25058 34581 33405.30 32522 34581 620559 912280 31.98
crit 3.45 15.65% 66805.45 50117 69161 65180.45 0 69161 230173 338376 31.20
 
 

Action details: melee

Static Values
  • id:0
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Weapon
  • normalized:false
  • weapon_power_mod:0.285714
  • weapon_multiplier:1.00
 
pet - lord_of_flames_infernal 153946 / 13039
Immolation 119936 0.7% 1.0 0.00sec 2998513 0 Periodic 46.5 55795 111577 64533 15.7% 8.1%

Stats details: immolation

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 23.23 46.47 0.0000 1.0486 2998513.39 2998513.39 0.00 123086.63 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 39.2 84.34% 55794.84 41903 57827 55799.11 54367 57184 2186403 2186403 0.00
crit 7.3 15.66% 111576.58 96378 115653 111563.66 0 115653 812111 812111 0.00
 
 

Action details: immolation

Static Values
  • id:19483
  • school:fire
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:!ticking
Spelldata
  • id:19483
  • name:Immolation
  • school:fire
  • tooltip:Burns nearby enemies for {$20153s1=0} fire damage every $t1 seconds.
  • description:Burns nearby enemies for {$20153s1=0} fire damage every $t1 seconds.
 

Action details: immolation_tick

Static Values
  • id:20153
  • school:fire
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:20153
  • name:Immolation
  • school:fire
  • tooltip:
  • description:Deals Fire damage to all enemies near the caster.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.650000
  • base_dd_min:0.00
  • base_dd_max:0.00
 
melee 34011 0.2% 22.0 1.11sec 38611 35009 Direct 22.0 33406 66796 38611 15.6%  

Stats details: melee

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 22.02 22.02 0.00 0.00 1.1029 0.0000 850301.03 1250023.06 31.98 35009.10 35009.10
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 18.59 84.41% 33405.87 25058 34581 33405.87 32364 34581 620990 912914 31.98
crit 3.43 15.59% 66795.61 57634 69161 65303.01 0 69161 229311 337110 31.26
 
 

Action details: melee

Static Values
  • id:0
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Weapon
  • normalized:false
  • weapon_power_mod:0.285714
  • weapon_multiplier:1.00
 
pet - shadowy_tear 142977 / 19132
Shadow Bolt 142977 1.4% 3.3 70.39sec 1720960 0 Periodic 36.6 135075 270044 156271 15.7% 15.0%

Stats details: shadow_bolt

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 3.32 0.00 36.78 36.57 0.0000 1.2284 5714470.70 5714470.70 0.00 126476.71 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 30.8 84.30% 135075.40 83 177930 134073.82 0 177930 4163910 4163910 0.00
crit 5.7 15.70% 270043.58 269 355860 261632.92 0 355860 1550561 1550561 0.00
 
 

Action details: shadow_bolt

Static Values
  • id:196657
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:20.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:196657
  • name:Shadow Bolt
  • school:shadow
  • tooltip:
  • description:Sends a shadowy bolt at the enemy, causing {$s1=1} Shadow damage.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • dot_duration:14.00
  • base_tick_time:2.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
 
pet - flame_rift 296157 / 82843
Searing Bolt 296157 6.0% 66.1 2.61sec 375096 1147694 Direct 65.8 68825 0 68825 0.0%  
Periodic 140.4 124911 250045 144499 15.7% 46.2%

Stats details: searing_bolt

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 66.15 65.76 140.39 140.39 0.3268 0.9895 24812001.05 24812001.05 0.00 154555.31 1147694.21
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 65.76 100.00% 68824.55 61274 88966 68918.36 0 88966 4525775 4525775 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 118.4 84.35% 124910.66 123 177962 124478.41 0 153410 14791131 14791131 0.00
crit 22.0 15.65% 250045.13 245 355924 248923.33 0 355924 5495094 5495094 0.00
 
 

Action details: searing_bolt

Static Values
  • id:243050
  • school:fire
  • resource:energy
  • range:100.0
  • travel_speed:20.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:1.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:243050
  • name:Searing Bolt
  • school:fire
  • tooltip:Burning for $w2 Fire damage every $t2 sec.
  • description:Sends a searing bolt at the enemy, causing {$s1=1} Fire damage, and an additional $o2 Fire damage over {$d=30 seconds}, stacking up to {$u=20} times.
Direct Damage
  • may_crit:false
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:1.000000
  • base_dd_min:1.00
  • base_dd_max:1.00
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.100000
  • base_td:1.00
  • dot_duration:30.00
  • base_tick_time:1.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
 
pet - chaos_tear 164469 / 8775
Chaos Bolt 164469 0.6% 3.3 69.84sec 791272 398795 Direct 3.3 0 796377 796377 100.0%  

Stats details: chaos_bolt

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 3.32 3.30 0.00 0.00 1.9844 0.0000 2629654.87 2629654.87 0.00 398795.10 398795.10
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
crit 3.30 100.00% 796377.24 708788 1029119 795741.45 0 1029119 2629655 2629655 0.00
 
 

Action details: chaos_bolt

Static Values
  • id:215279
  • school:chromatic
  • resource:none
  • range:100.0
  • travel_speed:16.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:5.500
  • base_execute_time:3.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:215279
  • name:Chaos Bolt
  • school:chromatic
  • tooltip:
  • description:Unleashes a devastating blast of chaos, causing {$s1=1} Chaos damage. Chaos Bolt always critically strikes and your critical strike chance increases its damage.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:5.000000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
pet - chaos_portal 298387 / 17298
Chaos Barrage 298387 1.2% 3.3 70.22sec 1549828 0 Periodic 116.7 38318 76641 44292 15.6% 6.0%

Stats details: chaos_barrage

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 3.34 0.00 117.23 116.73 0.0000 0.1547 5170506.28 5170506.28 0.00 285049.14 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 98.5 84.41% 38318.02 148 48932 38069.22 0 48932 3775840 3775840 0.00
crit 18.2 15.59% 76640.55 311 97864 76113.93 0 97864 1394667 1394667 0.00
 
 

Action details: chaos_barrage

Static Values
  • id:187394
  • school:magic
  • resource:none
  • range:100.0
  • travel_speed:24.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:187394
  • name:Chaos Barrage
  • school:magic
  • tooltip:
  • description:Deals {$s1=1} Chaos damage.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • dot_duration:5.50
  • base_tick_time:0.25
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
 
Simple Action Stats Execute Interval
Spite
augmentation 1.0 0.00sec

Stats details: augmentation

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: augmentation

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Spite
  • harmful:false
  • if_expr:
 
Berserking 2.1 180.63sec

Stats details: berserking

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.06 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: berserking

Static Values
  • id:26297
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:180.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:26297
  • name:Berserking
  • school:physical
  • tooltip:Haste increased by {$s1=15}%.
  • description:Increases your haste by {$s1=15}% for {$d=10 seconds}.
 
Dimensional Rift 13.0 23.59sec

Stats details: dimensional_rift

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 12.95 0.00 0.00 0.00 1.0108 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: dimensional_rift

Static Values
  • id:196586
  • school:none
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:45.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:charges=3
Spelldata
  • id:196586
  • name:Dimensional Rift
  • school:chaos
  • tooltip:
  • description:Rips a hole in time and space, opening a portal that damages your target.
 
flask 1.0 0.00sec

Stats details: flask

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: flask

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Spite
  • harmful:false
  • if_expr:
 
food 1.0 0.00sec

Stats details: food

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: food

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Spite
  • harmful:false
  • if_expr:
 
Havoc 14.9 20.93sec

Stats details: havoc

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 14.89 0.00 0.00 0.00 1.0693 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: havoc

Static Values
  • id:80240
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:88000.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:active_enemies>1&(active_enemies<4|talent.wreak_havoc.enabled&active_enemies<6)&!debuff.havoc.remains
Spelldata
  • id:80240
  • name:Havoc
  • school:shadow
  • tooltip:Spells cast by the Warlock also hit this target.
  • description:Marks a target with Havoc for {$d=8 seconds}, causing your single target spells to also strike the Havoc victim. Limit 1.
 
Life Tap 6.6 33.74sec

Stats details: life_tap

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 6.64 0.00 0.00 0.00 1.0439 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: life_tap

Static Values
  • id:1454
  • school:shadow
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:talent.empowered_life_tap.enabled&!buff.empowered_life_tap.remains
Spelldata
  • id:1454
  • name:Life Tap
  • school:shadow
  • tooltip:
  • description:Restores {$s1=30}% of your maximum mana, at the cost of {$s2=10}% of your maximum health.
 
potion 2.0 0.00sec

Stats details: potion

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: potion

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:60.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
 
Grimoire: Imp (service_imp) 3.7 91.35sec

Stats details: service_imp

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 3.69 0.00 0.00 0.00 0.9721 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: service_imp

Static Values
  • id:111859
  • school:shadow
  • resource:soul_shard
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:1.0
  • secondary_cost:0.0
  • cooldown:90.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:111859
  • name:Grimoire: Imp
  • school:shadow
  • tooltip:
  • description:Summons an Imp who attacks the target for {$108501s1=25} sec. Imps cast ranged Firebolts and cleanse a hostile magic effect from their master.
 
Soul Harvest 2.9 120.91sec

Stats details: soul_harvest

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.90 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: soul_harvest

Static Values
  • id:196098
  • school:shadow
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:120.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:196098
  • name:Soul Harvest
  • school:shadow
  • tooltip:Damage increased by {$s1=20}%.
  • description:Increases your damage and your pets' damage by {$s1=20}%. Lasts {$d=15 seconds}, increased by {$s2=2} sec for each target afflicted by your {$?s137043=false}[Agony][]{$?s137044=false}[Doom][]{$?s137046=false}[Immolate][], up to a maximum of {$s3=35} sec.
 
Summon Doomguard 1.0 0.00sec

Stats details: summon_doomguard

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 1.0820 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: summon_doomguard

Static Values
  • id:18540
  • school:shadow
  • resource:soul_shard
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:1.0
  • secondary_cost:0.0
  • cooldown:180.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:talent.grimoire_of_supremacy.enabled&active_enemies=1&artifact.lord_of_flames.rank=0
Spelldata
  • id:18540
  • name:Summon Doomguard
  • school:shadow
  • tooltip:
  • description:Summons a Doomguard for {$60478d=25 seconds} to assault the target with its Doom Bolts.
 
Summon Imp 1.0 0.00sec

Stats details: summon_imp

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: summon_imp

Static Values
  • id:688
  • school:shadow
  • resource:soul_shard
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:1.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:2.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:!talent.grimoire_of_supremacy.enabled&(!talent.grimoire_of_sacrifice.enabled|buff.demonic_power.down)
Spelldata
  • id:688
  • name:Summon Imp
  • school:shadow
  • tooltip:
  • description:Summons an Imp under your command that casts ranged Firebolts.$?s74434[ |cFFFFFFFFSoulburn:|r |cFF8282FFInstant cast.|r][]
 
Summon Infernal 1.0 0.00sec

Stats details: summon_infernal

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.7584 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: summon_infernal

Static Values
  • id:1122
  • school:shadow
  • resource:soul_shard
  • range:30.0
  • travel_speed:1.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:1.0
  • secondary_cost:0.0
  • cooldown:180.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:talent.grimoire_of_supremacy.enabled&artifact.lord_of_flames.rank>0
Spelldata
  • id:1122
  • name:Summon Infernal
  • school:shadow
  • tooltip:
  • description:Summons an Infernal from the Twisting Nether, impacting for {$22703s1=0} Fire damage and stunning all enemy targets in the area for {$22703d=2 seconds}. The Infernal will serve you for {$111685d=25 seconds}, dealing strong area-of-effect damage.
 

Buffs

Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit Overflow Expiry
Accelerando 20.1 0.0 15.4sec 15.4sec 78.45% 78.45% 1.5(1.5) 19.3

Buff details

  • buff initial source:Spite
  • cooldown name:buff_accelerando
  • max_stacks:5
  • duration:12.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00

Stat Buff details

  • stat:haste_rating
  • amount:734.41

Stack Uptimes

  • accelerando_1:29.70%
  • accelerando_2:24.51%
  • accelerando_3:14.62%
  • accelerando_4:6.59%
  • accelerando_5:3.02%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:225719
  • name:Accelerando
  • tooltip:Haste increased by $w1.
  • description:{$@spelldesc225125=Your damaging spells have a chance to grant you {$225719s1=528} Haste for {$225719d=12 seconds}, stacking up to 5 times. Stacking does not refresh duration.}
  • max_stacks:5
  • duration:12.00
  • cooldown:0.00
  • default_chance:101.00%
Berserking 2.1 0.0 180.6sec 180.6sec 6.86% 8.54% 0.0(0.0) 2.0

Buff details

  • buff initial source:Spite
  • cooldown name:buff_berserking
  • max_stacks:1
  • duration:10.00
  • cooldown:180.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • berserking_1:6.86%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:26297
  • name:Berserking
  • tooltip:Haste increased by {$s1=15}%.
  • description:Increases your haste by {$s1=15}% for {$d=10 seconds}.
  • max_stacks:0
  • duration:10.00
  • cooldown:180.00
  • default_chance:0.00%
Bloodlust 1.0 0.0 0.0sec 0.0sec 13.55% 13.55% 0.0(0.0) 1.0

Buff details

  • buff initial source:Spite
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • duration:40.00
  • cooldown:300.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • bloodlust_1:13.55%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:2825
  • name:Bloodlust
  • tooltip:Haste increased by {$s1=30}%.
  • description:Increases Haste by {$s1=30}% for all party and raid members for {$d=40 seconds}. Allies receiving this effect will become Sated and unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.
  • max_stacks:0
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
Conflagration of Chaos 24.1 0.0 12.3sec 12.3sec 49.20% 47.00% 0.0(0.0) 0.9

Buff details

  • buff initial source:Spite
  • cooldown name:buff_conflagration_of_chaos
  • max_stacks:1
  • duration:20.00
  • cooldown:0.00
  • default_chance:50.00%
  • default_value:-0.00

Stack Uptimes

  • conflagration_of_chaos_1:49.20%

Trigger Attempt Success

  • trigger_pct:49.96%

Spelldata details

  • id:196546
  • name:Conflagration of Chaos
  • tooltip:Your {$?s17877=false}[Shadowburn][Conflagrate] will always critically strike. Critical strike chance will increase the critical strike damage of {$?s17877=false}[Shadowburn][Conflagrate].
  • description:{$@spelldesc219195={$?s17877=false}[Shadowburn][Conflagrate] has a chance to guarantee your next {$?s17877=false}[Shadowburn][Conflagrate] critically strikes, and to increase its damage by your critical strike chance.}
  • max_stacks:0
  • duration:20.00
  • cooldown:0.00
  • default_chance:100.00%
Devil's Due 3.5 0.0 69.9sec 69.9sec 8.66% 8.66% 0.0(0.0) 3.2

Buff details

  • buff initial source:Spite
  • cooldown name:buff_devils_due
  • max_stacks:1
  • duration:8.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.18

Stack Uptimes

  • devils_due_1:8.66%

Trigger Attempt Success

  • trigger_pct:99.91%

Spelldata details

  • id:225776
  • name:Devil's Due
  • tooltip:Cast speed slowed by {$s1=7}%.
  • description:{$@spelldesc225142=Your damaging spells have a chance to grant Nefarious Pact, increasing your casting speed by {$225774s1=17}% for {$225774d=12 seconds}. When Nefarious Pact expires, your casting speed is decreased by {$225776s1=7}% for {$225776d=8 seconds}.}
  • max_stacks:0
  • duration:8.00
  • cooldown:0.00
  • default_chance:0.00%
Embrace Chaos 33.4 28.4 9.1sec 4.8sec 67.05% 79.84% 28.4(28.4) 32.7

Buff details

  • buff initial source:Spite
  • cooldown name:buff_embrace_chaos
  • max_stacks:1
  • duration:4.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • embrace_chaos_1:67.05%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:212019
  • name:Embrace Chaos
  • tooltip:Chaos Bolt has {$s1=40}% reduced cast time.
  • description:{$@spelldesc212018=Casting Chaos Bolt reduces the cast time of your next Chaos Bolt by {$212019s1=40}% for {$212019d=4 seconds}.}
  • max_stacks:0
  • duration:4.00
  • cooldown:0.00
  • default_chance:0.00%
Lord of Flames 1.0 0.0 0.0sec 0.0sec 97.88% 97.88% 0.0(0.0) 0.0

Buff details

  • buff initial source:Spite
  • cooldown name:buff_lord_of_flames
  • max_stacks:1
  • duration:600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • lord_of_flames_1:97.88%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:226802
  • name:Lord of Flames
  • tooltip:Recently activated Lord of Flames.
  • description:{$@spelldesc224103=Once every {$s2=10} minutes, {$?s152107=false}[your Infernal's Meteor Strike][Summon Infernal] will summon {$s3=3} additional Infernals to serve you for {$226804d=25 seconds}.}
  • max_stacks:0
  • duration:600.00
  • cooldown:0.00
  • default_chance:0.00%
Nefarious Pact 3.5 0.0 70.3sec 69.4sec 13.49% 13.49% 0.0(0.0) 3.3

Buff details

  • buff initial source:Spite
  • cooldown name:buff_nefarious_pact
  • max_stacks:1
  • duration:12.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.44

Stack Uptimes

  • nefarious_pact_1:13.49%

Trigger Attempt Success

  • trigger_pct:99.91%

Spelldata details

  • id:225774
  • name:Nefarious Pact
  • tooltip:Cast speed increased by {$s1=17}%.
  • description:{$@spelldesc225142=Your damaging spells have a chance to grant Nefarious Pact, increasing your casting speed by {$225774s1=17}% for {$225774d=12 seconds}. When Nefarious Pact expires, your casting speed is decreased by {$225776s1=7}% for {$225776d=8 seconds}.}
  • max_stacks:0
  • duration:12.00
  • cooldown:0.00
  • default_chance:0.00%
Potion of Deadly Grace 1.0 0.0 0.0sec 0.0sec 10.16% 10.16% 0.0(0.0) 1.0

Buff details

  • buff initial source:Spite
  • cooldown name:buff_potion_of_deadly_grace
  • max_stacks:1
  • duration:30.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • potion_of_deadly_grace_1:10.16%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:188027
  • name:Potion of Deadly Grace
  • tooltip:Your attacks have a chance to unleash a bolt of energy at your target.
  • description:Grants your attacks a chance to unleash a bolt of energy at your target. Staying away from enemies for the entire duration of the effect will extend the effect by an additional 5 seconds.
  • max_stacks:0
  • duration:25.00
  • cooldown:1.00
  • default_chance:101.00%
Potion of Prolonged Power 1.0 0.0 0.0sec 0.0sec 19.64% 19.64% 0.0(0.0) 1.0

Buff details

  • buff initial source:Spite
  • cooldown name:buff_potion_of_prolonged_power
  • max_stacks:1
  • duration:60.00
  • cooldown:1.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:all
  • amount:2500.00

Stack Uptimes

  • potion_of_prolonged_power_1:19.64%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:229206
  • name:Potion of Prolonged Power
  • tooltip:All stats increased by {$s1=2500}.
  • description:Drink to increase all stats by {$s1=2500} for {$d=60 seconds}.
  • max_stacks:0
  • duration:60.00
  • cooldown:1.00
  • default_chance:0.00%
Sin'dorei Spite 2.0 0.0 230.2sec 230.2sec 16.93% 16.93% 0.0(0.0) 2.0

Buff details

  • buff initial source:Spite
  • cooldown name:buff_sindorei_spite
  • max_stacks:1
  • duration:25.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.15

Stack Uptimes

  • sindorei_spite_1:16.93%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:208871
  • name:Sin'dorei Spite
  • tooltip:You and your minions deal {$s1=15}% increased damage.
  • description:{$@spelldesc208868=For {$208871d=25 seconds} after casting Summon Doomguard or Summon Infernal, you and your minions deal {$208871s1=15}% increased damage.{$?s152107=false}[ This effect can be gained only once every {$242690d=180 seconds}.][]}
  • max_stacks:0
  • duration:25.00
  • cooldown:0.00
  • default_chance:0.00%
Soul Harvest 2.9 0.0 120.9sec 120.9sec 17.79% 17.79% 0.0(0.0) 2.7

Buff details

  • buff initial source:Spite
  • cooldown name:buff_soul_harvest
  • max_stacks:1
  • duration:15.00
  • cooldown:120.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • soul_harvest_1:17.79%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:196098
  • name:Soul Harvest
  • tooltip:Damage increased by {$s1=20}%.
  • description:Increases your damage and your pets' damage by {$s1=20}%. Lasts {$d=15 seconds}, increased by {$s2=2} sec for each target afflicted by your {$?s137043=false}[Agony][]{$?s137044=false}[Doom][]{$?s137046=false}[Immolate][], up to a maximum of {$s3=35} sec.
  • max_stacks:0
  • duration:15.00
  • cooldown:120.00
  • default_chance:0.00%
Constant Buffs
Well Fed (azshari_salad)

Buff details

  • buff initial source:Spite
  • cooldown name:buff_azshari_salad
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:haste_rating
  • amount:375.00

Stack Uptimes

  • azshari_salad_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:225603
  • name:Well Fed
  • tooltip:Haste increased by $w1.
  • description:Increases haste by {$s1=375} for {$d=3600 seconds}.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Defiled Augmentation

Buff details

  • buff initial source:Spite
  • cooldown name:buff_defiled_augmentation
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:agility
  • amount:325.00
  • stat:strength
  • amount:325.00
  • stat:intellect
  • amount:325.00

Stack Uptimes

  • defiled_augmentation_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:224001
  • name:Defiled Augmentation
  • tooltip:Agility, Intellect and Strength increased by $w1.
  • description:Increases Agility, Intellect and Strength by {$s1=325} for {$d=3600 seconds}. Augment Rune.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Flask of the Whispered Pact

Buff details

  • buff initial source:Spite
  • cooldown name:buff_flask_of_the_whispered_pact
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:intellect
  • amount:1300.00

Stack Uptimes

  • flask_of_the_whispered_pact_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:188031
  • name:Flask of the Whispered Pact
  • tooltip:Intellect increased by $w1.
  • description:Increases Intellect by {$s1=1300} for {$d=3600 seconds}. Counts as both a Battle and Guardian elixir. This effect persists through death.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:101.00%
Tormented Souls

Buff details

  • buff initial source:Spite
  • cooldown name:buff_tormented_souls
  • max_stacks:12
  • duration:0.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00

Stack Uptimes

  • tormented_souls_2:0.37%
  • tormented_souls_3:99.63%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:216695
  • name:Tormented Souls
  • tooltip:Activate Reap Souls to consume all Tormented Souls collected by |cFFFFCC99Ulthalesh|r, increasing your damage by 10% and doubling the effect of all of |cFFFFCC99Ulthalesh|r's other traits for {$216708d=5 seconds} per soul consumed.
  • description:Activate Reap Souls to consume all Tormented Souls collected by |cFFFFCC99Ulthalesh|r, increasing your damage by 10% and doubling the effect of all of |cFFFFCC99Ulthalesh|r's other traits for {$216708d=5 seconds} per soul consumed.
  • max_stacks:12
  • duration:-0.00
  • cooldown:0.00
  • default_chance:101.00%

Procs

Count Interval
shadowy_tear 3.2 70.9sec
flame_rift 3.2 70.8sec
chaos_tear 3.3 70.3sec
chaos_portal 3.2 70.4sec
dimension_ripper 3.8 55.9sec
t19_2pc_chaos_bolt 43.1 6.7sec

Resources

Resource Usage Type Count Total Average RPE APR
Spite
chaos_bolt Soul Shard 61.8 123.5 2.0 2.0 982302.1
havoc Mana 14.9 1309953.4 88000.0 88000.3 0.0
immolate Mana 20.0 1318654.0 66000.0 65999.7 71.2
incinerate Mana 75.4 4973357.0 66000.0 66000.1 9.1
service_imp Soul Shard 3.7 3.7 1.0 1.0 0.0
summon_doomguard Soul Shard 1.0 1.0 1.0 1.0 0.0
summon_infernal Soul Shard 1.0 1.0 1.0 1.0 0.0
pet - imp
firebolt Energy 108.6 4345.4 40.0 40.0 3483.2
pet - service_imp
firebolt Energy 49.2 1968.7 40.0 40.0 7342.7
pet - doomguard
doom_bolt Energy 10.9 382.2 35.0 35.0 8267.4
pet - flame_rift
searing_bolt Energy 64.3 64.3 1.0 1.0 386127.2
Resource Gains Type Count Total Average Overflow
life_tap Mana 6.64 2190443.87 (32.51%) 330000.00 0.00 0.00%
immolate Soul Shard 72.13 71.03 (55.28%) 0.98 1.09 1.52%
conflagrate Soul Shard 48.33 48.23 (37.53%) 1.00 0.10 0.21%
mp5_regen Mana 519.93 4546377.63 (67.49%) 8744.22 76315.83 1.65%
soulsnatcher Soul Shard 9.24 9.24 (7.19%) 1.00 0.00 0.00%
pet - imp
energy_regen Energy 1900.13 4179.20 (100.00%) 2.20 21.60 0.51%
pet - service_imp
energy_regen Energy 444.07 1347.26 (100.00%) 3.03 62.00 4.40%
pet - doomguard
energy_regen Energy 15.69 341.26 (100.00%) 21.75 42.88 11.16%
Resource RPS-Gain RPS-Loss
Health 0.00 7239.51
Mana 22380.88 25254.98
Soul Shard 0.43 0.43
Combat End Resource Mean Min Max
Mana 236504.33 11365.96 493841.91
Soul Shard 2.28 0.00 5.00

Benefits & Uptimes

Benefits %
Uptimes %
Mana Cap 1.2%

Statistics & Data Analysis

Fight Length
Sample Data Spite Fight Length
Count 9999
Mean 301.01
Minimum 217.68
Maximum 385.07
Spread ( max - min ) 167.39
Range [ ( max - min ) / 2 * 100% ] 27.80%
DPS
Sample Data Spite Damage Per Second
Count 9999
Mean 1379147.11
Minimum 1174199.68
Maximum 1683614.78
Spread ( max - min ) 509415.10
Range [ ( max - min ) / 2 * 100% ] 18.47%
Standard Deviation 62921.4324
5th Percentile 1282051.42
95th Percentile 1487255.44
( 95th Percentile - 5th Percentile ) 205204.02
Mean Distribution
Standard Deviation 629.2458
95.00% Confidence Intervall ( 1377913.81 - 1380380.41 )
Normalized 95.00% Confidence Intervall ( 99.91% - 100.09% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 80
0.1% Error 7996
0.1 Scale Factor Error with Delta=300 33797212
0.05 Scale Factor Error with Delta=300 135188847
0.01 Scale Factor Error with Delta=300 3379721153
Priority Target DPS
Sample Data Spite Priority Target Damage Per Second
Count 9999
Mean 827967.79
Minimum 686265.44
Maximum 1044284.32
Spread ( max - min ) 358018.89
Range [ ( max - min ) / 2 * 100% ] 21.62%
Standard Deviation 47167.6206
5th Percentile 755535.18
95th Percentile 910100.08
( 95th Percentile - 5th Percentile ) 154564.90
Mean Distribution
Standard Deviation 471.6998
95.00% Confidence Intervall ( 827043.28 - 828892.31 )
Normalized 95.00% Confidence Intervall ( 99.89% - 100.11% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 125
0.1% Error 12467
0.1 Scale Factor Error with Delta=300 18992040
0.05 Scale Factor Error with Delta=300 75968159
0.01 Scale Factor Error with Delta=300 1899203958
DPS(e)
Sample Data Spite Damage Per Second (Effective)
Count 9999
Mean 1379147.11
Minimum 1174199.68
Maximum 1683614.78
Spread ( max - min ) 509415.10
Range [ ( max - min ) / 2 * 100% ] 18.47%
Damage
Sample Data Spite Damage
Count 9999
Mean 328352810.29
Minimum 232136005.99
Maximum 432483068.76
Spread ( max - min ) 200347062.78
Range [ ( max - min ) / 2 * 100% ] 30.51%
DTPS
Sample Data Spite Damage Taken Per Second
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HPS
Sample Data Spite Healing Per Second
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
HPS(e)
Sample Data Spite Healing Per Second (Effective)
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
Sample Data Spite Heal
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
Sample Data Spite Healing Taken Per Second
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
TMI
Sample Data Spite Theck-Meloree Index
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
ETMI
Sample Data SpiteTheck-Meloree Index (Effective)
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
MSD
Sample Data Spite Max Spike Value
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 flask,type=whispered_pact
1 0.00 food,type=azshari_salad
2 0.00 summon_pet,if=!talent.grimoire_of_supremacy.enabled&(!talent.grimoire_of_sacrifice.enabled|buff.demonic_power.down)
3 0.00 summon_infernal,if=talent.grimoire_of_supremacy.enabled&artifact.lord_of_flames.rank>0
4 0.00 summon_infernal,if=talent.grimoire_of_supremacy.enabled&active_enemies>1
5 0.00 summon_doomguard,if=talent.grimoire_of_supremacy.enabled&active_enemies=1&artifact.lord_of_flames.rank=0
6 0.00 augmentation,type=defiled
7 0.00 snapshot_stats
8 0.00 grimoire_of_sacrifice,if=talent.grimoire_of_sacrifice.enabled
9 0.00 life_tap,if=talent.empowered_life_tap.enabled&!buff.empowered_life_tap.remains
A 0.00 potion,name=prolonged_power
B 0.00 chaos_bolt
Default action list Executed every time the actor is available.
# count action,conditions
C 14.89 havoc,target=2,if=active_enemies>1&(active_enemies<4|talent.wreak_havoc.enabled&active_enemies<6)&!debuff.havoc.remains
D 1.00 dimensional_rift,if=charges=3
E 10.33 immolate,if=remains<=tick_time
F 0.66 immolate,cycle_targets=1,if=active_enemies>1&remains<=tick_time&(!talent.roaring_blaze.enabled|(!debuff.roaring_blaze.remains&action.conflagrate.charges<2+set_bonus.tier19_4pc))
G 9.03 immolate,if=talent.roaring_blaze.enabled&remains<=duration&!debuff.roaring_blaze.remains&target.time_to_die>10&(action.conflagrate.charges=2+set_bonus.tier19_4pc|(action.conflagrate.charges>=1+set_bonus.tier19_4pc&action.conflagrate.recharge_time<cast_time+gcd)|target.time_to_die<24)
H 2.06 berserking
0.00 blood_fury
0.00 arcane_torrent
I 1.00 potion,name=deadly_grace,if=(buff.soul_harvest.remains|trinket.proc.any.react|target.time_to_die<=45)
0.00 shadowburn,if=buff.conflagration_of_chaos.remains<=action.chaos_bolt.cast_time
0.00 shadowburn,if=(charges=1+set_bonus.tier19_4pc&recharge_time<action.chaos_bolt.cast_time|charges=2+set_bonus.tier19_4pc)&soul_shard<5
J 13.98 conflagrate,if=talent.roaring_blaze.enabled&(charges=2+set_bonus.tier19_4pc|(charges>=1+set_bonus.tier19_4pc&recharge_time<gcd)|target.time_to_die<24)
K 34.35 conflagrate,if=talent.roaring_blaze.enabled&debuff.roaring_blaze.stack>0&dot.immolate.remains>dot.immolate.duration*0.3&(active_enemies=1|soul_shard<3)&soul_shard<5
0.00 conflagrate,if=!talent.roaring_blaze.enabled&buff.backdraft.stack<3&buff.conflagration_of_chaos.remains<=action.chaos_bolt.cast_time
0.00 conflagrate,if=!talent.roaring_blaze.enabled&buff.backdraft.stack<3&(charges=1+set_bonus.tier19_4pc&recharge_time<action.chaos_bolt.cast_time|charges=2+set_bonus.tier19_4pc)&soul_shard<5
0.00 life_tap,if=talent.empowered_life_tap.enabled&buff.empowered_life_tap.remains<=gcd
0.00 dimensional_rift,if=equipped.144369&!buff.lessons_of_spacetime.remains&((!talent.grimoire_of_supremacy.enabled&!cooldown.summon_doomguard.remains)|(talent.grimoire_of_service.enabled&!cooldown.service_pet.remains)|(talent.soul_harvest.enabled&!cooldown.soul_harvest.remains))
L 3.69 service_pet
M 1.00 summon_infernal,if=artifact.lord_of_flames.rank>0&!buff.lord_of_flames.remains
N 1.00 summon_doomguard,if=!talent.grimoire_of_supremacy.enabled&spell_targets.infernal_awakening<=2&(target.time_to_die>180|target.health.pct<=20|target.time_to_die<30)
0.00 summon_infernal,if=!talent.grimoire_of_supremacy.enabled&spell_targets.infernal_awakening>2
0.00 summon_doomguard,if=talent.grimoire_of_supremacy.enabled&spell_targets.summon_infernal=1&artifact.lord_of_flames.rank>0&buff.lord_of_flames.remains&!pet.doomguard.active
0.00 summon_doomguard,if=talent.grimoire_of_supremacy.enabled&spell_targets.summon_infernal=1&equipped.132379&!cooldown.sindorei_spite_icd.remains
0.00 summon_infernal,if=talent.grimoire_of_supremacy.enabled&spell_targets.summon_infernal>1&equipped.132379&!cooldown.sindorei_spite_icd.remains
O 2.90 soul_harvest
0.00 channel_demonfire,if=dot.immolate.remains>cast_time
0.00 havoc,if=active_enemies=1&talent.wreak_havoc.enabled&equipped.132375&!debuff.havoc.remains
0.00 rain_of_fire,if=active_enemies>=3&cooldown.havoc.remains<=12&!talent.wreak_havoc.enabled
0.00 rain_of_fire,if=active_enemies>=6&talent.wreak_havoc.enabled
P 11.95 dimensional_rift,if=!equipped.144369|charges>1|((!talent.grimoire_of_service.enabled|recharge_time<cooldown.service_pet.remains)&(!talent.soul_harvest.enabled|recharge_time<cooldown.soul_harvest.remains)&(!talent.grimoire_of_supremacy.enabled|recharge_time<cooldown.summon_doomguard.remains))
0.00 life_tap,if=talent.empowered_life_tap.enabled&buff.empowered_life_tap.remains<duration*0.3
0.00 cataclysm
Q 61.08 chaos_bolt,if=(cooldown.havoc.remains>12&cooldown.havoc.remains|active_enemies<3|talent.wreak_havoc.enabled&active_enemies<6)&(set_bonus.tier19_4pc=0|!talent.eradication.enabled|buff.embrace_chaos.remains<=cast_time|soul_shard>=3)
0.00 shadowburn
0.00 conflagrate,if=!talent.roaring_blaze.enabled&buff.backdraft.stack<3
0.00 immolate,if=!talent.roaring_blaze.enabled&remains<=duration*0.3
R 75.68 incinerate
S 6.64 life_tap

Sample Sequence

0126ABCDEGHJKLMOPPQKKQQKRRQRKRCQRRRQERRRRGJQKKQRKRCQRKQPQRRQRERQRRCGJKPQKQKRQRRKQCRSERQPRRRGJKKLQCKQRRQKRRQRSERPRCROIRRGJKPQKPQKRRSQRQCKQRREQRRRRQGJKQCKSFKQQRKPQHRRPQERCLRRRGJQQKQKKQRRKCQQRQSERRRPQGJKCNQKQKRQRKROQRPECFSRRRQGJQKQJPJQCQRJQRRLREJQRJQR

Sample Sequence Table

time list # name target resources buffs
Pre precombat 0 flask Spite 1100000.0/1100000: 100% mana | 3.0/5: 60% soul_shard
Pre precombat 1 food Spite 1100000.0/1100000: 100% mana | 3.0/5: 60% soul_shard
Pre precombat 2 summon_imp Fluffy_Pillow 1100000.0/1100000: 100% mana | 3.0/5: 60% soul_shard
Pre precombat 6 augmentation Spite 1100000.0/1100000: 100% mana | 3.0/5: 60% soul_shard
Pre precombat A potion Fluffy_Pillow 1100000.0/1100000: 100% mana | 3.0/5: 60% soul_shard potion_of_prolonged_power
0:00.000 precombat B chaos_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 1.0/5: 20% soul_shard embrace_chaos, accelerando, potion_of_prolonged_power
0:00.000 default C havoc enemy2 1100000.0/1100000: 100% mana | 1.0/5: 20% soul_shard embrace_chaos, accelerando, potion_of_prolonged_power
0:01.145 default D dimensional_rift Fluffy_Pillow 1033522.6/1100000: 94% mana | 1.0/5: 20% soul_shard bloodlust, embrace_chaos, accelerando, potion_of_prolonged_power
0:02.027 default E immolate Fluffy_Pillow 1050101.6/1100000: 95% mana | 1.0/5: 20% soul_shard bloodlust, embrace_chaos, accelerando, potion_of_prolonged_power
0:02.908 default G immolate Fluffy_Pillow 1000661.9/1100000: 91% mana | 1.0/5: 20% soul_shard bloodlust, embrace_chaos, accelerando, potion_of_prolonged_power
0:03.790 default H berserking Fluffy_Pillow 951240.9/1100000: 86% mana | 1.0/5: 20% soul_shard bloodlust, embrace_chaos, accelerando, potion_of_prolonged_power
0:03.790 default J conflagrate Fluffy_Pillow 951240.9/1100000: 86% mana | 1.0/5: 20% soul_shard bloodlust, berserking, embrace_chaos, accelerando, potion_of_prolonged_power
0:04.557 default K conflagrate Fluffy_Pillow 967820.8/1100000: 88% mana | 2.0/5: 40% soul_shard bloodlust, berserking, accelerando, potion_of_prolonged_power
0:05.324 default L service_imp Fluffy_Pillow 984400.8/1100000: 89% mana | 4.0/5: 80% soul_shard bloodlust, berserking, accelerando, potion_of_prolonged_power
0:06.091 default M summon_infernal Fluffy_Pillow 1000980.7/1100000: 91% mana | 3.0/5: 60% soul_shard bloodlust, berserking, accelerando, potion_of_prolonged_power
0:06.858 default O soul_harvest Fluffy_Pillow 1017560.7/1100000: 93% mana | 3.0/5: 60% soul_shard bloodlust, berserking, lord_of_flames, sindorei_spite, accelerando, potion_of_prolonged_power
0:06.858 default P dimensional_rift Fluffy_Pillow 1017560.7/1100000: 93% mana | 3.0/5: 60% soul_shard bloodlust, berserking, soul_harvest, lord_of_flames, sindorei_spite, accelerando, potion_of_prolonged_power
0:07.625 default P dimensional_rift Fluffy_Pillow 1034140.6/1100000: 94% mana | 3.0/5: 60% soul_shard bloodlust, berserking, soul_harvest, lord_of_flames, sindorei_spite, accelerando, potion_of_prolonged_power
0:08.392 default Q chaos_bolt Fluffy_Pillow 1050967.8/1100000: 96% mana | 3.0/5: 60% soul_shard bloodlust, berserking, soul_harvest, lord_of_flames, sindorei_spite, accelerando(2), potion_of_prolonged_power
0:09.903 default K conflagrate Fluffy_Pillow 1084117.5/1100000: 99% mana | 1.0/5: 20% soul_shard bloodlust, berserking, soul_harvest, lord_of_flames, embrace_chaos, sindorei_spite, accelerando(2), potion_of_prolonged_power
0:10.658 default K conflagrate Fluffy_Pillow 1100000.0/1100000: 100% mana | 2.0/5: 40% soul_shard bloodlust, berserking, soul_harvest, lord_of_flames, embrace_chaos, sindorei_spite, accelerando(2), potion_of_prolonged_power
0:11.414 default Q chaos_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 4.0/5: 80% soul_shard bloodlust, berserking, soul_harvest, lord_of_flames, embrace_chaos, sindorei_spite, accelerando(2), potion_of_prolonged_power
0:12.320 default Q chaos_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 3.0/5: 60% soul_shard bloodlust, berserking, soul_harvest, lord_of_flames, embrace_chaos, sindorei_spite, accelerando, potion_of_prolonged_power
0:13.241 default K conflagrate Fluffy_Pillow 1100000.0/1100000: 100% mana | 1.0/5: 20% soul_shard bloodlust, berserking, soul_harvest, lord_of_flames, embrace_chaos, sindorei_spite, accelerando, potion_of_prolonged_power
0:14.009 default R incinerate Fluffy_Pillow 1100000.0/1100000: 100% mana | 2.0/5: 40% soul_shard bloodlust, soul_harvest, lord_of_flames, conflagration_of_chaos, embrace_chaos, sindorei_spite, accelerando, potion_of_prolonged_power
0:15.114 default R incinerate Fluffy_Pillow 1034094.0/1100000: 94% mana | 2.0/5: 40% soul_shard bloodlust, soul_harvest, lord_of_flames, conflagration_of_chaos, embrace_chaos, sindorei_spite, accelerando, potion_of_prolonged_power
0:16.218 default Q chaos_bolt Fluffy_Pillow 988845.9/1100000: 90% mana | 2.0/5: 40% soul_shard bloodlust, soul_harvest, lord_of_flames, conflagration_of_chaos, embrace_chaos, sindorei_spite, accelerando, potion_of_prolonged_power
0:17.276 default R incinerate Fluffy_Pillow 1008802.2/1100000: 92% mana | 0.0/5: 0% soul_shard bloodlust, soul_harvest, lord_of_flames, conflagration_of_chaos, embrace_chaos, sindorei_spite, accelerando(2), potion_of_prolonged_power
0:18.364 default K conflagrate Fluffy_Pillow 963559.5/1100000: 88% mana | 0.0/5: 0% soul_shard bloodlust, soul_harvest, lord_of_flames, conflagration_of_chaos, embrace_chaos, sindorei_spite, accelerando(3), potion_of_prolonged_power
0:19.223 default R incinerate Fluffy_Pillow 980187.3/1100000: 89% mana | 2.0/5: 40% soul_shard bloodlust, soul_harvest, lord_of_flames, embrace_chaos, sindorei_spite, accelerando(3), potion_of_prolonged_power
0:20.295 default C havoc enemy2 935085.2/1100000: 85% mana | 2.0/5: 40% soul_shard bloodlust, soul_harvest, lord_of_flames, embrace_chaos, sindorei_spite, accelerando(4), potion_of_prolonged_power
0:21.140 default Q chaos_bolt Fluffy_Pillow 863678.9/1100000: 79% mana | 2.0/5: 40% soul_shard bloodlust, soul_harvest, lord_of_flames, embrace_chaos, sindorei_spite, accelerando(4), potion_of_prolonged_power
0:22.152 default R incinerate Fluffy_Pillow 883552.0/1100000: 80% mana | 0.0/5: 0% soul_shard bloodlust, soul_harvest, lord_of_flames, embrace_chaos, sindorei_spite, accelerando(4), potion_of_prolonged_power
0:23.210 default R incinerate Fluffy_Pillow 838328.5/1100000: 76% mana | 1.0/5: 20% soul_shard bloodlust, soul_harvest, lord_of_flames, embrace_chaos, sindorei_spite, accelerando(4), potion_of_prolonged_power
0:24.268 default R incinerate Fluffy_Pillow 793054.6/1100000: 72% mana | 2.0/5: 40% soul_shard bloodlust, soul_harvest, lord_of_flames, embrace_chaos, sindorei_spite, potion_of_prolonged_power
0:25.388 default Q chaos_bolt Fluffy_Pillow 747793.8/1100000: 68% mana | 2.0/5: 40% soul_shard bloodlust, soul_harvest, lord_of_flames, embrace_chaos, sindorei_spite, potion_of_prolonged_power
0:26.461 default E immolate Fluffy_Pillow 767662.8/1100000: 70% mana | 1.0/5: 20% soul_shard bloodlust, lord_of_flames, embrace_chaos, sindorei_spite, potion_of_prolonged_power
0:27.356 default R incinerate Fluffy_Pillow 718235.6/1100000: 65% mana | 1.0/5: 20% soul_shard bloodlust, lord_of_flames, embrace_chaos, sindorei_spite, potion_of_prolonged_power
0:28.477 default R incinerate Fluffy_Pillow 672994.8/1100000: 61% mana | 1.0/5: 20% soul_shard bloodlust, lord_of_flames, embrace_chaos, sindorei_spite, accelerando, potion_of_prolonged_power
0:29.581 default R incinerate Fluffy_Pillow 627746.7/1100000: 57% mana | 1.0/5: 20% soul_shard bloodlust, lord_of_flames, embrace_chaos, sindorei_spite, accelerando, potion_of_prolonged_power
0:30.685 default R incinerate Fluffy_Pillow 582499.8/1100000: 53% mana | 1.0/5: 20% soul_shard bloodlust, lord_of_flames, sindorei_spite, accelerando(2), potion_of_prolonged_power
0:31.773 default G immolate Fluffy_Pillow 537256.0/1100000: 49% mana | 1.0/5: 20% soul_shard bloodlust, lord_of_flames, accelerando(2), potion_of_prolonged_power
0:32.643 default J conflagrate Fluffy_Pillow 487853.2/1100000: 44% mana | 2.0/5: 40% soul_shard bloodlust, lord_of_flames, accelerando(2), potion_of_prolonged_power
0:33.511 default Q chaos_bolt Fluffy_Pillow 504412.4/1100000: 46% mana | 3.0/5: 60% soul_shard bloodlust, lord_of_flames, accelerando(2), potion_of_prolonged_power
0:35.244 default K conflagrate Fluffy_Pillow 537724.5/1100000: 49% mana | 1.0/5: 20% soul_shard bloodlust, lord_of_flames, embrace_chaos, accelerando(3), potion_of_prolonged_power
0:36.101 default K conflagrate Fluffy_Pillow 554313.6/1100000: 50% mana | 2.0/5: 40% soul_shard bloodlust, lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(3), potion_of_prolonged_power
0:36.956 default Q chaos_bolt Fluffy_Pillow 570864.1/1100000: 52% mana | 3.0/5: 60% soul_shard bloodlust, lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(3), potion_of_prolonged_power
0:37.982 default R incinerate Fluffy_Pillow 590725.7/1100000: 54% mana | 1.0/5: 20% soul_shard bloodlust, lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(4), potion_of_prolonged_power
0:39.038 default K conflagrate Fluffy_Pillow 545463.0/1100000: 50% mana | 1.0/5: 20% soul_shard bloodlust, lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(4), potion_of_prolonged_power
0:39.884 default R incinerate Fluffy_Pillow 562076.3/1100000: 51% mana | 2.0/5: 40% soul_shard bloodlust, lord_of_flames, embrace_chaos, accelerando(4), potion_of_prolonged_power
0:40.943 default C havoc enemy2 516344.8/1100000: 47% mana | 2.0/5: 40% soul_shard bloodlust, lord_of_flames, embrace_chaos, potion_of_prolonged_power
0:41.840 default Q chaos_bolt Fluffy_Pillow 441121.6/1100000: 40% mana | 3.0/5: 60% soul_shard lord_of_flames, embrace_chaos, potion_of_prolonged_power
0:43.236 default R incinerate Fluffy_Pillow 461007.7/1100000: 42% mana | 1.0/5: 20% soul_shard lord_of_flames, embrace_chaos, accelerando, potion_of_prolonged_power
0:44.669 default K conflagrate Fluffy_Pillow 415727.8/1100000: 38% mana | 2.0/5: 40% soul_shard lord_of_flames, embrace_chaos, accelerando, potion_of_prolonged_power
0:45.813 default Q chaos_bolt Fluffy_Pillow 432287.4/1100000: 39% mana | 3.0/5: 60% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(2), potion_of_prolonged_power
0:47.168 default P dimensional_rift Fluffy_Pillow 452171.8/1100000: 41% mana | 2.0/5: 40% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(2), potion_of_prolonged_power
0:48.297 default Q chaos_bolt Fluffy_Pillow 468739.8/1100000: 43% mana | 3.0/5: 60% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(2), potion_of_prolonged_power
0:49.648 default R incinerate Fluffy_Pillow 488565.5/1100000: 44% mana | 1.0/5: 20% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(2), potion_of_prolonged_power
0:51.060 default R incinerate Fluffy_Pillow 443286.5/1100000: 40% mana | 2.0/5: 40% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(2), potion_of_prolonged_power
0:52.476 default Q chaos_bolt Fluffy_Pillow 398137.4/1100000: 36% mana | 2.0/5: 40% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(3), potion_of_prolonged_power
0:53.811 default R incinerate Fluffy_Pillow 418015.8/1100000: 38% mana | 0.0/5: 0% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(3), potion_of_prolonged_power
0:55.205 default E immolate Fluffy_Pillow 372772.7/1100000: 34% mana | 1.0/5: 20% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(3), potion_of_prolonged_power
0:56.317 default R incinerate Fluffy_Pillow 322687.8/1100000: 29% mana | 2.0/5: 40% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando, potion_of_prolonged_power
0:57.750 default Q chaos_bolt Fluffy_Pillow 277408.6/1100000: 25% mana | 2.0/5: 40% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(2), potion_of_prolonged_power
0:59.104 default R incinerate Fluffy_Pillow 297387.9/1100000: 27% mana | 1.0/5: 20% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(3)
1:00.496 default R incinerate Fluffy_Pillow 252115.1/1100000: 23% mana | 1.0/5: 20% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(3)
1:01.888 default C havoc enemy2 206842.2/1100000: 19% mana | 1.0/5: 20% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(3)
1:03.001 default G immolate Fluffy_Pillow 135415.0/1100000: 12% mana | 1.0/5: 20% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(3)
1:04.113 default J conflagrate Fluffy_Pillow 86207.0/1100000: 8% mana | 1.0/5: 20% soul_shard lord_of_flames, conflagration_of_chaos, accelerando(4)
1:05.210 default K conflagrate Fluffy_Pillow 102778.1/1100000: 9% mana | 2.0/5: 40% soul_shard lord_of_flames, conflagration_of_chaos, accelerando(4)
1:06.307 default P dimensional_rift Fluffy_Pillow 119349.1/1100000: 11% mana | 4.0/5: 80% soul_shard lord_of_flames, accelerando(4)
1:07.402 default Q chaos_bolt Fluffy_Pillow 136125.7/1100000: 12% mana | 4.0/5: 80% soul_shard lord_of_flames, accelerando(5)
1:09.560 default K conflagrate Fluffy_Pillow 167548.2/1100000: 15% mana | 2.0/5: 40% soul_shard lord_of_flames, embrace_chaos
1:10.722 default Q chaos_bolt Fluffy_Pillow 184099.7/1100000: 17% mana | 3.0/5: 60% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos
1:12.114 default K conflagrate Fluffy_Pillow 203927.3/1100000: 19% mana | 1.0/5: 20% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos
1:13.277 default R incinerate Fluffy_Pillow 220493.0/1100000: 20% mana | 2.0/5: 40% soul_shard lord_of_flames, embrace_chaos
1:14.732 default Q chaos_bolt Fluffy_Pillow 175218.0/1100000: 16% mana | 3.0/5: 60% soul_shard lord_of_flames, embrace_chaos
1:16.127 default R incinerate Fluffy_Pillow 195088.4/1100000: 18% mana | 1.0/5: 20% soul_shard lord_of_flames, embrace_chaos
1:17.582 default R incinerate Fluffy_Pillow 149814.2/1100000: 14% mana | 1.0/5: 20% soul_shard lord_of_flames, embrace_chaos, accelerando
1:19.015 default K conflagrate Fluffy_Pillow 104534.4/1100000: 10% mana | 1.0/5: 20% soul_shard lord_of_flames, embrace_chaos, accelerando
1:20.160 default Q chaos_bolt Fluffy_Pillow 121090.2/1100000: 11% mana | 2.0/5: 40% soul_shard lord_of_flames, accelerando
1:22.445 default C havoc enemy2 154414.1/1100000: 14% mana | 1.0/5: 20% soul_shard lord_of_flames, embrace_chaos, accelerando(2)
1:23.575 default R incinerate Fluffy_Pillow 82996.7/1100000: 8% mana | 1.0/5: 20% soul_shard lord_of_flames, embrace_chaos, accelerando(2)
1:24.988 default S life_tap Fluffy_Pillow 37732.3/1100000: 3% mana | 1.0/5: 20% soul_shard lord_of_flames, embrace_chaos, accelerando(2)
1:26.117 default E immolate Fluffy_Pillow 384300.2/1100000: 35% mana | 1.0/5: 20% soul_shard lord_of_flames, embrace_chaos, accelerando(2)
1:27.247 default R incinerate Fluffy_Pillow 334882.8/1100000: 30% mana | 1.0/5: 20% soul_shard lord_of_flames, accelerando(2)
1:28.660 default Q chaos_bolt Fluffy_Pillow 289618.4/1100000: 26% mana | 2.0/5: 40% soul_shard lord_of_flames, accelerando(2)
1:30.914 default P dimensional_rift Fluffy_Pillow 322369.0/1100000: 29% mana | 0.0/5: 0% soul_shard lord_of_flames, embrace_chaos, accelerando
1:32.291 default R incinerate Fluffy_Pillow 342279.5/1100000: 31% mana | 0.0/5: 0% soul_shard lord_of_flames, embrace_chaos, accelerando
1:33.727 default R incinerate Fluffy_Pillow 297111.8/1100000: 27% mana | 0.0/5: 0% soul_shard lord_of_flames, embrace_chaos, accelerando(2)
1:35.139 default R incinerate Fluffy_Pillow 251832.7/1100000: 23% mana | 0.0/5: 0% soul_shard lord_of_flames, accelerando(2)
1:36.551 default G immolate Fluffy_Pillow 206553.6/1100000: 19% mana | 0.0/5: 0% soul_shard lord_of_flames, accelerando(2)
1:37.681 default J conflagrate Fluffy_Pillow 157137.5/1100000: 14% mana | 0.0/5: 0% soul_shard lord_of_flames, accelerando(3)
1:38.794 default K conflagrate Fluffy_Pillow 173710.3/1100000: 16% mana | 1.0/5: 20% soul_shard lord_of_flames, conflagration_of_chaos, accelerando(3)
1:39.906 default K conflagrate Fluffy_Pillow 190268.2/1100000: 17% mana | 2.0/5: 40% soul_shard lord_of_flames, conflagration_of_chaos, accelerando(3)
1:41.018 default L service_imp Fluffy_Pillow 206826.1/1100000: 19% mana | 3.0/5: 60% soul_shard lord_of_flames, conflagration_of_chaos, accelerando(3)
1:42.130 default Q chaos_bolt Fluffy_Pillow 223142.9/1100000: 20% mana | 3.0/5: 60% soul_shard lord_of_flames, conflagration_of_chaos
1:44.453 default C havoc enemy2 256490.9/1100000: 23% mana | 2.0/5: 40% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando
1:45.598 default K conflagrate Fluffy_Pillow 185053.9/1100000: 17% mana | 2.0/5: 40% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(2)
1:46.726 default Q chaos_bolt Fluffy_Pillow 201607.2/1100000: 18% mana | 3.0/5: 60% soul_shard lord_of_flames, embrace_chaos, accelerando(2)
1:48.080 default R incinerate Fluffy_Pillow 221534.4/1100000: 20% mana | 2.0/5: 40% soul_shard lord_of_flames, embrace_chaos, accelerando(3)
1:49.473 default R incinerate Fluffy_Pillow 176276.5/1100000: 16% mana | 2.0/5: 40% soul_shard lord_of_flames, embrace_chaos, accelerando(3)
1:50.866 default Q chaos_bolt Fluffy_Pillow 131081.5/1100000: 12% mana | 2.0/5: 40% soul_shard lord_of_flames, embrace_chaos, accelerando(4)
1:52.180 default K conflagrate Fluffy_Pillow 150930.5/1100000: 14% mana | 0.0/5: 0% soul_shard lord_of_flames, embrace_chaos, accelerando(4)
1:53.277 default R incinerate Fluffy_Pillow 167501.5/1100000: 15% mana | 2.0/5: 40% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(4)
1:54.650 default R incinerate Fluffy_Pillow 122282.5/1100000: 11% mana | 2.0/5: 40% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(5)
1:56.004 default Q chaos_bolt Fluffy_Pillow 76214.0/1100000: 7% mana | 2.0/5: 40% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos
1:57.398 default R incinerate Fluffy_Pillow 96070.1/1100000: 9% mana | 0.0/5: 0% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos
1:58.854 default S life_tap Fluffy_Pillow 50809.3/1100000: 5% mana | 0.0/5: 0% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos
2:00.016 default E immolate Fluffy_Pillow 397360.8/1100000: 36% mana | 0.0/5: 0% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos
2:01.179 default R incinerate Fluffy_Pillow 347926.6/1100000: 32% mana | 0.0/5: 0% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos
2:02.635 default P dimensional_rift Fluffy_Pillow 302666.9/1100000: 28% mana | 0.0/5: 0% soul_shard lord_of_flames, conflagration_of_chaos, accelerando
2:03.779 default R incinerate Fluffy_Pillow 319208.3/1100000: 29% mana | 0.0/5: 0% soul_shard lord_of_flames, conflagration_of_chaos, accelerando
2:05.213 default C havoc enemy2 273943.7/1100000: 25% mana | 0.0/5: 0% soul_shard lord_of_flames, conflagration_of_chaos, accelerando(2)
2:06.343 default R incinerate Fluffy_Pillow 202526.4/1100000: 18% mana | 0.0/5: 0% soul_shard lord_of_flames, conflagration_of_chaos, accelerando(2)
2:07.756 default O soul_harvest Fluffy_Pillow 157262.0/1100000: 14% mana | 0.0/5: 0% soul_shard lord_of_flames, conflagration_of_chaos, accelerando(2)
2:07.756 default I potion Fluffy_Pillow 157262.0/1100000: 14% mana | 0.0/5: 0% soul_shard soul_harvest, lord_of_flames, conflagration_of_chaos, accelerando(2)
2:07.756 default R incinerate Fluffy_Pillow 157262.0/1100000: 14% mana | 0.0/5: 0% soul_shard soul_harvest, lord_of_flames, conflagration_of_chaos, accelerando(2), potion_of_deadly_grace
2:09.170 default R incinerate Fluffy_Pillow 112012.2/1100000: 10% mana | 1.0/5: 20% soul_shard soul_harvest, lord_of_flames, conflagration_of_chaos, accelerando(2), potion_of_deadly_grace
2:10.584 default G immolate Fluffy_Pillow 66762.5/1100000: 6% mana | 1.0/5: 20% soul_shard soul_harvest, lord_of_flames, conflagration_of_chaos, accelerando(2), potion_of_deadly_grace
2:11.713 default J conflagrate Fluffy_Pillow 17330.5/1100000: 2% mana | 1.0/5: 20% soul_shard soul_harvest, lord_of_flames, conflagration_of_chaos, accelerando(2), potion_of_deadly_grace
2:12.841 default K conflagrate Fluffy_Pillow 33953.7/1100000: 3% mana | 2.0/5: 40% soul_shard soul_harvest, lord_of_flames, accelerando(3), potion_of_deadly_grace
2:13.954 default P dimensional_rift Fluffy_Pillow 50526.5/1100000: 5% mana | 3.0/5: 60% soul_shard soul_harvest, lord_of_flames, accelerando(3), potion_of_deadly_grace
2:15.067 default Q chaos_bolt Fluffy_Pillow 66816.9/1100000: 6% mana | 3.0/5: 60% soul_shard soul_harvest, lord_of_flames, nefarious_pact, potion_of_deadly_grace
2:16.675 default K conflagrate Fluffy_Pillow 89721.2/1100000: 8% mana | 2.0/5: 40% soul_shard soul_harvest, lord_of_flames, embrace_chaos, nefarious_pact, potion_of_deadly_grace
2:17.483 default P dimensional_rift Fluffy_Pillow 101230.3/1100000: 9% mana | 3.0/5: 60% soul_shard soul_harvest, lord_of_flames, embrace_chaos, nefarious_pact, potion_of_deadly_grace
2:18.288 default Q chaos_bolt Fluffy_Pillow 112696.7/1100000: 10% mana | 3.0/5: 60% soul_shard soul_harvest, lord_of_flames, embrace_chaos, nefarious_pact, potion_of_deadly_grace
2:19.255 default K conflagrate Fluffy_Pillow 126470.6/1100000: 11% mana | 1.0/5: 20% soul_shard soul_harvest, lord_of_flames, embrace_chaos, nefarious_pact, potion_of_deadly_grace
2:20.266 default R incinerate Fluffy_Pillow 140871.3/1100000: 13% mana | 2.0/5: 40% soul_shard soul_harvest, lord_of_flames, embrace_chaos, nefarious_pact, potion_of_deadly_grace
2:21.275 default R incinerate Fluffy_Pillow 89269.9/1100000: 8% mana | 2.0/5: 40% soul_shard soul_harvest, lord_of_flames, embrace_chaos, nefarious_pact, accelerando, potion_of_deadly_grace
2:22.270 default S life_tap Fluffy_Pillow 37656.9/1100000: 3% mana | 2.0/5: 40% soul_shard soul_harvest, lord_of_flames, embrace_chaos, nefarious_pact, accelerando, potion_of_deadly_grace
2:23.064 default Q chaos_bolt Fluffy_Pillow 379137.6/1100000: 34% mana | 2.0/5: 40% soul_shard soul_harvest, lord_of_flames, embrace_chaos, nefarious_pact, accelerando, potion_of_deadly_grace
2:24.017 default R incinerate Fluffy_Pillow 392917.3/1100000: 36% mana | 1.0/5: 20% soul_shard soul_harvest, lord_of_flames, embrace_chaos, nefarious_pact, accelerando, potion_of_deadly_grace
2:25.012 default Q chaos_bolt Fluffy_Pillow 341304.3/1100000: 31% mana | 3.0/5: 60% soul_shard soul_harvest, lord_of_flames, embrace_chaos, nefarious_pact, accelerando, potion_of_deadly_grace
2:25.963 default C havoc enemy2 355055.0/1100000: 32% mana | 2.0/5: 40% soul_shard soul_harvest, lord_of_flames, embrace_chaos, devils_due, accelerando, potion_of_deadly_grace
2:27.312 default K conflagrate Fluffy_Pillow 286560.6/1100000: 26% mana | 2.0/5: 40% soul_shard lord_of_flames, embrace_chaos, devils_due, accelerando, potion_of_deadly_grace
2:28.660 default Q chaos_bolt Fluffy_Pillow 306051.7/1100000: 28% mana | 3.0/5: 60% soul_shard lord_of_flames, embrace_chaos, devils_due, accelerando, potion_of_deadly_grace
2:30.279 default R incinerate Fluffy_Pillow 329480.7/1100000: 30% mana | 2.0/5: 40% soul_shard lord_of_flames, embrace_chaos, devils_due, accelerando(2), potion_of_deadly_grace
2:31.944 default R incinerate Fluffy_Pillow 287914.4/1100000: 26% mana | 2.0/5: 40% soul_shard lord_of_flames, embrace_chaos, devils_due, accelerando(2), potion_of_deadly_grace
2:33.609 default E immolate Fluffy_Pillow 246232.7/1100000: 22% mana | 2.0/5: 40% soul_shard lord_of_flames, embrace_chaos, devils_due, potion_of_deadly_grace
2:34.977 default Q chaos_bolt Fluffy_Pillow 199718.5/1100000: 18% mana | 2.0/5: 40% soul_shard lord_of_flames, potion_of_deadly_grace
2:37.298 default R incinerate Fluffy_Pillow 232779.8/1100000: 21% mana | 0.0/5: 0% soul_shard lord_of_flames, embrace_chaos, accelerando, potion_of_deadly_grace
2:38.733 default R incinerate Fluffy_Pillow 187528.9/1100000: 17% mana | 1.0/5: 20% soul_shard lord_of_flames, embrace_chaos, accelerando
2:40.167 default R incinerate Fluffy_Pillow 142263.5/1100000: 13% mana | 1.0/5: 20% soul_shard lord_of_flames, embrace_chaos, accelerando
2:41.602 default R incinerate Fluffy_Pillow 97013.6/1100000: 9% mana | 1.0/5: 20% soul_shard lord_of_flames, accelerando(2)
2:43.015 default Q chaos_bolt Fluffy_Pillow 51750.1/1100000: 5% mana | 2.0/5: 40% soul_shard lord_of_flames, accelerando(3)
2:45.235 default G immolate Fluffy_Pillow 85021.7/1100000: 8% mana | 0.0/5: 0% soul_shard lord_of_flames, embrace_chaos, accelerando(4)
2:46.330 default J conflagrate Fluffy_Pillow 35562.5/1100000: 3% mana | 0.0/5: 0% soul_shard lord_of_flames, embrace_chaos, accelerando(4)
2:47.427 default K conflagrate Fluffy_Pillow 52133.6/1100000: 5% mana | 2.0/5: 40% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(4)
2:48.524 default Q chaos_bolt Fluffy_Pillow 68704.6/1100000: 6% mana | 3.0/5: 60% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(4)
2:49.839 default C havoc enemy2 88098.2/1100000: 8% mana | 1.0/5: 20% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos
2:51.002 default K conflagrate Fluffy_Pillow 16663.9/1100000: 2% mana | 1.0/5: 20% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos
2:52.164 default S life_tap Fluffy_Pillow 33215.4/1100000: 3% mana | 2.0/5: 40% soul_shard lord_of_flames, embrace_chaos
2:53.325 default F immolate enemy2 379800.3/1100000: 35% mana | 2.0/5: 40% soul_shard lord_of_flames, embrace_chaos, accelerando
2:54.471 default K conflagrate Fluffy_Pillow 330371.7/1100000: 30% mana | 2.0/5: 40% soul_shard lord_of_flames, accelerando(2)
2:55.600 default Q chaos_bolt Fluffy_Pillow 346939.6/1100000: 32% mana | 4.0/5: 80% soul_shard lord_of_flames, conflagration_of_chaos, accelerando(2)
2:57.852 default Q chaos_bolt Fluffy_Pillow 380027.5/1100000: 35% mana | 3.0/5: 60% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(3)
2:59.186 default R incinerate Fluffy_Pillow 399891.0/1100000: 36% mana | 1.0/5: 20% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(3)
3:00.578 default K conflagrate Fluffy_Pillow 354618.1/1100000: 32% mana | 1.0/5: 20% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(3)
3:01.690 default P dimensional_rift Fluffy_Pillow 371176.0/1100000: 34% mana | 2.0/5: 40% soul_shard lord_of_flames, embrace_chaos, accelerando(3)
3:02.801 default Q chaos_bolt Fluffy_Pillow 387719.0/1100000: 35% mana | 2.0/5: 40% soul_shard lord_of_flames, embrace_chaos, accelerando(3)
3:04.134 default H berserking Fluffy_Pillow 407720.7/1100000: 37% mana | 2.0/5: 40% soul_shard lord_of_flames, embrace_chaos, accelerando(5)
3:04.134 default R incinerate Fluffy_Pillow 407720.7/1100000: 37% mana | 2.0/5: 40% soul_shard berserking, lord_of_flames, embrace_chaos, accelerando(5)
3:05.312 default R incinerate Fluffy_Pillow 362218.6/1100000: 33% mana | 2.0/5: 40% soul_shard berserking, lord_of_flames, embrace_chaos
3:06.579 default P dimensional_rift Fluffy_Pillow 316972.7/1100000: 29% mana | 2.0/5: 40% soul_shard berserking, lord_of_flames, embrace_chaos
3:07.591 default Q chaos_bolt Fluffy_Pillow 333549.9/1100000: 30% mana | 2.0/5: 40% soul_shard berserking, lord_of_flames, embrace_chaos
3:08.804 default E immolate Fluffy_Pillow 353420.7/1100000: 32% mana | 0.0/5: 0% soul_shard berserking, lord_of_flames, embrace_chaos, accelerando
3:09.800 default R incinerate Fluffy_Pillow 303982.4/1100000: 28% mana | 0.0/5: 0% soul_shard berserking, lord_of_flames, embrace_chaos, accelerando
3:11.047 default C havoc enemy2 258717.7/1100000: 24% mana | 0.0/5: 0% soul_shard berserking, lord_of_flames, embrace_chaos, accelerando
3:12.045 default L service_imp Fluffy_Pillow 187497.6/1100000: 17% mana | 1.0/5: 20% soul_shard berserking, lord_of_flames, embrace_chaos, accelerando(2)
3:13.028 default R incinerate Fluffy_Pillow 204086.8/1100000: 19% mana | 0.0/5: 0% soul_shard berserking, lord_of_flames, accelerando(2)
3:14.258 default R incinerate Fluffy_Pillow 158727.7/1100000: 14% mana | 0.0/5: 0% soul_shard lord_of_flames, accelerando(3)
3:15.650 default R incinerate Fluffy_Pillow 113472.9/1100000: 10% mana | 0.0/5: 0% soul_shard lord_of_flames, accelerando(4)
3:17.023 default G immolate Fluffy_Pillow 68213.2/1100000: 6% mana | 0.0/5: 0% soul_shard lord_of_flames, accelerando(4)
3:18.119 default J conflagrate Fluffy_Pillow 18769.1/1100000: 2% mana | 2.0/5: 40% soul_shard lord_of_flames, accelerando(4)
3:19.214 default Q chaos_bolt Fluffy_Pillow 35310.0/1100000: 3% mana | 3.0/5: 60% soul_shard lord_of_flames, accelerando(4)
3:21.403 default Q chaos_bolt Fluffy_Pillow 67857.1/1100000: 6% mana | 3.0/5: 60% soul_shard lord_of_flames, embrace_chaos, accelerando
3:22.777 default K conflagrate Fluffy_Pillow 87724.1/1100000: 8% mana | 2.0/5: 40% soul_shard lord_of_flames, embrace_chaos, accelerando
3:23.922 default Q chaos_bolt Fluffy_Pillow 104280.0/1100000: 9% mana | 3.0/5: 60% soul_shard lord_of_flames, embrace_chaos, accelerando
3:25.295 default K conflagrate Fluffy_Pillow 124137.5/1100000: 11% mana | 1.0/5: 20% soul_shard lord_of_flames, embrace_chaos, accelerando(2)
3:26.426 default K conflagrate Fluffy_Pillow 140734.8/1100000: 13% mana | 2.0/5: 40% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(2)
3:27.553 default Q chaos_bolt Fluffy_Pillow 157273.4/1100000: 14% mana | 3.0/5: 60% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(2)
3:28.906 default R incinerate Fluffy_Pillow 177129.6/1100000: 16% mana | 1.0/5: 20% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(3)
3:30.298 default R incinerate Fluffy_Pillow 131856.8/1100000: 12% mana | 1.0/5: 20% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(3)
3:31.691 default K conflagrate Fluffy_Pillow 86709.4/1100000: 8% mana | 1.0/5: 20% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(4)
3:32.786 default C havoc enemy2 103250.2/1100000: 9% mana | 2.0/5: 40% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(4)
3:33.884 default Q chaos_bolt Fluffy_Pillow 31417.5/1100000: 3% mana | 4.0/5: 80% soul_shard lord_of_flames, conflagration_of_chaos
3:36.205 default Q chaos_bolt Fluffy_Pillow 64612.8/1100000: 6% mana | 3.0/5: 60% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando
3:37.577 default R incinerate Fluffy_Pillow 84450.9/1100000: 8% mana | 1.0/5: 20% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando
3:39.011 default Q chaos_bolt Fluffy_Pillow 39185.5/1100000: 4% mana | 3.0/5: 60% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando
3:40.385 default S life_tap Fluffy_Pillow 59052.6/1100000: 5% mana | 1.0/5: 20% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando
3:41.532 default E immolate Fluffy_Pillow 405641.0/1100000: 37% mana | 1.0/5: 20% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(2)
3:42.661 default R incinerate Fluffy_Pillow 356209.0/1100000: 32% mana | 1.0/5: 20% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(2)
3:44.075 default R incinerate Fluffy_Pillow 310959.3/1100000: 28% mana | 1.0/5: 20% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(2)
3:45.489 default R incinerate Fluffy_Pillow 265709.5/1100000: 24% mana | 1.0/5: 20% soul_shard lord_of_flames, conflagration_of_chaos, accelerando(2)
3:46.902 default P dimensional_rift Fluffy_Pillow 220445.2/1100000: 20% mana | 1.0/5: 20% soul_shard lord_of_flames, conflagration_of_chaos, accelerando(2)
3:48.030 default Q chaos_bolt Fluffy_Pillow 236803.6/1100000: 22% mana | 2.0/5: 40% soul_shard lord_of_flames, conflagration_of_chaos
3:50.350 default G immolate Fluffy_Pillow 270054.2/1100000: 25% mana | 0.0/5: 0% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando
3:51.496 default J conflagrate Fluffy_Pillow 220624.5/1100000: 20% mana | 0.0/5: 0% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando
3:52.641 default K conflagrate Fluffy_Pillow 237180.4/1100000: 22% mana | 2.0/5: 40% soul_shard lord_of_flames, embrace_chaos, accelerando
3:53.786 default C havoc enemy2 253736.3/1100000: 23% mana | 3.0/5: 60% soul_shard lord_of_flames, embrace_chaos, accelerando
3:54.932 default N summon_doomguard Fluffy_Pillow 182553.7/1100000: 17% mana | 4.0/5: 80% soul_shard lord_of_flames, accelerando(2)
3:56.061 default Q chaos_bolt Fluffy_Pillow 199121.6/1100000: 18% mana | 3.0/5: 60% soul_shard lord_of_flames, sindorei_spite, accelerando(2)
3:58.312 default K conflagrate Fluffy_Pillow 232154.8/1100000: 21% mana | 2.0/5: 40% soul_shard lord_of_flames, embrace_chaos, sindorei_spite, accelerando(2)
3:59.440 default Q chaos_bolt Fluffy_Pillow 248708.1/1100000: 23% mana | 3.0/5: 60% soul_shard lord_of_flames, embrace_chaos, sindorei_spite, accelerando(2)
4:00.791 default K conflagrate Fluffy_Pillow 268533.8/1100000: 24% mana | 1.0/5: 20% soul_shard lord_of_flames, embrace_chaos, sindorei_spite, accelerando(2)
4:01.918 default R incinerate Fluffy_Pillow 284849.2/1100000: 26% mana | 2.0/5: 40% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, sindorei_spite
4:03.375 default Q chaos_bolt Fluffy_Pillow 239692.9/1100000: 22% mana | 3.0/5: 60% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, sindorei_spite, accelerando
4:04.750 default R incinerate Fluffy_Pillow 259574.4/1100000: 24% mana | 1.0/5: 20% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, sindorei_spite, accelerando
4:06.185 default K conflagrate Fluffy_Pillow 214323.5/1100000: 19% mana | 1.0/5: 20% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, sindorei_spite, accelerando
4:07.331 default R incinerate Fluffy_Pillow 230893.8/1100000: 21% mana | 2.0/5: 40% soul_shard lord_of_flames, embrace_chaos, sindorei_spite, accelerando
4:08.765 default O soul_harvest Fluffy_Pillow 185628.4/1100000: 17% mana | 3.0/5: 60% soul_shard lord_of_flames, sindorei_spite, accelerando
4:08.765 default Q chaos_bolt Fluffy_Pillow 185628.4/1100000: 17% mana | 3.0/5: 60% soul_shard soul_harvest, lord_of_flames, sindorei_spite, accelerando
4:11.051 default R incinerate Fluffy_Pillow 218682.3/1100000: 20% mana | 1.0/5: 20% soul_shard soul_harvest, lord_of_flames, embrace_chaos, sindorei_spite, accelerando
4:12.487 default P dimensional_rift Fluffy_Pillow 173445.8/1100000: 16% mana | 1.0/5: 20% soul_shard soul_harvest, lord_of_flames, embrace_chaos, sindorei_spite, accelerando
4:13.633 default E immolate Fluffy_Pillow 190016.2/1100000: 17% mana | 1.0/5: 20% soul_shard soul_harvest, lord_of_flames, embrace_chaos, sindorei_spite, accelerando
4:14.781 default C havoc enemy2 140616.9/1100000: 13% mana | 1.0/5: 20% soul_shard soul_harvest, lord_of_flames, embrace_chaos, sindorei_spite, accelerando(2)
4:15.911 default F immolate enemy2 68788.0/1100000: 6% mana | 1.0/5: 20% soul_shard soul_harvest, lord_of_flames, sindorei_spite
4:17.074 default S life_tap Fluffy_Pillow 19353.8/1100000: 2% mana | 1.0/5: 20% soul_shard soul_harvest, lord_of_flames, sindorei_spite
4:18.235 default R incinerate Fluffy_Pillow 365891.0/1100000: 33% mana | 1.0/5: 20% soul_shard soul_harvest, lord_of_flames, sindorei_spite
4:19.691 default R incinerate Fluffy_Pillow 320630.3/1100000: 29% mana | 1.0/5: 20% soul_shard soul_harvest, lord_of_flames, sindorei_spite
4:21.145 default R incinerate Fluffy_Pillow 275341.0/1100000: 25% mana | 1.0/5: 20% soul_shard soul_harvest, lord_of_flames
4:22.601 default Q chaos_bolt Fluffy_Pillow 230080.2/1100000: 21% mana | 2.0/5: 40% soul_shard soul_harvest, lord_of_flames
4:24.921 default G immolate Fluffy_Pillow 263127.1/1100000: 24% mana | 2.0/5: 40% soul_shard soul_harvest, lord_of_flames, embrace_chaos, accelerando
4:26.068 default J conflagrate Fluffy_Pillow 213713.2/1100000: 19% mana | 2.0/5: 40% soul_shard soul_harvest, lord_of_flames, embrace_chaos, accelerando(2)
4:27.197 default Q chaos_bolt Fluffy_Pillow 230281.1/1100000: 21% mana | 4.0/5: 80% soul_shard soul_harvest, lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(2)
4:28.551 default K conflagrate Fluffy_Pillow 250150.9/1100000: 23% mana | 2.0/5: 40% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(2)
4:29.679 default Q chaos_bolt Fluffy_Pillow 266704.2/1100000: 24% mana | 3.0/5: 60% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(2)
4:31.030 default J conflagrate Fluffy_Pillow 286529.9/1100000: 26% mana | 2.0/5: 40% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(2)
4:32.159 default P dimensional_rift Fluffy_Pillow 303097.9/1100000: 28% mana | 3.0/5: 60% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(2)
4:33.288 default J conflagrate Fluffy_Pillow 319665.8/1100000: 29% mana | 4.0/5: 80% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(2)
4:34.418 default Q chaos_bolt Fluffy_Pillow 336248.4/1100000: 31% mana | 5.0/5: 100% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(2)
4:35.770 default C havoc enemy2 356184.7/1100000: 32% mana | 3.0/5: 60% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(3)
4:36.883 default Q chaos_bolt Fluffy_Pillow 284757.5/1100000: 26% mana | 3.0/5: 60% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(3)
4:38.217 default R incinerate Fluffy_Pillow 303919.6/1100000: 28% mana | 1.0/5: 20% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando
4:39.652 default J conflagrate Fluffy_Pillow 258668.6/1100000: 24% mana | 1.0/5: 20% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando
4:41.046 default Q chaos_bolt Fluffy_Pillow 278824.9/1100000: 25% mana | 2.0/5: 40% soul_shard lord_of_flames, embrace_chaos, accelerando
4:42.420 default R incinerate Fluffy_Pillow 298691.9/1100000: 27% mana | 0.0/5: 0% soul_shard lord_of_flames, embrace_chaos, accelerando
4:43.854 default R incinerate Fluffy_Pillow 253426.5/1100000: 23% mana | 0.0/5: 0% soul_shard lord_of_flames, embrace_chaos, accelerando
4:45.287 default L service_imp Fluffy_Pillow 208146.7/1100000: 19% mana | 1.0/5: 20% soul_shard lord_of_flames, embrace_chaos, accelerando
4:46.434 default R incinerate Fluffy_Pillow 224731.5/1100000: 20% mana | 0.0/5: 0% soul_shard lord_of_flames, accelerando
4:47.868 default E immolate Fluffy_Pillow 179466.9/1100000: 16% mana | 1.0/5: 20% soul_shard lord_of_flames, accelerando(2)
4:48.999 default J conflagrate Fluffy_Pillow 130064.2/1100000: 12% mana | 1.0/5: 20% soul_shard lord_of_flames, accelerando(2)
4:50.128 default Q chaos_bolt Fluffy_Pillow 146393.0/1100000: 13% mana | 2.0/5: 40% soul_shard lord_of_flames, conflagration_of_chaos
4:52.448 default R incinerate Fluffy_Pillow 179439.0/1100000: 16% mana | 1.0/5: 20% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos
4:53.905 default J conflagrate Fluffy_Pillow 134262.3/1100000: 12% mana | 2.0/5: 40% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando
4:55.050 default Q chaos_bolt Fluffy_Pillow 150818.1/1100000: 14% mana | 3.0/5: 60% soul_shard lord_of_flames, embrace_chaos, accelerando
4:56.422 default R incinerate Fluffy_Pillow 170656.3/1100000: 16% mana | 2.0/5: 40% soul_shard lord_of_flames, embrace_chaos, accelerando

Stats

Raid-Buffed Unbuffed Gear Amount
Strength 4201 3876 0
Agility 7254 6929 0
Stamina 54709 54709 34192
Intellect 50353 48647 39007 (1278)
Spirit 1 1 0
Health 3282540 3282540 0
Mana 1100000 1100000 0
Soul Shard 5 5 0
Spell Power 50353 48647 0
Crit 15.68% 15.68% 4271
Haste 29.49% 28.49% 10684
Damage / Heal Versatility 5.36% 5.36% 2544
ManaReg per Second 14244 14134 0
Mastery 66.15% 66.15% 5618
Armor 1975 1975 1975
Run Speed 7 0 0

Gear

Source Slot Average Item Level: 906.00
Local Head Eyes of Azj'Aqir
ilevel: 900, stats: { 253 Armor, +3255 Sta, +2170 Int, +1074 Haste, +578 Vers }
Local Neck Radiant String of Scorpid Eyes
ilevel: 900, stats: { +1831 Sta, +2011 Haste, +922 Crit }, enchant: mark_of_the_hidden_satyr
Local Shoulders Pauldrons of Azj'Aqir
ilevel: 900, stats: { 233 Armor, +2442 Sta, +1628 Int, +752 Mastery, +487 Vers }
Local Chest Robes of Fluctuating Energy
ilevel: 900, stats: { 311 Armor, +3255 Sta, +2170 Int, +1145 Haste, +507 Mastery }
Local Waist Man'ari Skullbuckled Cinch
ilevel: 900, stats: { 175 Armor, +2442 Sta, +1628 Int, +699 Haste, +540 Mastery }
Local Legs Leggings of Azj'Aqir
ilevel: 900, stats: { 272 Armor, +3255 Sta, +2170 Int, +932 Crit, +720 Haste }
Local Feet Outcast Wanderer's Footrags
ilevel: 910, stats: { 222 Armor, +2680 Sta, +1786 Int, +864 Crit, +422 Mastery }
Local Wrists Sin'dorei Spite
ilevel: 940, stats: { 157 Armor, +2658 Sta, +1772 Int, +694 Crit, +385 Haste }
Local Hands Clutch of Azj'Aqir
ilevel: 900, stats: { 194 Armor, +2442 Sta, +1628 Int, +859 Crit, +380 Mastery }
Local Finger1 Ring of the Scoured Clan
ilevel: 900, stats: { +1831 Sta, +2095 Mastery, +838 Haste }, enchant: { +200 Haste }
Local Finger2 Ring of Braided Stems
ilevel: 905, stats: { +1918 Sta, +1814 Haste, +1209 Vers }, enchant: { +200 Haste }
Local Trinket1 Whispers in the Dark
ilevel: 905, stats: { +2162 Int }
Local Trinket2 Erratic Metronome
ilevel: 900, stats: { +2063 Int }
Local Back Astromancer's Greatcloak
ilevel: 905, stats: { 158 Armor, +1918 Sta, +1278 StrAgiInt, +676 Haste, +270 Vers }, enchant: { +200 Int }
Local Main Hand Scepter of Sargeras
ilevel: 929, weapon: { 7005 - 10509, 3.6 }, stats: { +2843 Int, +4265 Sta, +922 Haste, +922 Mastery, +15509 Int }, relics: { +61 ilevels, +59 ilevels, +61 ilevels }

Talents

Level
15 Backdraft (Destruction Warlock) Roaring Blaze (Destruction Warlock) Shadowburn (Destruction Warlock)
30 Reverse Entropy (Destruction Warlock) Eradication (Destruction Warlock) Empowered Life Tap
45 Demonic Circle Mortal Coil Shadowfury
60 Cataclysm (Destruction Warlock) Fire and Brimstone (Destruction Warlock) Soul Harvest
75 Demon Skin Burning Rush Dark Pact
90 Grimoire of Supremacy Grimoire of Service Grimoire of Sacrifice
100 Wreak Havoc (Destruction Warlock) Channel Demonfire (Destruction Warlock) Soul Conduit

Profile

warlock="Spite"
level=110
race=troll
role=spell
position=back
talents=2203021
artifact=38:0:0:0:0:803:1:804:3:805:3:806:3:807:3:808:3:809:3:810:3:811:3:812:3:813:1:814:1:815:1:816:1:817:1:818:1:1355:1:1392:1:1609:4:1610:1:1611:1:1713:1
spec=destruction

# This default action priority list is automatically created based on your character.
# It is a attempt to provide you with a action list that is both simple and practicable,
# while resulting in a meaningful and good simulation. It may not result in the absolutely highest possible dps.
# Feel free to edit, adapt and improve it to your own needs.
# SimulationCraft is always looking for updates and improvements to the default action lists.

# Executed before combat begins. Accepts non-harmful actions only.
actions.precombat=flask,type=whispered_pact
actions.precombat+=/food,type=azshari_salad
actions.precombat+=/summon_pet,if=!talent.grimoire_of_supremacy.enabled&(!talent.grimoire_of_sacrifice.enabled|buff.demonic_power.down)
actions.precombat+=/summon_infernal,if=talent.grimoire_of_supremacy.enabled&artifact.lord_of_flames.rank>0
actions.precombat+=/summon_infernal,if=talent.grimoire_of_supremacy.enabled&active_enemies>1
actions.precombat+=/summon_doomguard,if=talent.grimoire_of_supremacy.enabled&active_enemies=1&artifact.lord_of_flames.rank=0
actions.precombat+=/augmentation,type=defiled
actions.precombat+=/snapshot_stats
actions.precombat+=/grimoire_of_sacrifice,if=talent.grimoire_of_sacrifice.enabled
actions.precombat+=/life_tap,if=talent.empowered_life_tap.enabled&!buff.empowered_life_tap.remains
actions.precombat+=/potion,name=prolonged_power
actions.precombat+=/chaos_bolt

# Executed every time the actor is available.
actions=havoc,target=2,if=active_enemies>1&(active_enemies<4|talent.wreak_havoc.enabled&active_enemies<6)&!debuff.havoc.remains
actions+=/dimensional_rift,if=charges=3
actions+=/immolate,if=remains<=tick_time
actions+=/immolate,cycle_targets=1,if=active_enemies>1&remains<=tick_time&(!talent.roaring_blaze.enabled|(!debuff.roaring_blaze.remains&action.conflagrate.charges<2+set_bonus.tier19_4pc))
actions+=/immolate,if=talent.roaring_blaze.enabled&remains<=duration&!debuff.roaring_blaze.remains&target.time_to_die>10&(action.conflagrate.charges=2+set_bonus.tier19_4pc|(action.conflagrate.charges>=1+set_bonus.tier19_4pc&action.conflagrate.recharge_time<cast_time+gcd)|target.time_to_die<24)
actions+=/berserking
actions+=/blood_fury
actions+=/arcane_torrent
actions+=/potion,name=deadly_grace,if=(buff.soul_harvest.remains|trinket.proc.any.react|target.time_to_die<=45)
actions+=/shadowburn,if=buff.conflagration_of_chaos.remains<=action.chaos_bolt.cast_time
actions+=/shadowburn,if=(charges=1+set_bonus.tier19_4pc&recharge_time<action.chaos_bolt.cast_time|charges=2+set_bonus.tier19_4pc)&soul_shard<5
actions+=/conflagrate,if=talent.roaring_blaze.enabled&(charges=2+set_bonus.tier19_4pc|(charges>=1+set_bonus.tier19_4pc&recharge_time<gcd)|target.time_to_die<24)
actions+=/conflagrate,if=talent.roaring_blaze.enabled&debuff.roaring_blaze.stack>0&dot.immolate.remains>dot.immolate.duration*0.3&(active_enemies=1|soul_shard<3)&soul_shard<5
actions+=/conflagrate,if=!talent.roaring_blaze.enabled&buff.backdraft.stack<3&buff.conflagration_of_chaos.remains<=action.chaos_bolt.cast_time
actions+=/conflagrate,if=!talent.roaring_blaze.enabled&buff.backdraft.stack<3&(charges=1+set_bonus.tier19_4pc&recharge_time<action.chaos_bolt.cast_time|charges=2+set_bonus.tier19_4pc)&soul_shard<5
actions+=/life_tap,if=talent.empowered_life_tap.enabled&buff.empowered_life_tap.remains<=gcd
actions+=/dimensional_rift,if=equipped.144369&!buff.lessons_of_spacetime.remains&((!talent.grimoire_of_supremacy.enabled&!cooldown.summon_doomguard.remains)|(talent.grimoire_of_service.enabled&!cooldown.service_pet.remains)|(talent.soul_harvest.enabled&!cooldown.soul_harvest.remains))
actions+=/service_pet
actions+=/summon_infernal,if=artifact.lord_of_flames.rank>0&!buff.lord_of_flames.remains
actions+=/summon_doomguard,if=!talent.grimoire_of_supremacy.enabled&spell_targets.infernal_awakening<=2&(target.time_to_die>180|target.health.pct<=20|target.time_to_die<30)
actions+=/summon_infernal,if=!talent.grimoire_of_supremacy.enabled&spell_targets.infernal_awakening>2
actions+=/summon_doomguard,if=talent.grimoire_of_supremacy.enabled&spell_targets.summon_infernal=1&artifact.lord_of_flames.rank>0&buff.lord_of_flames.remains&!pet.doomguard.active
actions+=/summon_doomguard,if=talent.grimoire_of_supremacy.enabled&spell_targets.summon_infernal=1&equipped.132379&!cooldown.sindorei_spite_icd.remains
actions+=/summon_infernal,if=talent.grimoire_of_supremacy.enabled&spell_targets.summon_infernal>1&equipped.132379&!cooldown.sindorei_spite_icd.remains
actions+=/soul_harvest
actions+=/channel_demonfire,if=dot.immolate.remains>cast_time
actions+=/havoc,if=active_enemies=1&talent.wreak_havoc.enabled&equipped.132375&!debuff.havoc.remains
actions+=/rain_of_fire,if=active_enemies>=3&cooldown.havoc.remains<=12&!talent.wreak_havoc.enabled
actions+=/rain_of_fire,if=active_enemies>=6&talent.wreak_havoc.enabled
actions+=/dimensional_rift,if=!equipped.144369|charges>1|((!talent.grimoire_of_service.enabled|recharge_time<cooldown.service_pet.remains)&(!talent.soul_harvest.enabled|recharge_time<cooldown.soul_harvest.remains)&(!talent.grimoire_of_supremacy.enabled|recharge_time<cooldown.summon_doomguard.remains))
actions+=/life_tap,if=talent.empowered_life_tap.enabled&buff.empowered_life_tap.remains<duration*0.3
actions+=/cataclysm
actions+=/chaos_bolt,if=(cooldown.havoc.remains>12&cooldown.havoc.remains|active_enemies<3|talent.wreak_havoc.enabled&active_enemies<6)&(set_bonus.tier19_4pc=0|!talent.eradication.enabled|buff.embrace_chaos.remains<=cast_time|soul_shard>=3)
actions+=/shadowburn
actions+=/conflagrate,if=!talent.roaring_blaze.enabled&buff.backdraft.stack<3
actions+=/immolate,if=!talent.roaring_blaze.enabled&remains<=duration*0.3
actions+=/incinerate
actions+=/life_tap

head=eyes_of_azjaqir,id=138314,bonus_id=3445
neck=radiant_string_of_scorpid_eyes,id=140898,bonus_id=3445,enchant_id=5439
shoulders=pauldrons_of_azjaqir,id=138323,bonus_id=3445
back=astromancers_greatcloak,id=140909,bonus_id=3518,enchant_id=5436
chest=robes_of_fluctuating_energy,id=140848,bonus_id=3445
wrists=sindorei_spite,id=132379,ilevel=940
hands=clutch_of_azjaqir,id=138311,bonus_id=3445
waist=manari_skullbuckled_cinch,id=140887,bonus_id=3445
legs=leggings_of_azjaqir,id=138317,bonus_id=3445
feet=outcast_wanderers_footrags,id=140914,bonus_id=3519
finger1=ring_of_the_scoured_clan,id=140897,bonus_id=3445,enchant=binding_of_haste
finger2=ring_of_braided_stems,id=140896,bonus_id=3518,enchant=binding_of_haste
trinket1=whispers_in_the_dark,id=140809,ilevel=905
trinket2=erratic_metronome,id=140792,ilevel=900
main_hand=scepter_of_sargeras,id=128941,ilevel=929,gem_id=140826/140837/140826,relic_id=3519/3518:3518/3519

# Gear Summary
# gear_ilvl=906.27
# gear_stamina=34192
# gear_intellect=39007
# gear_crit_rating=4271
# gear_haste_rating=10684
# gear_mastery_rating=5618
# gear_versatility_rating=2544
# gear_armor=1975
# set_bonus=tier19_2pc=1
# set_bonus=tier19_4pc=1
default_pet=imp

Simulation & Raid Information

Iterations: 10003
Threads: 4
Confidence: 95.00%
Fight Length: 218 - 385 ( 301.0 )

Performance:

Total Events Processed: 1012646581
Max Event Queue: 1346
Sim Seconds: 3010988
CPU Seconds: 1149.7500
Physical Seconds: 351.0754
Speed Up: 2619

Settings:

World Lag: 100 ms ( stddev = 10 ms )
Queue Lag: 5 ms ( stddev = 1 ms )

Raw Ability Summary

Character Unit Ability Id Total DPS Imp/Min Hit Crit Count Impacts Crit% Avoid% G% B% Interval Combined Duration
Alythess' Alythess' augmentation 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 301.01sec
Alythess' Alythess' berserking 26297 0 0 0.00 0 0 2.1 0.0 0.0% 0.0% 0.0% 0.0% 180.65sec 0 301.01sec
Alythess' Alythess' chaos_bolt 116858 119368486 396562 23.42 0 1015897 61.5 117.5 100.0% 0.0% 0.0% 0.0% 4.75sec 119368486 301.01sec
Alythess' Alythess' conflagrate 17962 49521670 164519 19.17 292980 680439 48.4 96.2 57.3% 0.0% 0.0% 0.0% 6.21sec 49521670 301.01sec
Alythess' Alythess' cry_havoc 243011 12287862 40822 21.18 96951 193877 53.1 106.3 19.3% 0.0% 0.0% 0.0% 5.45sec 12287862 301.01sec
Alythess' Alythess' deadly_grace 188091 1830973 6083 2.87 106653 213305 14.4 14.4 19.3% 0.0% 0.0% 0.0% 2.06sec 1830973 301.01sec
Alythess' Alythess' dimensional_rift 196586 0 0 0.00 0 0 12.9 0.0 0.0% 0.0% 0.0% 0.0% 23.68sec 0 301.01sec
Alythess' Alythess' flask 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 301.01sec
Alythess' Alythess' food 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 301.01sec
Alythess' Alythess' havoc 80240 0 0 0.00 0 0 14.9 0.0 0.0% 0.0% 0.0% 0.0% 20.93sec 0 301.01sec
Alythess' Alythess' immolate 348 9911385 32927 7.71 153142 306531 20.0 38.7 67.3% 0.0% 0.0% 0.0% 15.20sec 90132391 301.01sec
Alythess' Alythess' immolate ticks -348 80221006 267403 58.66 163611 326982 20.0 293.3 67.3% 0.0% 0.0% 0.0% 15.20sec 90132391 301.01sec
Alythess' Alythess' incinerate 29722 43439385 144313 28.60 253757 507641 75.1 143.5 19.3% 0.0% 0.0% 0.0% 3.84sec 43439385 301.01sec
Alythess' Alythess' life_tap 1454 0 0 0.00 0 0 6.6 0.0 0.0% 0.0% 0.0% 0.0% 33.93sec 0 301.01sec
Alythess' Alythess' mark_of_the_hidden_satyr 191259 3094725 10281 3.98 129793 259581 20.0 20.0 19.3% 0.0% 0.0% 0.0% 15.05sec 3094725 301.01sec
Alythess' Alythess' potion 0 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 301.01sec
Alythess' Alythess' service_imp 111859 0 0 0.00 0 0 3.7 0.0 0.0% 0.0% 0.0% 0.0% 91.34sec 0 301.01sec
Alythess' Alythess' soul_harvest 196098 0 0 0.00 0 0 2.9 0.0 0.0% 0.0% 0.0% 0.0% 120.90sec 0 301.01sec
Alythess' Alythess' summon_doomguard 18540 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 301.01sec
Alythess' Alythess' summon_imp 688 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 301.01sec
Alythess' Alythess' summon_infernal 1122 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 301.01sec
Alythess' Alythess'_imp firebolt 3110 14701357 48840 21.51 114217 228261 108.7 107.9 19.3% 0.0% 0.0% 0.0% 2.77sec 14701357 301.01sec
Alythess' Alythess'_service_imp firebolt 3110 13620199 141702 30.59 232927 465828 49.3 49.0 19.3% 0.0% 0.0% 0.0% 5.52sec 13620199 96.12sec
Alythess' Alythess'_infernal immolation ticks -19483 2609881 8700 4.65 47111 94223 1.0 23.2 19.2% 0.0% 0.0% 0.0% 0.00sec 2609881 25.00sec
Alythess' Alythess'_infernal melee 0 740905 29635 52.86 28213 56390 22.0 22.0 19.3% 0.0% 0.0% 0.0% 1.11sec 1089200 25.00sec
Alythess' Alythess'_doomguard doom_bolt 85692 2759159 110362 26.30 211062 422325 11.0 11.0 19.3% 0.0% 0.0% 0.0% 2.20sec 2759159 25.00sec
Alythess' Alythess'_lord_of_flames_infernal immolation ticks -19483 2614087 8714 4.65 47109 94237 1.0 23.2 19.4% 0.0% 0.0% 0.0% 0.00sec 2614087 25.00sec
Alythess' Alythess'_lord_of_flames_infernal melee 0 740309 29611 52.86 28208 56434 22.0 22.0 19.1% 0.0% 0.0% 0.0% 1.11sec 1088324 25.00sec
Alythess' Alythess'_lord_of_flames_infernal immolation ticks -19483 2612812 8709 4.65 47111 94224 1.0 23.2 19.3% 0.0% 0.0% 0.0% 0.00sec 2612812 25.00sec
Alythess' Alythess'_lord_of_flames_infernal melee 0 741320 29652 52.86 28208 56435 22.0 22.0 19.3% 0.0% 0.0% 0.0% 1.11sec 1089811 25.00sec
Alythess' Alythess'_lord_of_flames_infernal immolation ticks -19483 2611424 8705 4.65 47114 94195 1.0 23.2 19.3% 0.0% 0.0% 0.0% 0.00sec 2611424 25.00sec
Alythess' Alythess'_lord_of_flames_infernal melee 0 741566 29661 52.86 28210 56415 22.0 22.0 19.4% 0.0% 0.0% 0.0% 1.11sec 1090172 25.00sec
Alythess' Alythess'_shadowy_tear shadow_bolt ticks -196657 5404609 18015 7.35 123853 248092 3.3 36.8 19.3% 0.0% 0.0% 0.0% 70.70sec 5404609 40.63sec
Alythess' Alythess'_flame_rift searing_bolt 243050 4204410 50073 46.80 64195 0 65.9 65.5 0.0% 0.0% 0.0% 0.0% 2.66sec 23777464 83.97sec
Alythess' Alythess'_flame_rift searing_bolt ticks -243050 19573054 65244 27.96 117464 234899 65.9 139.8 19.2% 0.0% 0.0% 0.0% 2.66sec 23777464 83.97sec
Alythess' Alythess'_chaos_tear chaos_bolt 215279 2513981 157422 12.34 0 765251 3.3 3.3 100.0% 0.0% 0.0% 0.0% 70.88sec 2513981 15.97sec
Alythess' Alythess'_chaos_portal chaos_barrage ticks -187394 4883867 16280 23.30 35294 70563 3.3 116.5 19.3% 0.0% 0.0% 0.0% 71.15sec 4883867 17.43sec
Cloak Cloak augmentation 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 301.01sec
Cloak Cloak berserking 26297 0 0 0.00 0 0 2.1 0.0 0.0% 0.0% 0.0% 0.0% 180.61sec 0 301.01sec
Cloak Cloak chaos_bolt 116858 117364026 389903 23.07 0 1013991 60.6 115.7 100.0% 0.0% 0.0% 0.0% 4.82sec 117364026 301.01sec
Cloak Cloak conflagrate 17962 49302388 163791 19.14 301351 684358 48.3 96.0 55.4% 0.0% 0.0% 0.0% 6.22sec 49302388 301.01sec
Cloak Cloak cry_havoc 243011 12070977 40102 20.84 99822 199653 52.3 104.5 15.7% 0.0% 0.0% 0.0% 5.53sec 12070977 301.01sec
Cloak Cloak deadly_grace 188091 1801020 5983 2.86 108683 217492 14.3 14.3 15.5% 0.0% 0.0% 0.0% 2.07sec 1801020 301.01sec
Cloak Cloak dimensional_rift 196586 0 0 0.00 0 0 12.9 0.0 0.0% 0.0% 0.0% 0.0% 23.56sec 0 301.01sec
Cloak Cloak flask 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 301.01sec
Cloak Cloak food 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 301.01sec
Cloak Cloak havoc 80240 0 0 0.00 0 0 14.9 0.0 0.0% 0.0% 0.0% 0.0% 20.91sec 0 301.01sec
Cloak Cloak immolate 348 9986426 33177 7.70 157775 315786 20.0 38.6 63.8% 0.0% 0.0% 0.0% 15.24sec 90688927 301.01sec
Cloak Cloak immolate ticks -348 80702501 269008 58.57 168518 336791 20.0 292.8 63.6% 0.0% 0.0% 0.0% 15.24sec 90688927 301.01sec
Cloak Cloak incinerate 29722 43552910 144690 28.73 261238 522156 75.4 144.1 15.7% 0.0% 0.0% 0.0% 3.82sec 43552910 301.01sec
Cloak Cloak life_tap 1454 0 0 0.00 0 0 6.6 0.0 0.0% 0.0% 0.0% 0.0% 33.59sec 0 301.01sec
Cloak Cloak mark_of_the_hidden_satyr 191259 3086420 10254 3.97 133671 267290 19.9 19.9 15.8% 0.0% 0.0% 0.0% 15.04sec 3086420 301.01sec
Cloak Cloak potion 0 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 301.01sec
Cloak Cloak service_imp 111859 0 0 0.00 0 0 3.7 0.0 0.0% 0.0% 0.0% 0.0% 91.39sec 0 301.01sec
Cloak Cloak soul_harvest 196098 0 0 0.00 0 0 2.9 0.0 0.0% 0.0% 0.0% 0.0% 120.93sec 0 301.01sec
Cloak Cloak summon_doomguard 18540 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 301.01sec
Cloak Cloak summon_imp 688 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 301.01sec
Cloak Cloak summon_infernal 1122 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 301.01sec
Cloak Cloak_imp firebolt 3110 14651356 48674 21.48 117577 235186 108.6 107.7 15.6% 0.0% 0.0% 0.0% 2.77sec 14651356 301.01sec
Cloak Cloak_service_imp firebolt 3110 13573803 141247 30.55 239792 479708 49.2 48.9 15.7% 0.0% 0.0% 0.0% 5.53sec 13573803 96.10sec
Cloak Cloak_infernal immolation ticks -19483 2608480 8695 4.65 48477 96962 1.0 23.2 15.8% 0.0% 0.0% 0.0% 0.00sec 2608480 25.00sec
Cloak Cloak_infernal melee 0 739180 29566 52.84 29022 58063 22.0 22.0 15.7% 0.0% 0.0% 0.0% 1.11sec 1086665 25.00sec
Cloak Cloak_doomguard doom_bolt 85692 2740082 109602 26.20 217391 434183 10.9 10.9 15.5% 0.0% 0.0% 0.0% 2.21sec 2740082 25.00sec
Cloak Cloak_lord_of_flames_infernal immolation ticks -19483 2606682 8689 4.65 48476 96975 1.0 23.2 15.7% 0.0% 0.0% 0.0% 0.00sec 2606682 25.00sec
Cloak Cloak_lord_of_flames_infernal melee 0 738847 29553 52.84 29023 58048 22.0 22.0 15.6% 0.0% 0.0% 0.0% 1.11sec 1086175 25.00sec
Cloak Cloak_lord_of_flames_infernal immolation ticks -19483 2606010 8687 4.65 48473 97003 1.0 23.2 15.7% 0.0% 0.0% 0.0% 0.00sec 2606010 25.00sec
Cloak Cloak_lord_of_flames_infernal melee 0 738444 29537 52.84 29022 58061 22.0 22.0 15.6% 0.0% 0.0% 0.0% 1.11sec 1085583 25.00sec
Cloak Cloak_lord_of_flames_infernal immolation ticks -19483 2602855 8676 4.65 48478 96954 1.0 23.2 15.5% 0.0% 0.0% 0.0% 0.00sec 2602855 25.00sec
Cloak Cloak_lord_of_flames_infernal melee 0 738609 29543 52.84 29023 58055 22.0 22.0 15.6% 0.0% 0.0% 0.0% 1.11sec 1085825 25.00sec
Cloak Cloak_shadowy_tear shadow_bolt ticks -196657 5427213 18091 7.40 127407 254855 3.3 37.0 15.8% 0.0% 0.0% 0.0% 68.93sec 5427213 40.86sec
Cloak Cloak_flame_rift searing_bolt 243050 4252896 51406 46.69 66056 0 64.8 64.4 0.0% 0.0% 0.0% 0.0% 2.62sec 23414504 82.73sec
Cloak Cloak_flame_rift searing_bolt ticks -243050 19161608 63872 27.42 120814 241585 64.8 137.1 15.7% 0.0% 0.0% 0.0% 2.62sec 23414504 82.73sec
Cloak Cloak_chaos_tear chaos_bolt 215279 2524499 157842 12.40 0 764020 3.3 3.3 100.0% 0.0% 0.0% 0.0% 70.62sec 2524499 15.99sec
Cloak Cloak_chaos_portal chaos_barrage ticks -187394 4929875 16433 23.55 36364 72723 3.3 117.8 15.6% 0.0% 0.0% 0.0% 68.78sec 4929875 17.50sec
Destro_7.2_NoLeggos Destro_7.2_NoLeggos augmentation 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 301.01sec
Destro_7.2_NoLeggos Destro_7.2_NoLeggos berserking 26297 0 0 0.00 0 0 2.1 0.0 0.0% 0.0% 0.0% 0.0% 180.68sec 0 301.01sec
Destro_7.2_NoLeggos Destro_7.2_NoLeggos chaos_bolt 116858 115290939 383016 23.13 0 993744 60.6 116.0 100.0% 0.0% 0.0% 0.0% 4.82sec 115290939 301.01sec
Destro_7.2_NoLeggos Destro_7.2_NoLeggos conflagrate 17962 48656451 161645 19.24 299963 673790 48.5 96.5 54.6% 0.0% 0.0% 0.0% 6.18sec 48656451 301.01sec
Destro_7.2_NoLeggos Destro_7.2_NoLeggos cry_havoc 243011 11895841 39520 20.95 99364 198659 52.5 105.1 13.9% 0.0% 0.0% 0.0% 5.51sec 11895841 301.01sec
Destro_7.2_NoLeggos Destro_7.2_NoLeggos deadly_grace 188091 1798114 5974 2.88 109266 218418 14.4 14.4 14.0% 0.0% 0.0% 0.0% 2.08sec 1798114 301.01sec
Destro_7.2_NoLeggos Destro_7.2_NoLeggos dimensional_rift 196586 0 0 0.00 0 0 13.0 0.0 0.0% 0.0% 0.0% 0.0% 23.51sec 0 301.01sec
Destro_7.2_NoLeggos Destro_7.2_NoLeggos flask 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 301.01sec
Destro_7.2_NoLeggos Destro_7.2_NoLeggos food 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 301.01sec
Destro_7.2_NoLeggos Destro_7.2_NoLeggos havoc 80240 0 0 0.00 0 0 14.9 0.0 0.0% 0.0% 0.0% 0.0% 20.92sec 0 301.01sec
Destro_7.2_NoLeggos Destro_7.2_NoLeggos immolate 348 9854301 32738 7.73 156956 313861 20.1 38.8 61.9% 0.0% 0.0% 0.0% 15.14sec 90056338 301.01sec
Destro_7.2_NoLeggos Destro_7.2_NoLeggos immolate ticks -348 80202037 267340 58.96 167906 336019 20.1 294.8 61.9% 0.0% 0.0% 0.0% 15.14sec 90056338 301.01sec
Destro_7.2_NoLeggos Destro_7.2_NoLeggos incinerate 29722 43264037 143730 29.12 259852 519636 76.5 146.1 14.0% 0.0% 0.0% 0.0% 3.76sec 43264037 301.01sec
Destro_7.2_NoLeggos Destro_7.2_NoLeggos life_tap 1454 0 0 0.00 0 0 6.8 0.0 0.0% 0.0% 0.0% 0.0% 32.86sec 0 301.01sec
Destro_7.2_NoLeggos Destro_7.2_NoLeggos mark_of_the_hidden_satyr 191259 3025991 10053 3.98 133008 266125 20.0 20.0 13.8% 0.0% 0.0% 0.0% 15.00sec 3025991 301.01sec
Destro_7.2_NoLeggos Destro_7.2_NoLeggos potion 0 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 301.01sec
Destro_7.2_NoLeggos Destro_7.2_NoLeggos service_imp 111859 0 0 0.00 0 0 3.7 0.0 0.0% 0.0% 0.0% 0.0% 91.34sec 0 301.01sec
Destro_7.2_NoLeggos Destro_7.2_NoLeggos soul_harvest 196098 0 0 0.00 0 0 2.9 0.0 0.0% 0.0% 0.0% 0.0% 120.88sec 0 301.01sec
Destro_7.2_NoLeggos Destro_7.2_NoLeggos summon_doomguard 18540 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 301.01sec
Destro_7.2_NoLeggos Destro_7.2_NoLeggos summon_imp 688 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 301.01sec
Destro_7.2_NoLeggos Destro_7.2_NoLeggos summon_infernal 1122 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 301.01sec
Destro_7.2_NoLeggos Destro_7.2_NoLeggos_imp firebolt 3110 14445762 47991 21.59 117013 233987 109.2 108.3 14.0% 0.0% 0.0% 0.0% 2.76sec 14445762 301.01sec
Destro_7.2_NoLeggos Destro_7.2_NoLeggos_service_imp firebolt 3110 13360355 139021 30.66 238675 477322 49.4 49.1 14.0% 0.0% 0.0% 0.0% 5.50sec 13360355 96.10sec
Destro_7.2_NoLeggos Destro_7.2_NoLeggos_infernal immolation ticks -19483 2566299 8554 4.66 48293 96534 1.0 23.3 13.9% 0.0% 0.0% 0.0% 0.00sec 2566299 25.00sec
Destro_7.2_NoLeggos Destro_7.2_NoLeggos_infernal melee 0 727277 29090 52.99 28925 57820 22.1 22.1 13.9% 0.0% 0.0% 0.0% 1.10sec 1069166 25.00sec
Destro_7.2_NoLeggos Destro_7.2_NoLeggos_doomguard doom_bolt 85692 2724538 108977 26.51 216250 432331 11.0 11.0 14.1% 0.0% 0.0% 0.0% 2.19sec 2724538 25.00sec
Destro_7.2_NoLeggos Destro_7.2_NoLeggos_lord_of_flames_infernal immolation ticks -19483 2566008 8553 4.66 48289 96586 1.0 23.3 13.9% 0.0% 0.0% 0.0% 0.00sec 2566008 25.00sec
Destro_7.2_NoLeggos Destro_7.2_NoLeggos_lord_of_flames_infernal melee 0 728121 29124 52.99 28923 57848 22.1 22.1 14.0% 0.0% 0.0% 0.0% 1.10sec 1070406 25.00sec
Destro_7.2_NoLeggos Destro_7.2_NoLeggos_lord_of_flames_infernal immolation ticks -19483 2565502 8552 4.66 48286 96626 1.0 23.3 13.9% 0.0% 0.0% 0.0% 0.00sec 2565502 25.00sec
Destro_7.2_NoLeggos Destro_7.2_NoLeggos_lord_of_flames_infernal melee 0 727499 29099 52.99 28925 57819 22.1 22.1 13.9% 0.0% 0.0% 0.0% 1.10sec 1069493 25.00sec
Destro_7.2_NoLeggos Destro_7.2_NoLeggos_lord_of_flames_infernal immolation ticks -19483 2565629 8552 4.66 48292 96552 1.0 23.3 13.9% 0.0% 0.0% 0.0% 0.00sec 2565629 25.00sec
Destro_7.2_NoLeggos Destro_7.2_NoLeggos_lord_of_flames_infernal melee 0 727154 29085 52.99 28924 57835 22.1 22.1 13.9% 0.0% 0.0% 0.0% 1.10sec 1068985 25.00sec
Destro_7.2_NoLeggos Destro_7.2_NoLeggos_shadowy_tear shadow_bolt ticks -196657 5369189 17897 7.45 127225 254319 3.3 37.3 13.9% 0.0% 0.0% 0.0% 70.21sec 5369189 40.98sec
Destro_7.2_NoLeggos Destro_7.2_NoLeggos_flame_rift searing_bolt 243050 4294276 51345 46.89 65704 0 65.7 65.4 0.0% 0.0% 0.0% 0.0% 2.63sec 23392801 83.64sec
Destro_7.2_NoLeggos Destro_7.2_NoLeggos_flame_rift searing_bolt ticks -243050 19098526 63662 27.87 120340 240481 65.7 139.3 13.9% 0.0% 0.0% 0.0% 2.63sec 23392801 83.64sec
Destro_7.2_NoLeggos Destro_7.2_NoLeggos_chaos_tear chaos_bolt 215279 2468175 154232 12.36 0 748802 3.3 3.3 100.0% 0.0% 0.0% 0.0% 69.00sec 2468175 16.00sec
Destro_7.2_NoLeggos Destro_7.2_NoLeggos_chaos_portal chaos_barrage ticks -187394 4873577 16245 23.77 36134 72283 3.4 118.9 13.9% 0.0% 0.0% 0.0% 70.66sec 4873577 17.65sec
Feretory Feretory augmentation 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 301.01sec
Feretory Feretory berserking 26297 0 0 0.00 0 0 2.1 0.0 0.0% 0.0% 0.0% 0.0% 180.66sec 0 301.01sec
Feretory Feretory chaos_bolt 116858 145531434 483480 28.51 0 1017467 74.5 143.0 100.0% 0.0% 0.0% 0.0% 3.92sec 145531434 301.01sec
Feretory Feretory conflagrate 17962 50222605 166848 19.30 308121 692158 48.7 96.8 54.8% 0.0% 0.0% 0.0% 6.17sec 50222605 301.01sec
Feretory Feretory cry_havoc 243011 15000235 49833 25.98 101010 202066 65.2 130.4 13.9% 0.0% 0.0% 0.0% 4.43sec 15000235 301.01sec
Feretory Feretory deadly_grace 188091 1803193 5991 2.89 109255 218272 14.5 14.5 13.9% 0.0% 0.0% 0.0% 2.05sec 1803193 301.01sec
Feretory Feretory dimensional_rift 196586 0 0 0.00 0 0 12.5 0.0 0.0% 0.0% 0.0% 0.0% 24.49sec 0 301.01sec
Feretory Feretory flask 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 301.01sec
Feretory Feretory food 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 301.01sec
Feretory Feretory havoc 80240 0 0 0.00 0 0 14.9 0.0 0.0% 0.0% 0.0% 0.0% 20.88sec 0 301.01sec
Feretory Feretory immolate 348 10125417 33638 7.76 160585 321270 20.2 38.9 62.0% 0.0% 0.0% 0.0% 15.05sec 91295411 301.01sec
Feretory Feretory immolate ticks -348 81169994 270567 59.13 169536 339163 20.2 295.6 61.9% 0.0% 0.0% 0.0% 15.05sec 91295411 301.01sec
Feretory Feretory incinerate 29722 38762833 128777 25.59 265025 530215 67.3 128.4 13.9% 0.0% 0.0% 0.0% 4.26sec 38762833 301.01sec
Feretory Feretory life_tap 1454 0 0 0.00 0 0 5.0 0.0 0.0% 0.0% 0.0% 0.0% 40.28sec 0 301.01sec
Feretory Feretory mark_of_the_hidden_satyr 191259 3103178 10309 4.02 135009 270107 20.2 20.2 14.0% 0.0% 0.0% 0.0% 14.84sec 3103178 301.01sec
Feretory Feretory potion 0 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 301.01sec
Feretory Feretory service_imp 111859 0 0 0.00 0 0 3.7 0.0 0.0% 0.0% 0.0% 0.0% 91.21sec 0 301.01sec
Feretory Feretory soul_harvest 196098 0 0 0.00 0 0 2.9 0.0 0.0% 0.0% 0.0% 0.0% 120.83sec 0 301.01sec
Feretory Feretory summon_doomguard 18540 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 301.01sec
Feretory Feretory summon_imp 688 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 301.01sec
Feretory Feretory summon_infernal 1122 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 301.01sec
Feretory Feretory_imp firebolt 3110 14701640 48841 21.65 118844 237675 109.4 108.6 13.9% 0.0% 0.0% 0.0% 2.75sec 14701640 301.01sec
Feretory Feretory_service_imp firebolt 3110 13604935 141347 30.69 242363 484447 49.5 49.2 14.0% 0.0% 0.0% 0.0% 5.49sec 13604935 96.25sec
Feretory Feretory_infernal immolation ticks -19483 2614729 8716 4.69 48989 97978 1.0 23.4 13.9% 0.0% 0.0% 0.0% 0.00sec 2614729 25.00sec
Feretory Feretory_infernal melee 0 742721 29708 53.25 29341 58650 22.2 22.2 14.1% 0.0% 0.0% 0.0% 1.10sec 1091870 25.00sec
Feretory Feretory_doomguard doom_bolt 85692 2766588 110659 26.56 219618 438914 11.1 11.1 13.9% 0.0% 0.0% 0.0% 2.19sec 2766588 25.00sec
Feretory Feretory_lord_of_flames_infernal immolation ticks -19483 2617360 8725 4.69 48987 97995 1.0 23.4 14.0% 0.0% 0.0% 0.0% 0.00sec 2617360 25.00sec
Feretory Feretory_lord_of_flames_infernal melee 0 742109 29683 53.25 29336 58711 22.2 22.2 14.0% 0.0% 0.0% 0.0% 1.10sec 1090971 25.00sec
Feretory Feretory_lord_of_flames_infernal immolation ticks -19483 2614830 8716 4.69 48988 97989 1.0 23.4 13.9% 0.0% 0.0% 0.0% 0.00sec 2614830 25.00sec
Feretory Feretory_lord_of_flames_infernal melee 0 742647 29705 53.25 29338 58682 22.2 22.2 14.1% 0.0% 0.0% 0.0% 1.10sec 1091762 25.00sec
Feretory Feretory_lord_of_flames_infernal immolation ticks -19483 2614559 8715 4.69 48986 98012 1.0 23.4 13.9% 0.0% 0.0% 0.0% 0.00sec 2614559 25.00sec
Feretory Feretory_lord_of_flames_infernal melee 0 741533 29660 53.25 29335 58724 22.2 22.2 13.9% 0.0% 0.0% 0.0% 1.10sec 1090124 25.00sec
Feretory Feretory_shadowy_tear shadow_bolt ticks -196657 5319839 17733 7.25 129485 258490 3.2 36.3 13.9% 0.0% 0.0% 0.0% 72.26sec 5319839 39.99sec
Feretory Feretory_flame_rift searing_bolt 243050 4235472 51279 46.09 66752 0 63.8 63.5 0.0% 0.0% 0.0% 0.0% 2.68sec 23099115 82.60sec
Feretory Feretory_flame_rift searing_bolt ticks -243050 18863643 62879 27.06 122335 244852 63.8 135.3 13.9% 0.0% 0.0% 0.0% 2.68sec 23099115 82.60sec
Feretory Feretory_chaos_tear chaos_bolt 215279 2432937 156655 12.35 0 760978 3.2 3.2 100.0% 0.0% 0.0% 0.0% 72.02sec 2432937 15.53sec
Feretory Feretory_chaos_portal chaos_barrage ticks -187394 4813636 16045 23.07 36803 73626 3.2 115.3 13.9% 0.0% 0.0% 0.0% 72.47sec 4813636 17.00sec
KJ_Trinket KJ_Trinket augmentation 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 301.01sec
KJ_Trinket KJ_Trinket berserking 26297 0 0 0.00 0 0 2.1 0.0 0.0% 0.0% 0.0% 0.0% 180.53sec 0 301.01sec
KJ_Trinket KJ_Trinket chaos_bolt 116858 118279237 392943 22.73 0 1037059 59.8 114.1 100.0% 0.0% 0.0% 0.0% 4.87sec 118279237 301.01sec
KJ_Trinket KJ_Trinket conflagrate 17962 49842467 165585 18.98 309520 700584 47.9 95.2 54.7% 0.0% 0.0% 0.0% 6.27sec 49842467 301.01sec
KJ_Trinket KJ_Trinket cry_havoc 243011 12053218 40043 20.36 102530 205222 51.1 102.1 15.1% 0.0% 0.0% 0.0% 5.65sec 12053218 301.01sec
KJ_Trinket KJ_Trinket deadly_grace 188091 1787755 5939 2.83 109231 218382 14.2 14.2 15.1% 0.0% 0.0% 0.0% 2.09sec 1787755 301.01sec
KJ_Trinket KJ_Trinket dimensional_rift 196586 0 0 0.00 0 0 12.8 0.0 0.0% 0.0% 0.0% 0.0% 23.74sec 0 301.01sec
KJ_Trinket KJ_Trinket flask 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 301.01sec
KJ_Trinket KJ_Trinket food 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 301.01sec
KJ_Trinket KJ_Trinket havoc 80240 0 0 0.00 0 0 14.9 0.0 0.0% 0.0% 0.0% 0.0% 20.93sec 0 301.01sec
KJ_Trinket KJ_Trinket immolate 348 10123002 33630 7.64 161966 323825 19.8 38.3 63.1% 0.0% 0.0% 0.0% 15.40sec 91521404 301.01sec
KJ_Trinket KJ_Trinket immolate ticks -348 81398402 271328 58.00 172030 344138 19.8 290.0 63.1% 0.0% 0.0% 0.0% 15.40sec 91521404 301.01sec
KJ_Trinket KJ_Trinket incinerate 29722 43567560 144739 28.12 268425 536639 73.6 141.1 15.1% 0.0% 0.0% 0.0% 3.91sec 43567560 301.01sec
KJ_Trinket KJ_Trinket kiljaedens_burning_wish 235999 7447513 24742 1.77 0 838600 4.5 8.9 100.0% 0.0% 0.0% 0.0% 75.49sec 7447513 301.01sec
KJ_Trinket KJ_Trinket life_tap 1454 0 0 0.00 0 0 6.4 0.0 0.0% 0.0% 0.0% 0.0% 34.77sec 0 301.01sec
KJ_Trinket KJ_Trinket mark_of_the_hidden_satyr 191259 3097124 10289 3.96 135529 271173 19.9 19.9 15.0% 0.0% 0.0% 0.0% 15.09sec 3097124 301.01sec
KJ_Trinket KJ_Trinket potion 0 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 301.01sec
KJ_Trinket KJ_Trinket service_imp 111859 0 0 0.00 0 0 3.7 0.0 0.0% 0.0% 0.0% 0.0% 91.30sec 0 301.01sec
KJ_Trinket KJ_Trinket soul_harvest 196098 0 0 0.00 0 0 2.9 0.0 0.0% 0.0% 0.0% 0.0% 120.95sec 0 301.01sec
KJ_Trinket KJ_Trinket summon_doomguard 18540 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 301.01sec
KJ_Trinket KJ_Trinket summon_imp 688 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 301.01sec
KJ_Trinket KJ_Trinket summon_infernal 1122 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 301.01sec
KJ_Trinket KJ_Trinket_imp firebolt 3110 14647744 48662 21.28 119233 238496 107.6 106.8 15.1% 0.0% 0.0% 0.0% 2.80sec 14647744 301.01sec
KJ_Trinket KJ_Trinket_service_imp firebolt 3110 13450918 139933 30.01 243081 486155 48.4 48.1 15.1% 0.0% 0.0% 0.0% 5.61sec 13450918 96.12sec
KJ_Trinket KJ_Trinket_infernal immolation ticks -19483 2608095 8694 4.63 49033 98065 1.0 23.1 15.0% 0.0% 0.0% 0.0% 0.00sec 2608095 25.00sec
KJ_Trinket KJ_Trinket_infernal melee 0 741972 29678 52.80 29319 58648 22.0 22.0 15.0% 0.0% 0.0% 0.0% 1.12sec 1090770 25.00sec
KJ_Trinket KJ_Trinket_doomguard doom_bolt 85692 2673006 106916 25.31 220565 440878 10.5 10.5 14.9% 0.0% 0.0% 0.0% 2.22sec 2673006 25.00sec
KJ_Trinket KJ_Trinket_lord_of_flames_infernal immolation ticks -19483 2608123 8694 4.63 49031 98089 1.0 23.1 15.0% 0.0% 0.0% 0.0% 0.00sec 2608123 25.00sec
KJ_Trinket KJ_Trinket_lord_of_flames_infernal melee 0 742070 29682 52.80 29317 58672 22.0 22.0 15.0% 0.0% 0.0% 0.0% 1.12sec 1090914 25.00sec
KJ_Trinket KJ_Trinket_lord_of_flames_infernal immolation ticks -19483 2609277 8698 4.63 49030 98096 1.0 23.1 15.0% 0.0% 0.0% 0.0% 0.00sec 2609277 25.00sec
KJ_Trinket KJ_Trinket_lord_of_flames_infernal melee 0 743063 29721 52.80 29320 58637 22.0 22.0 15.2% 0.0% 0.0% 0.0% 1.12sec 1092373 25.00sec
KJ_Trinket KJ_Trinket_lord_of_flames_infernal immolation ticks -19483 2611741 8706 4.63 49034 98054 1.0 23.1 15.2% 0.0% 0.0% 0.0% 0.00sec 2611741 25.00sec
KJ_Trinket KJ_Trinket_lord_of_flames_infernal melee 0 742517 29699 52.80 29320 58630 22.0 22.0 15.1% 0.0% 0.0% 0.0% 1.12sec 1091570 25.00sec
KJ_Trinket KJ_Trinket_shadowy_tear shadow_bolt ticks -196657 5390532 17968 7.31 128773 258117 3.3 36.5 15.1% 0.0% 0.0% 0.0% 71.50sec 5390532 40.51sec
KJ_Trinket KJ_Trinket_flame_rift searing_bolt 243050 4357747 52167 46.75 66956 0 65.5 65.1 0.0% 0.0% 0.0% 0.0% 2.66sec 23936068 83.53sec
KJ_Trinket KJ_Trinket_flame_rift searing_bolt ticks -243050 19578321 65261 27.75 122617 245175 65.5 138.8 15.1% 0.0% 0.0% 0.0% 2.66sec 23936068 83.53sec
KJ_Trinket KJ_Trinket_chaos_tear chaos_bolt 215279 2527451 159044 12.37 0 771549 3.3 3.3 100.0% 0.0% 0.0% 0.0% 69.79sec 2527451 15.89sec
KJ_Trinket KJ_Trinket_chaos_portal chaos_barrage ticks -187394 4892113 16307 23.03 37064 74133 3.3 115.2 15.1% 0.0% 0.0% 0.0% 70.83sec 4892113 17.47sec
Magistrike Magistrike augmentation 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 301.01sec
Magistrike Magistrike berserking 26297 0 0 0.00 0 0 2.1 0.0 0.0% 0.0% 0.0% 0.0% 180.57sec 0 301.01sec
Magistrike Magistrike chaos_bolt 116858 117956820 391872 22.92 0 1025828 60.2 115.0 100.0% 0.0% 0.0% 0.0% 4.84sec 117956820 301.01sec
Magistrike Magistrike chaos_bolt_magistrike 213229 21641371 71896 4.58 0 942467 0.0 23.0 100.0% 0.0% 0.0% 0.0% 0.00sec 21641371 301.01sec
Magistrike Magistrike conflagrate 17962 49464228 164328 19.02 304709 692443 48.0 95.4 55.1% 0.0% 0.0% 0.0% 6.26sec 49464228 301.01sec
Magistrike Magistrike cry_havoc 243011 12086727 40154 20.63 100955 201809 51.8 103.5 15.7% 0.0% 0.0% 0.0% 5.57sec 12086727 301.01sec
Magistrike Magistrike deadly_grace 188091 1791250 5951 2.84 108686 217342 14.3 14.3 15.5% 0.0% 0.0% 0.0% 2.08sec 1791250 301.01sec
Magistrike Magistrike dimensional_rift 196586 0 0 0.00 0 0 12.9 0.0 0.0% 0.0% 0.0% 0.0% 23.78sec 0 301.01sec
Magistrike Magistrike flask 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 301.01sec
Magistrike Magistrike food 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 301.01sec
Magistrike Magistrike havoc 80240 0 0 0.00 0 0 14.9 0.0 0.0% 0.0% 0.0% 0.0% 20.93sec 0 301.01sec
Magistrike Magistrike immolate 348 10013482 33266 7.65 159295 318579 19.8 38.4 63.7% 0.0% 0.0% 0.0% 15.35sec 90694160 301.01sec
Magistrike Magistrike immolate ticks -348 80680677 268936 58.14 169538 339306 19.8 290.7 63.6% 0.0% 0.0% 0.0% 15.35sec 90694160 301.01sec
Magistrike Magistrike incinerate 29722 43555713 144699 28.42 264177 528564 74.5 142.6 15.6% 0.0% 0.0% 0.0% 3.86sec 43555713 301.01sec
Magistrike Magistrike life_tap 1454 0 0 0.00 0 0 6.5 0.0 0.0% 0.0% 0.0% 0.0% 33.99sec 0 301.01sec
Magistrike Magistrike mark_of_the_hidden_satyr 191259 3058965 10162 3.94 133746 267504 19.8 19.8 15.6% 0.0% 0.0% 0.0% 15.21sec 3058965 301.01sec
Magistrike Magistrike potion 0 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 301.01sec
Magistrike Magistrike service_imp 111859 0 0 0.00 0 0 3.7 0.0 0.0% 0.0% 0.0% 0.0% 91.43sec 0 301.01sec
Magistrike Magistrike soul_harvest 196098 0 0 0.00 0 0 2.9 0.0 0.0% 0.0% 0.0% 0.0% 120.93sec 0 301.01sec
Magistrike Magistrike summon_doomguard 18540 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 301.01sec
Magistrike Magistrike summon_imp 688 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 301.01sec
Magistrike Magistrike summon_infernal 1122 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 301.01sec
Magistrike Magistrike_imp firebolt 3110 14574909 48420 21.33 117695 235383 107.8 107.0 15.7% 0.0% 0.0% 0.0% 2.79sec 14574909 301.01sec
Magistrike Magistrike_service_imp firebolt 3110 13462991 140128 30.27 240030 480128 48.7 48.5 15.7% 0.0% 0.0% 0.0% 5.57sec 13462991 96.08sec
Magistrike Magistrike_infernal immolation ticks -19483 2593964 8647 4.62 48459 96914 1.0 23.1 15.8% 0.0% 0.0% 0.0% 0.00sec 2593964 25.00sec
Magistrike Magistrike_infernal melee 0 736974 29478 52.80 28995 57951 22.0 22.0 15.6% 0.0% 0.0% 0.0% 1.12sec 1083421 25.00sec
Magistrike Magistrike_doomguard doom_bolt 85692 2693152 107724 25.72 217530 435368 10.7 10.7 15.5% 0.0% 0.0% 0.0% 2.21sec 2693152 25.00sec
Magistrike Magistrike_lord_of_flames_infernal immolation ticks -19483 2591712 8639 4.62 48458 96921 1.0 23.1 15.7% 0.0% 0.0% 0.0% 0.00sec 2591712 25.00sec
Magistrike Magistrike_lord_of_flames_infernal melee 0 737748 29509 52.80 28993 57967 22.0 22.0 15.7% 0.0% 0.0% 0.0% 1.12sec 1084559 25.00sec
Magistrike Magistrike_lord_of_flames_infernal immolation ticks -19483 2594428 8648 4.62 48458 96915 1.0 23.1 15.8% 0.0% 0.0% 0.0% 0.00sec 2594428 25.00sec
Magistrike Magistrike_lord_of_flames_infernal melee 0 737608 29503 52.80 28995 57949 22.0 22.0 15.7% 0.0% 0.0% 0.0% 1.12sec 1084354 25.00sec
Magistrike Magistrike_lord_of_flames_infernal immolation ticks -19483 2591932 8640 4.62 48459 96909 1.0 23.1 15.7% 0.0% 0.0% 0.0% 0.00sec 2591932 25.00sec
Magistrike Magistrike_lord_of_flames_infernal melee 0 739075 29562 52.80 28990 58008 22.0 22.0 15.9% 0.0% 0.0% 0.0% 1.12sec 1086510 25.00sec
Magistrike Magistrike_shadowy_tear shadow_bolt ticks -196657 5392958 17977 7.37 127331 254411 3.3 36.8 15.7% 0.0% 0.0% 0.0% 70.55sec 5392958 40.90sec
Magistrike Magistrike_flame_rift searing_bolt 243050 4308293 51500 46.73 66123 0 65.5 65.2 0.0% 0.0% 0.0% 0.0% 2.67sec 23752855 83.66sec
Magistrike Magistrike_flame_rift searing_bolt ticks -243050 19444562 64815 27.79 120989 241802 65.5 139.0 15.7% 0.0% 0.0% 0.0% 2.67sec 23752855 83.66sec
Magistrike Magistrike_chaos_tear chaos_bolt 215279 2501698 157504 12.37 0 764252 3.3 3.3 100.0% 0.0% 0.0% 0.0% 70.90sec 2501698 15.88sec
Magistrike Magistrike_chaos_portal chaos_barrage ticks -187394 4848811 16163 23.16 36357 72727 3.3 115.8 15.6% 0.0% 0.0% 0.0% 70.41sec 4848811 17.43sec
Meme_Build Meme_Build augmentation 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 301.01sec
Meme_Build Meme_Build berserking 26297 0 0 0.00 0 0 2.1 0.0 0.0% 0.0% 0.0% 0.0% 181.01sec 0 301.01sec
Meme_Build Meme_Build chaos_bolt 116858 126446591 420077 25.06 0 1005964 94.3 125.7 100.0% 0.0% 0.0% 0.0% 3.11sec 126446591 301.01sec
Meme_Build Meme_Build conflagrate 17962 35926052 119352 13.81 305093 689417 48.9 69.3 55.6% 0.0% 0.0% 0.0% 6.15sec 35926052 301.01sec
Meme_Build Meme_Build cry_havoc 243011 4522596 15025 7.94 99618 199077 19.9 39.8 14.0% 0.0% 0.0% 0.0% 13.86sec 4522596 301.01sec
Meme_Build Meme_Build deadly_grace 188091 1851338 6150 2.96 109378 218626 14.9 14.9 13.8% 0.0% 0.0% 0.0% 2.03sec 1851338 301.01sec
Meme_Build Meme_Build dimensional_rift 196586 0 0 0.00 0 0 12.5 0.0 0.0% 0.0% 0.0% 0.0% 24.43sec 0 301.01sec
Meme_Build Meme_Build flask 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 301.01sec
Meme_Build Meme_Build food 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 301.01sec
Meme_Build Meme_Build havoc 80240 0 0 0.00 0 0 15.0 0.0 0.0% 0.0% 0.0% 0.0% 20.70sec 0 301.01sec
Meme_Build Meme_Build immolate 348 8758837 29098 6.82 158211 316390 27.9 34.2 61.9% 0.0% 0.0% 0.0% 10.81sec 48183807 301.01sec
Meme_Build Meme_Build immolate ticks -348 39424970 131417 58.89 82661 165304 27.9 294.4 62.0% 0.0% 0.0% 0.0% 10.81sec 48183807 301.01sec
Meme_Build Meme_Build incinerate 29722 25777799 85638 17.31 260659 521425 68.1 86.8 13.9% 0.0% 0.0% 0.0% 4.25sec 25777799 301.01sec
Meme_Build Meme_Build life_tap 1454 0 0 0.00 0 0 6.8 0.0 0.0% 0.0% 0.0% 0.0% 32.00sec 0 301.01sec
Meme_Build Meme_Build mark_of_the_hidden_satyr 191259 3094336 10280 4.01 135010 270165 20.1 20.1 13.8% 0.0% 0.0% 0.0% 14.94sec 3094336 301.01sec
Meme_Build Meme_Build potion 0 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 301.01sec
Meme_Build Meme_Build service_imp 111859 0 0 0.00 0 0 3.7 0.0 0.0% 0.0% 0.0% 0.0% 90.69sec 0 301.01sec
Meme_Build Meme_Build soul_harvest 196098 0 0 0.00 0 0 2.9 0.0 0.0% 0.0% 0.0% 0.0% 120.58sec 0 301.01sec
Meme_Build Meme_Build summon_doomguard 18540 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 301.01sec
Meme_Build Meme_Build summon_imp 688 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 301.01sec
Meme_Build Meme_Build summon_infernal 1122 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 301.01sec
Meme_Build Meme_Build_imp firebolt 3110 14754382 49016 21.65 119216 238445 109.5 108.6 13.9% 0.0% 0.0% 0.0% 2.75sec 14754382 301.01sec
Meme_Build Meme_Build_service_imp firebolt 3110 13710706 141609 30.68 243016 486406 49.8 49.5 13.9% 0.0% 0.0% 0.0% 5.48sec 13710706 96.82sec
Meme_Build Meme_Build_infernal immolation ticks -19483 2630750 8769 4.71 49061 98105 1.0 23.5 13.9% 0.0% 0.0% 0.0% 0.00sec 2630750 25.00sec
Meme_Build Meme_Build_infernal melee 0 745040 29800 53.44 29379 58756 22.3 22.3 13.9% 0.0% 0.0% 0.0% 1.09sec 1095280 25.00sec
Meme_Build Meme_Build_doomguard doom_bolt 85692 2765913 110632 26.58 219504 438727 11.1 11.1 13.8% 0.0% 0.0% 0.0% 2.18sec 2765913 25.00sec
Meme_Build Meme_Build_lord_of_flames_infernal immolation ticks -19483 2630623 8769 4.71 49057 98154 1.0 23.5 13.9% 0.0% 0.0% 0.0% 0.00sec 2630623 25.00sec
Meme_Build Meme_Build_lord_of_flames_infernal melee 0 745282 29810 53.44 29381 58730 22.3 22.3 13.9% 0.0% 0.0% 0.0% 1.09sec 1095635 25.00sec
Meme_Build Meme_Build_lord_of_flames_infernal immolation ticks -19483 2632768 8776 4.71 49060 98115 1.0 23.5 14.0% 0.0% 0.0% 0.0% 0.00sec 2632768 25.00sec
Meme_Build Meme_Build_lord_of_flames_infernal melee 0 745507 29819 53.44 29380 58747 22.3 22.3 14.0% 0.0% 0.0% 0.0% 1.09sec 1095965 25.00sec
Meme_Build Meme_Build_lord_of_flames_infernal immolation ticks -19483 2629912 8766 4.71 49063 98076 1.0 23.5 13.9% 0.0% 0.0% 0.0% 0.00sec 2629912 25.00sec
Meme_Build Meme_Build_lord_of_flames_infernal melee 0 745290 29810 53.44 29378 58771 22.3 22.3 13.9% 0.0% 0.0% 0.0% 1.09sec 1095646 25.00sec
Meme_Build Meme_Build_shadowy_tear shadow_bolt ticks -196657 5295878 17653 7.20 129674 259523 3.2 36.0 14.0% 0.0% 0.0% 0.0% 73.31sec 5295878 39.59sec
Meme_Build Meme_Build_flame_rift searing_bolt 243050 4247719 51308 46.04 66864 0 63.9 63.5 0.0% 0.0% 0.0% 0.0% 2.70sec 23131622 82.79sec
Meme_Build Meme_Build_flame_rift searing_bolt ticks -243050 18883903 62946 27.05 122509 244884 63.9 135.3 14.0% 0.0% 0.0% 0.0% 2.70sec 23131622 82.79sec
Meme_Build Meme_Build_chaos_tear chaos_bolt 215279 2449342 161347 12.72 0 760921 3.2 3.2 100.0% 0.0% 0.0% 0.0% 72.20sec 2449342 15.18sec
Meme_Build Meme_Build_chaos_portal chaos_barrage ticks -187394 4875033 16250 23.24 36988 73930 3.2 116.2 14.0% 0.0% 0.0% 0.0% 72.33sec 4875033 16.64sec
Norgannon's Norgannon's augmentation 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 301.01sec
Norgannon's Norgannon's berserking 26297 0 0 0.00 0 0 2.1 0.0 0.0% 0.0% 0.0% 0.0% 180.74sec 0 301.01sec
Norgannon's Norgannon's chaos_bolt 116858 118867931 394899 23.56 0 1005608 61.5 118.2 100.0% 0.0% 0.0% 0.0% 4.75sec 118867931 301.01sec
Norgannon's Norgannon's conflagrate 17962 50017124 166165 19.48 305106 682889 49.2 97.8 54.7% 0.0% 0.0% 0.0% 6.10sec 50017124 301.01sec
Norgannon's Norgannon's cry_havoc 243011 12328575 40958 21.45 101056 202042 53.8 107.6 13.4% 0.0% 0.0% 0.0% 5.39sec 12328575 301.01sec
Norgannon's Norgannon's deadly_grace 188091 1817711 6039 2.93 109175 218630 14.7 14.7 13.3% 0.0% 0.0% 0.0% 2.03sec 1817711 301.01sec
Norgannon's Norgannon's dimensional_rift 196586 0 0 0.00 0 0 13.1 0.0 0.0% 0.0% 0.0% 0.0% 23.26sec 0 301.01sec
Norgannon's Norgannon's flask 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 301.01sec
Norgannon's Norgannon's food 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 301.01sec
Norgannon's Norgannon's havoc 80240 0 0 0.00 0 0 14.9 0.0 0.0% 0.0% 0.0% 0.0% 20.90sec 0 301.01sec
Norgannon's Norgannon's immolate 348 10051449 33393 7.79 159478 318967 20.3 39.1 61.4% 0.0% 0.0% 0.0% 14.93sec 93390739 301.01sec
Norgannon's Norgannon's immolate ticks -348 83339290 277798 60.03 172158 344117 20.3 300.2 61.3% 0.0% 0.0% 0.0% 14.93sec 93390739 301.01sec
Norgannon's Norgannon's incinerate 29722 44794601 148815 29.82 264116 528533 78.5 149.6 13.3% 0.0% 0.0% 0.0% 3.67sec 44794601 301.01sec
Norgannon's Norgannon's life_tap 1454 0 0 0.00 0 0 7.0 0.0 0.0% 0.0% 0.0% 0.0% 32.14sec 0 301.01sec
Norgannon's Norgannon's mark_of_the_hidden_satyr 191259 3109625 10331 4.06 134507 269245 20.4 20.4 13.4% 0.0% 0.0% 0.0% 14.73sec 3109625 301.01sec
Norgannon's Norgannon's potion 0 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 301.01sec
Norgannon's Norgannon's service_imp 111859 0 0 0.00 0 0 3.7 0.0 0.0% 0.0% 0.0% 0.0% 91.52sec 0 301.01sec
Norgannon's Norgannon's soul_harvest 196098 0 0 0.00 0 0 2.9 0.0 0.0% 0.0% 0.0% 0.0% 121.06sec 0 301.01sec
Norgannon's Norgannon's summon_doomguard 18540 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 301.01sec
Norgannon's Norgannon's summon_imp 688 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 301.01sec
Norgannon's Norgannon's summon_infernal 1122 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 301.01sec
Norgannon's Norgannon's_imp firebolt 3110 14766615 49057 21.93 118408 236849 110.9 110.0 13.3% 0.0% 0.0% 0.0% 2.71sec 14766615 301.01sec
Norgannon's Norgannon's_service_imp firebolt 3110 13478661 140386 30.73 241929 483987 49.5 49.2 13.3% 0.0% 0.0% 0.0% 5.49sec 13478661 96.01sec
Norgannon's Norgannon's_infernal immolation ticks -19483 2647449 8825 4.79 48782 97570 1.0 23.9 13.4% 0.0% 0.0% 0.0% 0.00sec 2647449 25.00sec
Norgannon's Norgannon's_infernal melee 0 753816 30151 54.72 29188 58385 22.8 22.8 13.3% 0.0% 0.0% 0.0% 1.08sec 1108181 25.00sec
Norgannon's Norgannon's_doomguard doom_bolt 85692 2775845 111032 26.85 218861 437845 11.2 11.2 13.4% 0.0% 0.0% 0.0% 2.16sec 2775845 25.00sec
Norgannon's Norgannon's_lord_of_flames_infernal immolation ticks -19483 2645626 8819 4.79 48782 97562 1.0 23.9 13.3% 0.0% 0.0% 0.0% 0.00sec 2645626 25.00sec
Norgannon's Norgannon's_lord_of_flames_infernal melee 0 754555 30181 54.72 29188 58387 22.8 22.8 13.4% 0.0% 0.0% 0.0% 1.08sec 1109267 25.00sec
Norgannon's Norgannon's_lord_of_flames_infernal immolation ticks -19483 2648054 8827 4.79 48781 97581 1.0 23.9 13.4% 0.0% 0.0% 0.0% 0.00sec 2648054 25.00sec
Norgannon's Norgannon's_lord_of_flames_infernal melee 0 754945 30197 54.72 29191 58356 22.8 22.8 13.4% 0.0% 0.0% 0.0% 1.08sec 1109841 25.00sec
Norgannon's Norgannon's_lord_of_flames_infernal immolation ticks -19483 2646776 8823 4.79 48780 97597 1.0 23.9 13.3% 0.0% 0.0% 0.0% 0.00sec 2646776 25.00sec
Norgannon's Norgannon's_lord_of_flames_infernal melee 0 753825 30152 54.72 29189 58378 22.8 22.8 13.3% 0.0% 0.0% 0.0% 1.08sec 1108195 25.00sec
Norgannon's Norgannon's_shadowy_tear shadow_bolt ticks -196657 5555421 18518 7.63 129283 258491 3.4 38.1 13.3% 0.0% 0.0% 0.0% 69.72sec 5555421 41.74sec
Norgannon's Norgannon's_flame_rift searing_bolt 243050 4423076 52006 46.92 66500 0 66.9 66.5 0.0% 0.0% 0.0% 0.0% 2.63sec 23966581 85.05sec
Norgannon's Norgannon's_flame_rift searing_bolt ticks -243050 19543505 65145 28.27 122032 244163 66.9 141.4 13.3% 0.0% 0.0% 0.0% 2.63sec 23966581 85.05sec
Norgannon's Norgannon's_chaos_tear chaos_bolt 215279 2500878 155156 12.35 0 753689 3.3 3.3 100.0% 0.0% 0.0% 0.0% 69.84sec 2500878 16.12sec
Norgannon's Norgannon's_chaos_portal chaos_barrage ticks -187394 4980916 16603 24.11 36632 73210 3.4 120.5 13.3% 0.0% 0.0% 0.0% 69.67sec 4980916 17.62sec
Portal_Pants Portal_Pants augmentation 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 301.01sec
Portal_Pants Portal_Pants berserking 26297 0 0 0.00 0 0 2.1 0.0 0.0% 0.0% 0.0% 0.0% 180.57sec 0 301.01sec
Portal_Pants Portal_Pants chaos_bolt 116858 121852715 404815 22.64 0 1072925 59.5 113.6 100.0% 0.0% 0.0% 0.0% 4.91sec 121852715 301.01sec
Portal_Pants Portal_Pants conflagrate 17962 51051772 169602 18.85 317775 723045 47.5 94.6 54.8% 0.0% 0.0% 0.0% 6.32sec 51051772 301.01sec
Portal_Pants Portal_Pants cry_havoc 243011 12467249 41418 20.35 105383 210627 51.0 102.1 15.9% 0.0% 0.0% 0.0% 5.66sec 12467249 301.01sec
Portal_Pants Portal_Pants deadly_grace 188091 1784668 5929 2.81 109267 218251 14.1 14.1 15.7% 0.0% 0.0% 0.0% 2.10sec 1784668 301.01sec
Portal_Pants Portal_Pants dimensional_rift 196586 0 0 0.00 0 0 12.8 0.0 0.0% 0.0% 0.0% 0.0% 23.91sec 0 301.01sec
Portal_Pants Portal_Pants flask 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 301.01sec
Portal_Pants Portal_Pants food 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 301.01sec
Portal_Pants Portal_Pants havoc 80240 0 0 0.00 0 0 14.9 0.0 0.0% 0.0% 0.0% 0.0% 20.92sec 0 301.01sec
Portal_Pants Portal_Pants immolate 348 10375726 34470 7.59 166302 332426 19.7 38.1 63.8% 0.0% 0.0% 0.0% 15.52sec 93412681 301.01sec
Portal_Pants Portal_Pants immolate ticks -348 83036955 276790 57.51 176242 352419 19.7 287.5 63.9% 0.0% 0.0% 0.0% 15.52sec 93412681 301.01sec
Portal_Pants Portal_Pants incinerate 29722 45014882 149547 28.06 275931 551944 73.4 140.8 15.9% 0.0% 0.0% 0.0% 3.92sec 45014882 301.01sec
Portal_Pants Portal_Pants life_tap 1454 0 0 0.00 0 0 6.4 0.0 0.0% 0.0% 0.0% 0.0% 34.38sec 0 301.01sec
Portal_Pants Portal_Pants mark_of_the_hidden_satyr 191259 3087053 10256 3.90 136006 271869 19.6 19.6 15.9% 0.0% 0.0% 0.0% 15.31sec 3087053 301.01sec
Portal_Pants Portal_Pants potion 0 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 301.01sec
Portal_Pants Portal_Pants service_imp 111859 0 0 0.00 0 0 3.7 0.0 0.0% 0.0% 0.0% 0.0% 91.33sec 0 301.01sec
Portal_Pants Portal_Pants soul_harvest 196098 0 0 0.00 0 0 2.9 0.0 0.0% 0.0% 0.0% 0.0% 120.87sec 0 301.01sec
Portal_Pants Portal_Pants summon_doomguard 18540 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 301.01sec
Portal_Pants Portal_Pants summon_imp 688 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 301.01sec
Portal_Pants Portal_Pants summon_infernal 1122 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 301.01sec
Portal_Pants Portal_Pants_imp firebolt 3110 14660797 48706 21.09 119568 239116 106.6 105.8 15.9% 0.0% 0.0% 0.0% 2.82sec 14660797 301.01sec
Portal_Pants Portal_Pants_service_imp firebolt 3110 13525477 140773 29.83 244211 488117 48.1 47.8 15.9% 0.0% 0.0% 0.0% 5.65sec 13525477 96.08sec
Portal_Pants Portal_Pants_infernal immolation ticks -19483 2622235 8741 4.59 49221 98444 1.0 23.0 15.9% 0.0% 0.0% 0.0% 0.00sec 2622235 25.00sec
Portal_Pants Portal_Pants_infernal melee 0 746505 29859 52.49 29435 58908 21.9 21.9 15.9% 0.0% 0.0% 0.0% 1.13sec 1097433 25.00sec
Portal_Pants Portal_Pants_doomguard doom_bolt 85692 2702455 108095 25.26 221279 442563 10.5 10.5 16.0% 0.0% 0.0% 0.0% 2.24sec 2702455 25.00sec
Portal_Pants Portal_Pants_lord_of_flames_infernal immolation ticks -19483 2622512 8742 4.59 49224 98411 1.0 23.0 16.0% 0.0% 0.0% 0.0% 0.00sec 2622512 25.00sec
Portal_Pants Portal_Pants_lord_of_flames_infernal melee 0 746708 29867 52.49 29436 58895 21.9 21.9 16.0% 0.0% 0.0% 0.0% 1.13sec 1097732 25.00sec
Portal_Pants Portal_Pants_lord_of_flames_infernal immolation ticks -19483 2622280 8741 4.59 49225 98399 1.0 23.0 16.0% 0.0% 0.0% 0.0% 0.00sec 2622280 25.00sec
Portal_Pants Portal_Pants_lord_of_flames_infernal melee 0 745748 29829 52.49 29438 58875 21.9 21.9 15.8% 0.0% 0.0% 0.0% 1.13sec 1096320 25.00sec
Portal_Pants Portal_Pants_lord_of_flames_infernal immolation ticks -19483 2621176 8737 4.59 49217 98484 1.0 23.0 15.9% 0.0% 0.0% 0.0% 0.00sec 2621176 25.00sec
Portal_Pants Portal_Pants_lord_of_flames_infernal melee 0 745217 29807 52.49 29439 58858 21.9 21.9 15.8% 0.0% 0.0% 0.0% 1.13sec 1095539 25.00sec
Portal_Pants Portal_Pants_shadowy_tear shadow_bolt ticks -196657 5404752 18016 7.27 128998 258011 3.3 36.4 15.9% 0.0% 0.0% 0.0% 70.76sec 5404752 40.72sec
Portal_Pants Portal_Pants_flame_rift searing_bolt 243050 4365332 52112 46.53 67193 0 65.3 65.0 0.0% 0.0% 0.0% 0.0% 2.63sec 24161939 83.77sec
Portal_Pants Portal_Pants_flame_rift searing_bolt ticks -243050 19796606 65989 27.77 122958 245965 65.3 138.9 15.9% 0.0% 0.0% 0.0% 2.63sec 24161939 83.77sec
Portal_Pants Portal_Pants_chaos_tear chaos_bolt 215279 2533995 160506 12.35 0 779734 3.3 3.2 100.0% 0.0% 0.0% 0.0% 70.62sec 2533995 15.79sec
Portal_Pants Portal_Pants_chaos_portal chaos_barrage ticks -187394 4896020 16320 22.95 36969 73867 3.3 114.7 15.9% 0.0% 0.0% 0.0% 70.60sec 4896020 17.41sec
Prydaz Prydaz augmentation 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 301.01sec
Prydaz Prydaz berserking 26297 0 0 0.00 0 0 2.1 0.0 0.0% 0.0% 0.0% 0.0% 180.57sec 0 301.01sec
Prydaz Prydaz chaos_bolt 116858 120598842 400649 22.93 0 1048166 60.3 115.1 100.0% 0.0% 0.0% 0.0% 4.85sec 120598842 301.01sec
Prydaz Prydaz conflagrate 17962 50671733 168340 19.07 312333 708136 48.1 95.7 54.9% 0.0% 0.0% 0.0% 6.24sec 50671733 301.01sec
Prydaz Prydaz cry_havoc 243011 12388910 41158 20.67 103495 207022 51.9 103.7 15.4% 0.0% 0.0% 0.0% 5.58sec 12388910 301.01sec
Prydaz Prydaz deadly_grace 188091 1800188 5981 2.85 109289 218658 14.3 14.3 15.2% 0.0% 0.0% 0.0% 2.08sec 1800188 301.01sec
Prydaz Prydaz dimensional_rift 196586 0 0 0.00 0 0 12.9 0.0 0.0% 0.0% 0.0% 0.0% 23.72sec 0 301.01sec
Prydaz Prydaz flask 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 301.01sec
Prydaz Prydaz food 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 301.01sec
Prydaz Prydaz havoc 80240 0 0 0.00 0 0 14.9 0.0 0.0% 0.0% 0.0% 0.0% 20.94sec 0 301.01sec
Prydaz Prydaz immolate 348 10272751 34128 7.67 163259 326754 19.9 38.5 63.4% 0.0% 0.0% 0.0% 15.33sec 93192396 301.01sec
Prydaz Prydaz immolate ticks -348 82919645 276399 58.29 174093 348341 19.9 291.5 63.4% 0.0% 0.0% 0.0% 15.33sec 93192396 301.01sec
Prydaz Prydaz incinerate 29722 44752519 148675 28.54 270820 541992 74.9 143.2 15.4% 0.0% 0.0% 0.0% 3.84sec 44752519 301.01sec
Prydaz Prydaz life_tap 1454 0 0 0.00 0 0 6.6 0.0 0.0% 0.0% 0.0% 0.0% 33.88sec 0 301.01sec
Prydaz Prydaz mark_of_the_hidden_satyr 191259 3035748 10085 3.94 133007 265976 19.8 19.8 15.3% 0.0% 0.0% 0.0% 15.11sec 3035748 301.01sec
Prydaz Prydaz potion 0 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 301.01sec
Prydaz Prydaz service_imp 111859 0 0 0.00 0 0 3.7 0.0 0.0% 0.0% 0.0% 0.0% 91.33sec 0 301.01sec
Prydaz Prydaz soul_harvest 196098 0 0 0.00 0 0 2.9 0.0 0.0% 0.0% 0.0% 0.0% 120.97sec 0 301.01sec
Prydaz Prydaz summon_doomguard 18540 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 301.01sec
Prydaz Prydaz summon_imp 688 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 301.01sec
Prydaz Prydaz summon_infernal 1122 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 301.01sec
Prydaz Prydaz_imp firebolt 3110 14487887 48131 21.38 117028 234063 108.1 107.3 15.4% 0.0% 0.0% 0.0% 2.78sec 14487887 301.01sec
Prydaz Prydaz_service_imp firebolt 3110 13395794 139396 30.37 238657 477483 48.9 48.6 15.4% 0.0% 0.0% 0.0% 5.55sec 13395794 96.10sec
Prydaz Prydaz_infernal immolation ticks -19483 2576470 8588 4.63 48219 96432 1.0 23.2 15.4% 0.0% 0.0% 0.0% 0.00sec 2576470 25.00sec
Prydaz Prydaz_infernal melee 0 732805 29311 52.81 28862 57673 22.0 22.0 15.4% 0.0% 0.0% 0.0% 1.11sec 1077293 25.00sec
Prydaz Prydaz_doomguard doom_bolt 85692 2687715 107506 25.87 216323 432611 10.8 10.8 15.3% 0.0% 0.0% 0.0% 2.21sec 2687715 25.00sec
Prydaz Prydaz_lord_of_flames_infernal immolation ticks -19483 2575946 8586 4.63 48220 96415 1.0 23.2 15.3% 0.0% 0.0% 0.0% 0.00sec 2575946 25.00sec
Prydaz Prydaz_lord_of_flames_infernal melee 0 732927 29316 52.81 28860 57695 22.0 22.0 15.4% 0.0% 0.0% 0.0% 1.11sec 1077471 25.00sec
Prydaz Prydaz_lord_of_flames_infernal immolation ticks -19483 2577882 8593 4.63 48219 96426 1.0 23.2 15.4% 0.0% 0.0% 0.0% 0.00sec 2577882 25.00sec
Prydaz Prydaz_lord_of_flames_infernal melee 0 732322 29292 52.81 28856 57738 22.0 22.0 15.3% 0.0% 0.0% 0.0% 1.11sec 1076582 25.00sec
Prydaz Prydaz_lord_of_flames_infernal immolation ticks -19483 2577185 8591 4.63 48217 96456 1.0 23.2 15.4% 0.0% 0.0% 0.0% 0.00sec 2577185 25.00sec
Prydaz Prydaz_lord_of_flames_infernal melee 0 733223 29328 52.81 28855 57745 22.0 22.0 15.5% 0.0% 0.0% 0.0% 1.11sec 1077907 25.00sec
Prydaz Prydaz_shadowy_tear shadow_bolt ticks -196657 5355153 17851 7.37 126505 253229 3.3 36.9 15.4% 0.0% 0.0% 0.0% 68.94sec 5355153 40.87sec
Prydaz Prydaz_flame_rift searing_bolt 243050 4279766 51031 46.61 65693 0 65.5 65.1 0.0% 0.0% 0.0% 0.0% 2.63sec 23562108 83.87sec
Prydaz Prydaz_flame_rift searing_bolt ticks -243050 19282342 64274 27.81 120243 240464 65.5 139.0 15.3% 0.0% 0.0% 0.0% 2.63sec 23562108 83.87sec
Prydaz Prydaz_chaos_tear chaos_bolt 215279 2497058 156387 12.37 0 758671 3.3 3.3 100.0% 0.0% 0.0% 0.0% 71.11sec 2497058 15.97sec
Prydaz Prydaz_chaos_portal chaos_barrage ticks -187394 4850807 16169 23.35 36171 72332 3.3 116.7 15.4% 0.0% 0.0% 0.0% 71.80sec 4850807 17.52sec
Sephuz Sephuz augmentation 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 301.01sec
Sephuz Sephuz berserking 26297 0 0 0.00 0 0 2.1 0.0 0.0% 0.0% 0.0% 0.0% 180.70sec 0 301.01sec
Sephuz Sephuz chaos_bolt 116858 122918903 408357 23.86 0 1026828 62.5 119.7 100.0% 0.0% 0.0% 0.0% 4.68sec 122918903 301.01sec
Sephuz Sephuz conflagrate 17962 50613314 168146 19.32 293250 686722 48.7 96.9 58.2% 0.0% 0.0% 0.0% 6.16sec 50613314 301.01sec
Sephuz Sephuz cry_havoc 243011 12714130 42238 21.68 96930 193929 54.4 108.8 20.6% 0.0% 0.0% 0.0% 5.33sec 12714130 301.01sec
Sephuz Sephuz deadly_grace 188091 1873650 6225 2.90 106621 213148 14.6 14.6 20.7% 0.0% 0.0% 0.0% 2.03sec 1873650 301.01sec
Sephuz Sephuz dimensional_rift 196586 0 0 0.00 0 0 12.9 0.0 0.0% 0.0% 0.0% 0.0% 23.61sec 0 301.01sec
Sephuz Sephuz flask 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 301.01sec
Sephuz Sephuz food 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 301.01sec
Sephuz Sephuz havoc 80240 0 0 0.00 0 0 14.9 0.0 0.0% 0.0% 0.0% 0.0% 20.91sec 0 301.01sec
Sephuz Sephuz immolate 348 10054479 33403 7.75 153352 306662 20.2 38.9 68.6% 0.0% 0.0% 0.0% 15.05sec 92134406 301.01sec
Sephuz Sephuz immolate ticks -348 82079927 273600 59.27 164231 328396 20.2 296.3 68.7% 0.0% 0.0% 0.0% 15.05sec 92134406 301.01sec
Sephuz Sephuz incinerate 29722 44288552 147134 28.85 253771 507444 75.8 144.7 20.6% 0.0% 0.0% 0.0% 3.79sec 44288552 301.01sec
Sephuz Sephuz life_tap 1454 0 0 0.00 0 0 6.6 0.0 0.0% 0.0% 0.0% 0.0% 33.56sec 0 301.01sec
Sephuz Sephuz mark_of_the_hidden_satyr 191259 3157815 10491 4.02 129767 259465 20.2 20.2 20.6% 0.0% 0.0% 0.0% 14.79sec 3157815 301.01sec
Sephuz Sephuz potion 0 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 301.01sec
Sephuz Sephuz service_imp 111859 0 0 0.00 0 0 3.7 0.0 0.0% 0.0% 0.0% 0.0% 91.40sec 0 301.01sec
Sephuz Sephuz soul_harvest 196098 0 0 0.00 0 0 2.9 0.0 0.0% 0.0% 0.0% 0.0% 120.84sec 0 301.01sec
Sephuz Sephuz summon_doomguard 18540 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 301.01sec
Sephuz Sephuz summon_imp 688 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 301.01sec
Sephuz Sephuz summon_infernal 1122 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 301.01sec
Sephuz Sephuz_imp firebolt 3110 15002123 49840 21.69 114234 228532 109.7 108.8 20.7% 0.0% 0.0% 0.0% 2.74sec 15002123 301.01sec
Sephuz Sephuz_service_imp firebolt 3110 13834751 143988 30.71 233056 465880 49.5 49.2 20.7% 0.0% 0.0% 0.0% 5.49sec 13834751 96.08sec
Sephuz Sephuz_infernal immolation ticks -19483 2668397 8895 4.69 47134 94233 1.0 23.5 20.6% 0.0% 0.0% 0.0% 0.00sec 2668397 25.00sec
Sephuz Sephuz_infernal melee 0 756227 30248 53.33 28230 56444 22.2 22.2 20.5% 0.0% 0.0% 0.0% 1.10sec 1111725 25.00sec
Sephuz Sephuz_doomguard doom_bolt 85692 2819287 112767 26.61 211048 421858 11.1 11.1 20.5% 0.0% 0.0% 0.0% 2.18sec 2819287 25.00sec
Sephuz Sephuz_lord_of_flames_infernal immolation ticks -19483 2668985 8897 4.69 47128 94275 1.0 23.5 20.7% 0.0% 0.0% 0.0% 0.00sec 2668985 25.00sec
Sephuz Sephuz_lord_of_flames_infernal melee 0 757119 30284 53.33 28228 56461 22.2 22.2 20.7% 0.0% 0.0% 0.0% 1.10sec 1113036 25.00sec
Sephuz Sephuz_lord_of_flames_infernal immolation ticks -19483 2668793 8896 4.69 47132 94244 1.0 23.5 20.7% 0.0% 0.0% 0.0% 0.00sec 2668793 25.00sec
Sephuz Sephuz_lord_of_flames_infernal melee 0 756911 30275 53.33 28229 56457 22.2 22.2 20.7% 0.0% 0.0% 0.0% 1.10sec 1112732 25.00sec
Sephuz Sephuz_lord_of_flames_infernal immolation ticks -19483 2669583 8899 4.69 47129 94267 1.0 23.5 20.7% 0.0% 0.0% 0.0% 0.00sec 2669583 25.00sec
Sephuz Sephuz_lord_of_flames_infernal melee 0 755995 30239 53.33 28226 56478 22.2 22.2 20.5% 0.0% 0.0% 0.0% 1.10sec 1111384 25.00sec
Sephuz Sephuz_shadowy_tear shadow_bolt ticks -196657 5526351 18421 7.40 124402 248955 3.3 37.0 20.6% 0.0% 0.0% 0.0% 68.94sec 5526351 40.77sec
Sephuz Sephuz_flame_rift searing_bolt 243050 4211697 49997 46.79 64114 0 66.1 65.7 0.0% 0.0% 0.0% 0.0% 2.64sec 23989406 84.24sec
Sephuz Sephuz_flame_rift searing_bolt ticks -243050 19777709 65926 27.91 117499 235033 66.1 139.5 20.6% 0.0% 0.0% 0.0% 2.64sec 23989406 84.24sec
Sephuz Sephuz_chaos_tear chaos_bolt 215279 2547523 159633 12.38 0 773670 3.3 3.3 100.0% 0.0% 0.0% 0.0% 70.68sec 2547523 15.96sec
Sephuz Sephuz_chaos_portal chaos_barrage ticks -187394 5040212 16801 23.78 35282 70589 3.3 118.9 20.7% 0.0% 0.0% 0.0% 69.63sec 5040212 17.54sec
Shoulders Shoulders augmentation 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 301.01sec
Shoulders Shoulders berserking 26297 0 0 0.00 0 0 2.1 0.0 0.0% 0.0% 0.0% 0.0% 180.62sec 0 301.01sec
Shoulders Shoulders chaos_bolt 116858 123562140 410494 23.09 0 1066751 60.6 115.8 100.0% 0.0% 0.0% 0.0% 4.83sec 123562140 301.01sec
Shoulders Shoulders conflagrate 17962 51853495 172266 19.14 318051 720410 48.3 96.0 55.1% 0.0% 0.0% 0.0% 6.22sec 51853495 301.01sec
Shoulders Shoulders cry_havoc 243011 12699574 42190 20.85 105146 210105 52.3 104.6 15.5% 0.0% 0.0% 0.0% 5.55sec 12699574 301.01sec
Shoulders Shoulders deadly_grace 188091 1862759 6188 2.85 112693 226025 14.3 14.3 15.4% 0.0% 0.0% 0.0% 2.06sec 1862759 301.01sec
Shoulders Shoulders dimensional_rift 196586 0 0 0.00 0 0 12.9 0.0 0.0% 0.0% 0.0% 0.0% 23.65sec 0 301.01sec
Shoulders Shoulders flask 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 301.01sec
Shoulders Shoulders food 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 301.01sec
Shoulders Shoulders havoc 80240 0 0 0.00 0 0 14.9 0.0 0.0% 0.0% 0.0% 0.0% 20.92sec 0 301.01sec
Shoulders Shoulders immolate 348 10503822 34895 7.69 166307 332910 20.0 38.6 63.5% 0.0% 0.0% 0.0% 15.23sec 95911385 301.01sec
Shoulders Shoulders immolate ticks -348 85407563 284692 58.55 178459 356834 20.0 292.7 63.5% 0.0% 0.0% 0.0% 15.23sec 95911385 301.01sec
Shoulders Shoulders incinerate 29722 45679691 151755 28.73 274394 548758 75.3 144.1 15.5% 0.0% 0.0% 0.0% 3.84sec 45679691 301.01sec
Shoulders Shoulders life_tap 1454 0 0 0.00 0 0 6.6 0.0 0.0% 0.0% 0.0% 0.0% 33.65sec 0 301.01sec
Shoulders Shoulders mark_of_the_hidden_satyr 191259 3194369 10612 3.96 139374 278752 19.9 19.9 15.4% 0.0% 0.0% 0.0% 15.12sec 3194369 301.01sec
Shoulders Shoulders potion 0 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 301.01sec
Shoulders Shoulders service_imp 111859 0 0 0.00 0 0 3.7 0.0 0.0% 0.0% 0.0% 0.0% 91.41sec 0 301.01sec
Shoulders Shoulders soul_harvest 196098 0 0 0.00 0 0 2.9 0.0 0.0% 0.0% 0.0% 0.0% 120.97sec 0 301.01sec
Shoulders Shoulders summon_doomguard 18540 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 301.01sec
Shoulders Shoulders summon_imp 688 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 301.01sec
Shoulders Shoulders summon_infernal 1122 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 301.01sec
Shoulders Shoulders_imp firebolt 3110 15304268 50843 21.46 123052 245968 108.5 107.7 15.5% 0.0% 0.0% 0.0% 2.77sec 15304268 301.01sec
Shoulders Shoulders_service_imp firebolt 3110 14300791 148862 30.52 253506 506739 49.1 48.9 15.5% 0.0% 0.0% 0.0% 5.53sec 14300791 96.07sec
Shoulders Shoulders_infernal immolation ticks -19483 2821818 9406 4.64 52625 105240 1.0 23.2 15.5% 0.0% 0.0% 0.0% 0.00sec 2821818 25.00sec
Shoulders Shoulders_infernal melee 0 802227 32088 52.83 31502 62995 22.0 22.0 15.7% 0.0% 0.0% 0.0% 1.11sec 1179350 25.00sec
Shoulders Shoulders_doomguard doom_bolt 85692 2823623 112942 26.13 224385 448896 10.9 10.9 15.6% 0.0% 0.0% 0.0% 2.20sec 2823623 25.00sec
Shoulders Shoulders_lord_of_flames_infernal immolation ticks -19483 2819027 9397 4.64 52627 105218 1.0 23.2 15.4% 0.0% 0.0% 0.0% 0.00sec 2819027 25.00sec
Shoulders Shoulders_lord_of_flames_infernal melee 0 800653 32025 52.83 31505 62969 22.0 22.0 15.5% 0.0% 0.0% 0.0% 1.11sec 1177035 25.00sec
Shoulders Shoulders_lord_of_flames_infernal immolation ticks -19483 2822796 9409 4.64 52625 105241 1.0 23.2 15.6% 0.0% 0.0% 0.0% 0.00sec 2822796 25.00sec
Shoulders Shoulders_lord_of_flames_infernal melee 0 801017 32039 52.83 31501 63013 22.0 22.0 15.5% 0.0% 0.0% 0.0% 1.11sec 1177571 25.00sec
Shoulders Shoulders_lord_of_flames_infernal immolation ticks -19483 2821911 9406 4.64 52624 105252 1.0 23.2 15.5% 0.0% 0.0% 0.0% 0.00sec 2821911 25.00sec
Shoulders Shoulders_lord_of_flames_infernal melee 0 799923 31996 52.83 31500 63016 22.0 22.0 15.4% 0.0% 0.0% 0.0% 1.11sec 1175963 25.00sec
Shoulders Shoulders_shadowy_tear shadow_bolt ticks -196657 5851245 19504 7.36 138333 276651 3.3 36.8 15.6% 0.0% 0.0% 0.0% 71.37sec 5851245 44.15sec
Shoulders Shoulders_flame_rift searing_bolt 243050 4770629 57139 47.36 72390 0 66.3 65.9 0.0% 0.0% 0.0% 0.0% 2.57sec 25117740 83.49sec
Shoulders Shoulders_flame_rift searing_bolt ticks -243050 20347111 67824 28.14 125196 250323 66.3 140.7 15.5% 0.0% 0.0% 0.0% 2.57sec 25117740 83.49sec
Shoulders Shoulders_chaos_tear chaos_bolt 215279 2718472 167054 11.94 0 839512 3.3 3.2 100.0% 0.0% 0.0% 0.0% 70.49sec 2718472 16.27sec
Shoulders Shoulders_chaos_portal chaos_barrage ticks -187394 5276115 17587 23.09 39753 79481 3.3 115.4 15.5% 0.0% 0.0% 0.0% 70.36sec 5276115 18.15sec
Spite Spite augmentation 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 301.01sec
Spite Spite berserking 26297 0 0 0.00 0 0 2.1 0.0 0.0% 0.0% 0.0% 0.0% 180.63sec 0 301.01sec
Spite Spite chaos_bolt 116858 121328400 403073 23.15 0 1044804 60.8 116.1 100.0% 0.0% 0.0% 0.0% 4.82sec 121328400 301.01sec
Spite Spite conflagrate 17962 50579065 168032 19.16 308671 701919 48.3 96.1 55.3% 0.0% 0.0% 0.0% 6.21sec 50579065 301.01sec
Spite Spite cry_havoc 243011 12488819 41490 20.92 102846 205478 52.5 105.0 15.7% 0.0% 0.0% 0.0% 5.53sec 12488819 301.01sec
Spite Spite deadly_grace 188091 1806185 6000 2.86 108662 217305 14.4 14.4 15.7% 0.0% 0.0% 0.0% 2.07sec 1806185 301.01sec
Spite Spite dimensional_rift 196586 0 0 0.00 0 0 13.0 0.0 0.0% 0.0% 0.0% 0.0% 23.59sec 0 301.01sec
Spite Spite flask 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 301.01sec
Spite Spite food 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 301.01sec
Spite Spite havoc 80240 0 0 0.00 0 0 14.9 0.0 0.0% 0.0% 0.0% 0.0% 20.93sec 0 301.01sec
Spite Spite immolate 348 10159893 33753 7.70 160864 321719 20.0 38.6 63.5% 0.0% 0.0% 0.0% 15.22sec 93953796 301.01sec
Spite Spite immolate ticks -348 83793903 279313 58.60 174617 349409 20.0 293.0 63.7% 0.0% 0.0% 0.0% 15.22sec 93953796 301.01sec
Spite Spite incinerate 29722 45020056 149564 28.71 270177 540176 75.4 144.0 15.7% 0.0% 0.0% 0.0% 3.81sec 45020056 301.01sec
Spite Spite life_tap 1454 0 0 0.00 0 0 6.6 0.0 0.0% 0.0% 0.0% 0.0% 33.74sec 0 301.01sec
Spite Spite mark_of_the_hidden_satyr 191259 3176490 10553 3.98 137595 275641 19.9 19.9 15.7% 0.0% 0.0% 0.0% 15.03sec 3176490 301.01sec
Spite Spite potion 0 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 301.01sec
Spite Spite service_imp 111859 0 0 0.00 0 0 3.7 0.0 0.0% 0.0% 0.0% 0.0% 91.35sec 0 301.01sec
Spite Spite soul_harvest 196098 0 0 0.00 0 0 2.9 0.0 0.0% 0.0% 0.0% 0.0% 120.91sec 0 301.01sec
Spite Spite summon_doomguard 18540 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 301.01sec
Spite Spite summon_imp 688 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 301.01sec
Spite Spite summon_infernal 1122 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 301.01sec
Spite Spite_imp firebolt 3110 15135891 50284 21.49 121343 242589 108.6 107.8 15.7% 0.0% 0.0% 0.0% 2.77sec 15135891 301.01sec
Spite Spite_service_imp firebolt 3110 14455577 150440 30.55 255563 511357 49.2 48.9 15.6% 0.0% 0.0% 0.0% 5.52sec 14455577 96.09sec
Spite Spite_infernal immolation ticks -19483 2998925 9996 4.65 55793 111592 1.0 23.2 15.7% 0.0% 0.0% 0.0% 0.00sec 2998925 25.00sec
Spite Spite_infernal melee 0 851854 34073 52.85 33402 66837 22.0 22.0 15.8% 0.0% 0.0% 0.0% 1.11sec 1252307 25.00sec
Spite Spite_doomguard doom_bolt 85692 3159908 126391 26.21 250153 499971 10.9 10.9 15.7% 0.0% 0.0% 0.0% 2.20sec 3159908 25.00sec
Spite Spite_lord_of_flames_infernal immolation ticks -19483 2999666 9999 4.65 55794 111583 1.0 23.2 15.7% 0.0% 0.0% 0.0% 0.00sec 2999666 25.00sec
Spite Spite_lord_of_flames_infernal melee 0 850263 34009 52.85 33403 66827 22.0 22.0 15.6% 0.0% 0.0% 0.0% 1.11sec 1249967 25.00sec
Spite Spite_lord_of_flames_infernal immolation ticks -19483 2997532 9992 4.65 55792 111606 1.0 23.2 15.6% 0.0% 0.0% 0.0% 0.00sec 2997532 25.00sec
Spite Spite_lord_of_flames_infernal melee 0 850732 34028 52.85 33405 66805 22.0 22.0 15.6% 0.0% 0.0% 0.0% 1.11sec 1250656 25.00sec
Spite Spite_lord_of_flames_infernal immolation ticks -19483 2998513 9995 4.65 55795 111577 1.0 23.2 15.7% 0.0% 0.0% 0.0% 0.00sec 2998513 25.00sec
Spite Spite_lord_of_flames_infernal melee 0 850301 34011 52.85 33406 66796 22.0 22.0 15.6% 0.0% 0.0% 0.0% 1.11sec 1250023 25.00sec
Spite Spite_shadowy_tear shadow_bolt ticks -196657 5714471 19048 7.36 135075 270044 3.3 36.8 15.7% 0.0% 0.0% 0.0% 70.39sec 5714471 40.86sec
Spite Spite_flame_rift searing_bolt 243050 4525775 53537 46.67 68825 0 66.1 65.8 0.0% 0.0% 0.0% 0.0% 2.61sec 24812001 84.54sec
Spite Spite_flame_rift searing_bolt ticks -243050 20286226 67621 28.08 124911 250045 66.1 140.4 15.7% 0.0% 0.0% 0.0% 2.61sec 24812001 84.54sec
Spite Spite_chaos_tear chaos_bolt 215279 2629655 164107 12.36 0 796377 3.3 3.3 100.0% 0.0% 0.0% 0.0% 69.84sec 2629655 16.02sec
Spite Spite_chaos_portal chaos_barrage ticks -187394 5170506 17235 23.45 38318 76641 3.3 117.2 15.6% 0.0% 0.0% 0.0% 70.22sec 5170506 17.54sec

Fluffy_Pillow : 0 dps, 0 dps to main target

Results, Spec and Gear

RPS Out RPS In Primary Resource Waiting APM Active Skill
0.0 0.0 Mana 0.00% 0.0 100.0% 100%
Talents

Charts

Abilities

Buffs

Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit Overflow Expiry
Health Decade (0 - 10) 1.0 0.0 0.0sec 0.0sec 11.57% 11.57% 0.0(0.0) 0.0

Buff details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_Health Decade (0 - 10)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • Health Decade (0 - 10)_1:11.57%

Trigger Attempt Success

  • trigger_pct:100.00%
Health Decade (10 - 20) 1.0 0.0 0.0sec 0.0sec 10.55% 10.55% 0.0(0.0) 0.0

Buff details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_Health Decade (10 - 20)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • Health Decade (10 - 20)_1:10.55%

Trigger Attempt Success

  • trigger_pct:100.00%
Health Decade (20 - 30) 1.0 0.0 0.0sec 0.0sec 11.68% 11.68% 0.0(0.0) 0.0

Buff details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_Health Decade (20 - 30)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • Health Decade (20 - 30)_1:11.68%

Trigger Attempt Success

  • trigger_pct:100.00%
Health Decade (30 - 40) 1.0 0.0 0.0sec 0.0sec 11.42% 11.42% 0.0(0.0) 0.0

Buff details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_Health Decade (30 - 40)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • Health Decade (30 - 40)_1:11.42%

Trigger Attempt Success

  • trigger_pct:100.00%
Health Decade (40 - 50) 1.0 0.0 0.0sec 0.0sec 11.39% 11.39% 0.0(0.0) 0.0

Buff details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_Health Decade (40 - 50)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • Health Decade (40 - 50)_1:11.39%

Trigger Attempt Success

  • trigger_pct:100.00%
Health Decade (50 - 60) 1.0 0.0 0.0sec 0.0sec 11.39% 11.39% 0.0(0.0) 0.0

Buff details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_Health Decade (50 - 60)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • Health Decade (50 - 60)_1:11.39%

Trigger Attempt Success

  • trigger_pct:100.00%
Health Decade (60 - 70) 1.0 0.0 0.0sec 0.0sec 11.98% 11.98% 0.0(0.0) 0.0

Buff details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_Health Decade (60 - 70)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • Health Decade (60 - 70)_1:11.98%

Trigger Attempt Success

  • trigger_pct:100.00%
Health Decade (70 - 80) 1.0 0.0 0.0sec 0.0sec 9.33% 9.33% 0.0(0.0) 0.0

Buff details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_Health Decade (70 - 80)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • Health Decade (70 - 80)_1:9.33%

Trigger Attempt Success

  • trigger_pct:100.00%
Health Decade (80 - 90) 1.0 0.0 0.0sec 0.0sec 5.13% 5.13% 0.0(0.0) 0.0

Buff details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_Health Decade (80 - 90)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • Health Decade (80 - 90)_1:5.13%

Trigger Attempt Success

  • trigger_pct:100.00%
Health Decade (90 - 100) 1.0 0.0 0.0sec 0.0sec 5.56% 5.56% 0.0(0.0) 0.0

Buff details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_Health Decade (90 - 100)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • Health Decade (90 - 100)_1:5.56%

Trigger Attempt Success

  • trigger_pct:100.00%
Eradication 12.0 49.2 25.4sec 4.9sec 87.07% 87.07% 49.2(49.2) 11.0

Buff details

  • buff initial source:Destro_7.2_NoLeggos
  • cooldown name:buff_eradication
  • max_stacks:1
  • duration:6.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • eradication_1:87.07%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:196414
  • name:Eradication
  • tooltip:Damage taken from the Warlock increased by $s1%.
  • description:{$@spelldesc196412=Chaos Bolt increases the damage you deal to the target by $196414s1% for {$196414d=6 seconds}.}
  • max_stacks:0
  • duration:6.00
  • cooldown:0.00
  • default_chance:0.00%
Eradication 12.1 48.7 25.1sec 4.9sec 86.81% 86.81% 48.7(48.7) 11.2

Buff details

  • buff initial source:Prydaz
  • cooldown name:buff_eradication
  • max_stacks:1
  • duration:6.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • eradication_1:86.81%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:196414
  • name:Eradication
  • tooltip:Damage taken from the Warlock increased by $s1%.
  • description:{$@spelldesc196412=Chaos Bolt increases the damage you deal to the target by $196414s1% for {$196414d=6 seconds}.}
  • max_stacks:0
  • duration:6.00
  • cooldown:0.00
  • default_chance:0.00%
Eradication 12.0 49.1 25.3sec 4.9sec 87.35% 87.35% 49.1(49.1) 11.1

Buff details

  • buff initial source:Shoulders
  • cooldown name:buff_eradication
  • max_stacks:1
  • duration:6.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • eradication_1:87.35%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:196414
  • name:Eradication
  • tooltip:Damage taken from the Warlock increased by $s1%.
  • description:{$@spelldesc196412=Chaos Bolt increases the damage you deal to the target by $196414s1% for {$196414d=6 seconds}.}
  • max_stacks:0
  • duration:6.00
  • cooldown:0.00
  • default_chance:0.00%
Eradication 12.0 49.1 25.4sec 4.9sec 87.07% 87.07% 49.1(49.1) 11.0

Buff details

  • buff initial source:Cloak
  • cooldown name:buff_eradication
  • max_stacks:1
  • duration:6.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • eradication_1:87.07%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:196414
  • name:Eradication
  • tooltip:Damage taken from the Warlock increased by $s1%.
  • description:{$@spelldesc196412=Chaos Bolt increases the damage you deal to the target by $196414s1% for {$196414d=6 seconds}.}
  • max_stacks:0
  • duration:6.00
  • cooldown:0.00
  • default_chance:0.00%
Eradication 12.1 48.6 25.0sec 4.9sec 86.74% 86.74% 48.6(48.6) 11.2

Buff details

  • buff initial source:Magistrike
  • cooldown name:buff_eradication
  • max_stacks:1
  • duration:6.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • eradication_1:86.74%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:196414
  • name:Eradication
  • tooltip:Damage taken from the Warlock increased by $s1%.
  • description:{$@spelldesc196412=Chaos Bolt increases the damage you deal to the target by $196414s1% for {$196414d=6 seconds}.}
  • max_stacks:0
  • duration:6.00
  • cooldown:0.00
  • default_chance:0.00%
Eradication 11.9 49.3 25.5sec 4.9sec 87.14% 87.14% 49.3(49.3) 11.0

Buff details

  • buff initial source:Spite
  • cooldown name:buff_eradication
  • max_stacks:1
  • duration:6.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • eradication_1:87.14%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:196414
  • name:Eradication
  • tooltip:Damage taken from the Warlock increased by $s1%.
  • description:{$@spelldesc196412=Chaos Bolt increases the damage you deal to the target by $196414s1% for {$196414d=6 seconds}.}
  • max_stacks:0
  • duration:6.00
  • cooldown:0.00
  • default_chance:0.00%
Eradication 8.9 66.0 34.0sec 4.0sec 91.89% 91.89% 66.0(66.0) 8.0

Buff details

  • buff initial source:Feretory
  • cooldown name:buff_eradication
  • max_stacks:1
  • duration:6.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • eradication_1:91.89%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:196414
  • name:Eradication
  • tooltip:Damage taken from the Warlock increased by $s1%.
  • description:{$@spelldesc196412=Chaos Bolt increases the damage you deal to the target by $196414s1% for {$196414d=6 seconds}.}
  • max_stacks:0
  • duration:6.00
  • cooldown:0.00
  • default_chance:0.00%
Eradication 12.4 47.7 24.6sec 5.0sec 86.04% 86.04% 47.7(47.7) 11.4

Buff details

  • buff initial source:Portal_Pants
  • cooldown name:buff_eradication
  • max_stacks:1
  • duration:6.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • eradication_1:86.04%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:196414
  • name:Eradication
  • tooltip:Damage taken from the Warlock increased by $s1%.
  • description:{$@spelldesc196412=Chaos Bolt increases the damage you deal to the target by $196414s1% for {$196414d=6 seconds}.}
  • max_stacks:0
  • duration:6.00
  • cooldown:0.00
  • default_chance:0.00%
Eradication 11.8 50.3 25.9sec 4.8sec 87.43% 87.43% 50.3(50.3) 10.8

Buff details

  • buff initial source:Norgannon's
  • cooldown name:buff_eradication
  • max_stacks:1
  • duration:6.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • eradication_1:87.43%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:196414
  • name:Eradication
  • tooltip:Damage taken from the Warlock increased by $s1%.
  • description:{$@spelldesc196412=Chaos Bolt increases the damage you deal to the target by $196414s1% for {$196414d=6 seconds}.}
  • max_stacks:0
  • duration:6.00
  • cooldown:0.00
  • default_chance:0.00%
Eradication 11.7 50.2 25.9sec 4.8sec 87.55% 87.55% 50.2(50.2) 10.8

Buff details

  • buff initial source:Alythess'
  • cooldown name:buff_eradication
  • max_stacks:1
  • duration:6.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • eradication_1:87.55%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:196414
  • name:Eradication
  • tooltip:Damage taken from the Warlock increased by $s1%.
  • description:{$@spelldesc196412=Chaos Bolt increases the damage you deal to the target by $196414s1% for {$196414d=6 seconds}.}
  • max_stacks:0
  • duration:6.00
  • cooldown:0.00
  • default_chance:0.00%
Eradication 11.5 51.5 26.4sec 4.8sec 88.04% 88.04% 51.5(51.5) 10.6

Buff details

  • buff initial source:Sephuz
  • cooldown name:buff_eradication
  • max_stacks:1
  • duration:6.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • eradication_1:88.04%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:196414
  • name:Eradication
  • tooltip:Damage taken from the Warlock increased by $s1%.
  • description:{$@spelldesc196412=Chaos Bolt increases the damage you deal to the target by $196414s1% for {$196414d=6 seconds}.}
  • max_stacks:0
  • duration:6.00
  • cooldown:0.00
  • default_chance:0.00%
Eradication 12.2 48.2 24.9sec 5.0sec 86.75% 86.75% 48.2(48.2) 11.3

Buff details

  • buff initial source:KJ_Trinket
  • cooldown name:buff_eradication
  • max_stacks:1
  • duration:6.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • eradication_1:86.75%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:196414
  • name:Eradication
  • tooltip:Damage taken from the Warlock increased by $s1%.
  • description:{$@spelldesc196412=Chaos Bolt increases the damage you deal to the target by $196414s1% for {$196414d=6 seconds}.}
  • max_stacks:0
  • duration:6.00
  • cooldown:0.00
  • default_chance:0.00%
Eradication 5.1 89.5 54.7sec 3.2sec 96.92% 96.92% 89.5(89.5) 4.1

Buff details

  • buff initial source:Meme_Build
  • cooldown name:buff_eradication
  • max_stacks:1
  • duration:6.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • eradication_1:96.92%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:196414
  • name:Eradication
  • tooltip:Damage taken from the Warlock increased by $s1%.
  • description:{$@spelldesc196412=Chaos Bolt increases the damage you deal to the target by $196414s1% for {$196414d=6 seconds}.}
  • max_stacks:0
  • duration:6.00
  • cooldown:0.00
  • default_chance:0.00%
Havoc 0.0 0.0 0.0sec 0.0sec 0.00% 0.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:Cloak
  • cooldown name:buff_havoc
  • max_stacks:1
  • duration:8.00
  • cooldown:20.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • havoc_1:0.00%

Trigger Attempt Success

  • trigger_pct:0.06%

Spelldata details

  • id:80240
  • name:Havoc
  • tooltip:Spells cast by the Warlock also hit this target.
  • description:Marks a target with Havoc for {$d=8 seconds}, causing your single target spells to also strike the Havoc victim. Limit 1.
  • max_stacks:1
  • duration:8.00
  • cooldown:20.00
  • default_chance:100.00%
Roaring Blaze 10.2 38.3 31.2sec 6.2sec 71.97% 71.02% 0.0(0.0) 0.0

Buff details

  • buff initial source:Destro_7.2_NoLeggos
  • cooldown name:buff_roaring_blaze
  • max_stacks:100
  • duration:30.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • roaring_blaze_1:8.29%
  • roaring_blaze_2:9.36%
  • roaring_blaze_3:10.66%
  • roaring_blaze_4:16.80%
  • roaring_blaze_5:23.42%
  • roaring_blaze_6:3.44%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:205690
  • name:Roaring Blaze
  • tooltip:Damage taken from the Warlock's Immolate increased by $s1%.
  • description:{$@spelldesc205184=Conflagrate increases your remaining Immolate damage on the target by $205690s1% until Immolate expires or is refreshed.}
  • max_stacks:0
  • duration:30.00
  • cooldown:0.00
  • default_chance:0.00%
Roaring Blaze 10.2 37.9 31.3sec 6.2sec 71.52% 70.72% 0.0(0.0) 0.0

Buff details

  • buff initial source:Prydaz
  • cooldown name:buff_roaring_blaze
  • max_stacks:100
  • duration:30.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • roaring_blaze_1:8.44%
  • roaring_blaze_2:9.45%
  • roaring_blaze_3:10.61%
  • roaring_blaze_4:16.90%
  • roaring_blaze_5:22.87%
  • roaring_blaze_6:3.25%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:205690
  • name:Roaring Blaze
  • tooltip:Damage taken from the Warlock's Immolate increased by $s1%.
  • description:{$@spelldesc205184=Conflagrate increases your remaining Immolate damage on the target by $205690s1% until Immolate expires or is refreshed.}
  • max_stacks:0
  • duration:30.00
  • cooldown:0.00
  • default_chance:0.00%
Roaring Blaze 10.2 38.1 31.2sec 6.2sec 71.75% 70.90% 0.0(0.0) 0.0

Buff details

  • buff initial source:Shoulders
  • cooldown name:buff_roaring_blaze
  • max_stacks:100
  • duration:30.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • roaring_blaze_1:8.45%
  • roaring_blaze_2:9.39%
  • roaring_blaze_3:10.50%
  • roaring_blaze_4:17.07%
  • roaring_blaze_5:23.04%
  • roaring_blaze_6:3.29%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:205690
  • name:Roaring Blaze
  • tooltip:Damage taken from the Warlock's Immolate increased by $s1%.
  • description:{$@spelldesc205184=Conflagrate increases your remaining Immolate damage on the target by $205690s1% until Immolate expires or is refreshed.}
  • max_stacks:0
  • duration:30.00
  • cooldown:0.00
  • default_chance:0.00%
Roaring Blaze 10.2 38.1 31.2sec 6.2sec 71.76% 70.91% 0.0(0.0) 0.0

Buff details

  • buff initial source:Cloak
  • cooldown name:buff_roaring_blaze
  • max_stacks:100
  • duration:30.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • roaring_blaze_1:8.36%
  • roaring_blaze_2:9.40%
  • roaring_blaze_3:10.68%
  • roaring_blaze_4:16.92%
  • roaring_blaze_5:23.09%
  • roaring_blaze_6:3.31%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:205690
  • name:Roaring Blaze
  • tooltip:Damage taken from the Warlock's Immolate increased by $s1%.
  • description:{$@spelldesc205184=Conflagrate increases your remaining Immolate damage on the target by $205690s1% until Immolate expires or is refreshed.}
  • max_stacks:0
  • duration:30.00
  • cooldown:0.00
  • default_chance:0.00%
Roaring Blaze 10.2 37.8 31.4sec 6.3sec 71.40% 70.63% 0.0(0.0) 0.0

Buff details

  • buff initial source:Magistrike
  • cooldown name:buff_roaring_blaze
  • max_stacks:100
  • duration:30.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • roaring_blaze_1:8.47%
  • roaring_blaze_2:9.48%
  • roaring_blaze_3:10.58%
  • roaring_blaze_4:16.94%
  • roaring_blaze_5:22.75%
  • roaring_blaze_6:3.18%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:205690
  • name:Roaring Blaze
  • tooltip:Damage taken from the Warlock's Immolate increased by $s1%.
  • description:{$@spelldesc205184=Conflagrate increases your remaining Immolate damage on the target by $205690s1% until Immolate expires or is refreshed.}
  • max_stacks:0
  • duration:30.00
  • cooldown:0.00
  • default_chance:0.00%
Roaring Blaze 10.2 38.1 31.2sec 6.2sec 71.79% 70.90% 0.0(0.0) 0.0

Buff details

  • buff initial source:Spite
  • cooldown name:buff_roaring_blaze
  • max_stacks:100
  • duration:30.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • roaring_blaze_1:8.40%
  • roaring_blaze_2:9.39%
  • roaring_blaze_3:10.68%
  • roaring_blaze_4:16.86%
  • roaring_blaze_5:23.13%
  • roaring_blaze_6:3.34%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:205690
  • name:Roaring Blaze
  • tooltip:Damage taken from the Warlock's Immolate increased by $s1%.
  • description:{$@spelldesc205184=Conflagrate increases your remaining Immolate damage on the target by $205690s1% until Immolate expires or is refreshed.}
  • max_stacks:0
  • duration:30.00
  • cooldown:0.00
  • default_chance:0.00%
Roaring Blaze 10.3 38.4 31.0sec 6.2sec 72.18% 71.13% 0.0(0.0) 0.0

Buff details

  • buff initial source:Feretory
  • cooldown name:buff_roaring_blaze
  • max_stacks:100
  • duration:30.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • roaring_blaze_1:9.88%
  • roaring_blaze_2:9.77%
  • roaring_blaze_3:10.35%
  • roaring_blaze_4:16.05%
  • roaring_blaze_5:22.59%
  • roaring_blaze_6:3.54%
  • roaring_blaze_7:0.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:205690
  • name:Roaring Blaze
  • tooltip:Damage taken from the Warlock's Immolate increased by $s1%.
  • description:{$@spelldesc205184=Conflagrate increases your remaining Immolate damage on the target by $205690s1% until Immolate expires or is refreshed.}
  • max_stacks:0
  • duration:30.00
  • cooldown:0.00
  • default_chance:0.00%
Roaring Blaze 10.1 37.4 31.6sec 6.3sec 70.86% 70.25% 0.0(0.0) 0.0

Buff details

  • buff initial source:Portal_Pants
  • cooldown name:buff_roaring_blaze
  • max_stacks:100
  • duration:30.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • roaring_blaze_1:8.61%
  • roaring_blaze_2:9.51%
  • roaring_blaze_3:10.53%
  • roaring_blaze_4:16.92%
  • roaring_blaze_5:22.28%
  • roaring_blaze_6:3.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:205690
  • name:Roaring Blaze
  • tooltip:Damage taken from the Warlock's Immolate increased by $s1%.
  • description:{$@spelldesc205184=Conflagrate increases your remaining Immolate damage on the target by $205690s1% until Immolate expires or is refreshed.}
  • max_stacks:0
  • duration:30.00
  • cooldown:0.00
  • default_chance:0.00%
Roaring Blaze 10.2 38.9 31.0sec 6.1sec 72.32% 71.24% 0.0(0.0) 0.0

Buff details

  • buff initial source:Norgannon's
  • cooldown name:buff_roaring_blaze
  • max_stacks:100
  • duration:30.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • roaring_blaze_1:8.27%
  • roaring_blaze_2:9.20%
  • roaring_blaze_3:10.51%
  • roaring_blaze_4:16.61%
  • roaring_blaze_5:23.77%
  • roaring_blaze_6:3.95%
  • roaring_blaze_7:0.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:205690
  • name:Roaring Blaze
  • tooltip:Damage taken from the Warlock's Immolate increased by $s1%.
  • description:{$@spelldesc205184=Conflagrate increases your remaining Immolate damage on the target by $205690s1% until Immolate expires or is refreshed.}
  • max_stacks:0
  • duration:30.00
  • cooldown:0.00
  • default_chance:0.00%
Roaring Blaze 10.2 38.1 31.2sec 6.2sec 71.82% 70.91% 0.0(0.0) 0.0

Buff details

  • buff initial source:Alythess'
  • cooldown name:buff_roaring_blaze
  • max_stacks:100
  • duration:30.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • roaring_blaze_1:8.48%
  • roaring_blaze_2:9.44%
  • roaring_blaze_3:10.61%
  • roaring_blaze_4:16.82%
  • roaring_blaze_5:23.13%
  • roaring_blaze_6:3.35%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:205690
  • name:Roaring Blaze
  • tooltip:Damage taken from the Warlock's Immolate increased by $s1%.
  • description:{$@spelldesc205184=Conflagrate increases your remaining Immolate damage on the target by $205690s1% until Immolate expires or is refreshed.}
  • max_stacks:0
  • duration:30.00
  • cooldown:0.00
  • default_chance:0.00%
Roaring Blaze 10.2 38.5 31.1sec 6.2sec 72.16% 71.15% 0.0(0.0) 0.0

Buff details

  • buff initial source:Sephuz
  • cooldown name:buff_roaring_blaze
  • max_stacks:100
  • duration:30.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • roaring_blaze_1:8.44%
  • roaring_blaze_2:9.32%
  • roaring_blaze_3:10.59%
  • roaring_blaze_4:16.73%
  • roaring_blaze_5:23.52%
  • roaring_blaze_6:3.56%
  • roaring_blaze_7:0.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:205690
  • name:Roaring Blaze
  • tooltip:Damage taken from the Warlock's Immolate increased by $s1%.
  • description:{$@spelldesc205184=Conflagrate increases your remaining Immolate damage on the target by $205690s1% until Immolate expires or is refreshed.}
  • max_stacks:0
  • duration:30.00
  • cooldown:0.00
  • default_chance:0.00%
Roaring Blaze 10.1 37.7 31.4sec 6.3sec 71.26% 70.62% 0.0(0.0) 0.0

Buff details

  • buff initial source:KJ_Trinket
  • cooldown name:buff_roaring_blaze
  • max_stacks:100
  • duration:30.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • roaring_blaze_1:8.49%
  • roaring_blaze_2:9.46%
  • roaring_blaze_3:10.58%
  • roaring_blaze_4:17.04%
  • roaring_blaze_5:22.53%
  • roaring_blaze_6:3.15%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:205690
  • name:Roaring Blaze
  • tooltip:Damage taken from the Warlock's Immolate increased by $s1%.
  • description:{$@spelldesc205184=Conflagrate increases your remaining Immolate damage on the target by $205690s1% until Immolate expires or is refreshed.}
  • max_stacks:0
  • duration:30.00
  • cooldown:0.00
  • default_chance:0.00%
Constant Buffs
bleeding

Buff details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_bleeding
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • bleeding_1:100.00%
Mortal Wounds

Buff details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_mortal_wounds
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:0.25

Stack Uptimes

  • mortal_wounds_1:100.00%

Spelldata details

  • id:115804
  • name:Mortal Wounds
  • tooltip:Healing effects received reduced by $w1%.
  • description:Grievously wounds the target, reducing the effectiveness of any healing received for {$115804d=10 seconds}.
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:101.00%

Procs

Count Interval

Resources

Resource Usage Type Count Total Average RPE APR
Fluffy_Pillow
Resource RPS-Gain RPS-Loss
Health 0.00 10547739.75
Combat End Resource Mean Min Max
Health 0.00 0.00 0.00

Benefits & Uptimes

Benefits %
Uptimes %

Deaths

death count 12719
death count pct 127.15
avg death time 301.14
min death time 217.68
max death time 385.07
dmg taken 3175267744.20

Statistics & Data Analysis

Fight Length
Sample Data Fluffy_Pillow Fight Length
Count 9999
Mean 301.01
Minimum 217.68
Maximum 385.07
Spread ( max - min ) 167.39
Range [ ( max - min ) / 2 * 100% ] 27.80%
DPS
Sample Data Fluffy_Pillow Damage Per Second
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
Priority Target DPS
Sample Data Fluffy_Pillow Priority Target Damage Per Second
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
DPS(e)
Sample Data Fluffy_Pillow Damage Per Second (Effective)
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Damage
Sample Data Fluffy_Pillow Damage
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
DTPS
Sample Data Fluffy_Pillow Damage Taken Per Second
Count 9999
Mean 10582830.26
Minimum 9805536.32
Maximum 11670524.74
Spread ( max - min ) 1864988.42
Range [ ( max - min ) / 2 * 100% ] 8.81%
Standard Deviation 287812.1613
5th Percentile 10128910.85
95th Percentile 11071956.88
( 95th Percentile - 5th Percentile ) 943046.04
Mean Distribution
Standard Deviation 2878.2655
95.00% Confidence Intervall ( 10577188.96 - 10588471.56 )
Normalized 95.00% Confidence Intervall ( 99.95% - 100.05% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 29
0.1% Error 2842
0.1 Scale Factor Error with Delta=300 707134377
0.05 Scale Factor Error with Delta=300 2828537505
0.01 Scale Factor Error with Delta=300 70713437614
HPS
Sample Data Fluffy_Pillow Healing Per Second
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
HPS(e)
Sample Data Fluffy_Pillow Healing Per Second (Effective)
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
Sample Data Fluffy_Pillow Heal
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
Sample Data Fluffy_Pillow Healing Taken Per Second
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
TMI
Sample Data Fluffy_Pillow Theck-Meloree Index
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
ETMI
Sample Data Fluffy_PillowTheck-Meloree Index (Effective)
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
MSD
Sample Data Fluffy_Pillow Max Spike Value
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 snapshot_stats

Stats

Raid-Buffed Unbuffed Gear Amount
Strength 0 0 0
Agility 0 0 0
Stamina 0 0 0
Intellect 0 0 0
Spirit 0 0 0
Health 0 3806263664 0
Melee Crit 5.00% 5.00% 0
Spell Crit 0.00% 0.00% 0
Haste 0.00% 0.00% 0
Damage / Heal Versatility 0.00% 0.00% 0
Mitigation Versatility 0.00% 0.00% 0
Mastery 0.00% 0.00% 0
Armor 3474 3474 3474
Run Speed 7 0 0
Tank-Miss 3.00% 3.00% 0
Tank-Dodge 3.00% 3.00% 0
Tank-Parry 3.00% 3.00% 0
Tank-Block 3.00% 3.00% 0
Tank-Crit 0.00% 0.00% 0

Gear

Source Slot Average Item Level: 0.00

Talents

Level
15 none none none
30 none none none
45 none none none
60 none none none
75 none none none
90 none none none
100 none none none

Profile

enemy="Fluffy_Pillow"
level=113
race=humanoid
role=tank
position=front
talents=0000000
spec=unknown

# This default action priority list is automatically created based on your character.
# It is a attempt to provide you with a action list that is both simple and practicable,
# while resulting in a meaningful and good simulation. It may not result in the absolutely highest possible dps.
# Feel free to edit, adapt and improve it to your own needs.
# SimulationCraft is always looking for updates and improvements to the default action lists.

# Executed before combat begins. Accepts non-harmful actions only.
actions.precombat=snapshot_stats

# Executed every time the actor is available.


# Gear Summary
# gear_ilvl=0.00

enemy2 : 0 dps, 0 dps to main target

Results, Spec and Gear

RPS Out RPS In Primary Resource Waiting APM Active Skill
0.0 0.0 Mana 0.00% 0.0 100.0% 100%
Talents

Charts

Abilities

Buffs

Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit Overflow Expiry
Health Decade (0 - 10) 1.0 0.0 0.0sec 0.0sec 6.89% 6.89% 0.0(0.0) 0.0

Buff details

  • buff initial source:enemy2
  • cooldown name:buff_Health Decade (0 - 10)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • Health Decade (0 - 10)_1:6.89%

Trigger Attempt Success

  • trigger_pct:99.92%
Health Decade (10 - 20) 1.0 0.0 0.0sec 0.0sec 11.45% 11.45% 0.0(0.0) 0.0

Buff details

  • buff initial source:enemy2
  • cooldown name:buff_Health Decade (10 - 20)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • Health Decade (10 - 20)_1:11.45%

Trigger Attempt Success

  • trigger_pct:100.00%
Health Decade (20 - 30) 1.0 0.0 0.0sec 0.0sec 11.87% 11.87% 0.0(0.0) 0.0

Buff details

  • buff initial source:enemy2
  • cooldown name:buff_Health Decade (20 - 30)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • Health Decade (20 - 30)_1:11.87%

Trigger Attempt Success

  • trigger_pct:100.00%
Health Decade (30 - 40) 1.0 0.0 0.0sec 0.0sec 11.56% 11.56% 0.0(0.0) 0.0

Buff details

  • buff initial source:enemy2
  • cooldown name:buff_Health Decade (30 - 40)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • Health Decade (30 - 40)_1:11.56%

Trigger Attempt Success

  • trigger_pct:100.00%
Health Decade (40 - 50) 1.0 0.0 0.0sec 0.0sec 10.97% 10.97% 0.0(0.0) 0.0

Buff details

  • buff initial source:enemy2
  • cooldown name:buff_Health Decade (40 - 50)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • Health Decade (40 - 50)_1:10.97%

Trigger Attempt Success

  • trigger_pct:100.00%
Health Decade (50 - 60) 1.0 0.0 0.0sec 0.0sec 11.34% 11.34% 0.0(0.0) 0.0

Buff details

  • buff initial source:enemy2
  • cooldown name:buff_Health Decade (50 - 60)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • Health Decade (50 - 60)_1:11.34%

Trigger Attempt Success

  • trigger_pct:100.00%
Health Decade (60 - 70) 1.0 0.0 0.0sec 0.0sec 12.02% 12.02% 0.0(0.0) 0.0

Buff details

  • buff initial source:enemy2
  • cooldown name:buff_Health Decade (60 - 70)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • Health Decade (60 - 70)_1:12.02%

Trigger Attempt Success

  • trigger_pct:100.00%
Health Decade (70 - 80) 1.0 0.0 0.0sec 0.0sec 10.46% 10.46% 0.0(0.0) 0.0

Buff details

  • buff initial source:enemy2
  • cooldown name:buff_Health Decade (70 - 80)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • Health Decade (70 - 80)_1:10.46%

Trigger Attempt Success

  • trigger_pct:100.00%
Health Decade (80 - 90) 1.0 0.0 0.0sec 0.0sec 6.71% 6.71% 0.0(0.0) 0.0

Buff details

  • buff initial source:enemy2
  • cooldown name:buff_Health Decade (80 - 90)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • Health Decade (80 - 90)_1:6.71%

Trigger Attempt Success

  • trigger_pct:100.00%
Health Decade (90 - 100) 1.0 0.0 0.0sec 0.0sec 6.73% 6.73% 0.0(0.0) 0.0

Buff details

  • buff initial source:enemy2
  • cooldown name:buff_Health Decade (90 - 100)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • Health Decade (90 - 100)_1:6.73%

Trigger Attempt Success

  • trigger_pct:100.00%
Eradication 12.8 42.0 23.0sec 5.3sec 80.04% 80.04% 42.0(42.0) 12.0

Buff details

  • buff initial source:Destro_7.2_NoLeggos
  • cooldown name:buff_eradication
  • max_stacks:1
  • duration:6.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • eradication_1:80.04%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:196414
  • name:Eradication
  • tooltip:Damage taken from the Warlock increased by $s1%.
  • description:{$@spelldesc196412=Chaos Bolt increases the damage you deal to the target by $196414s1% for {$196414d=6 seconds}.}
  • max_stacks:0
  • duration:6.00
  • cooldown:0.00
  • default_chance:0.00%
Eradication 13.0 41.3 22.8sec 5.3sec 79.51% 79.51% 41.3(41.3) 12.1

Buff details

  • buff initial source:Prydaz
  • cooldown name:buff_eradication
  • max_stacks:1
  • duration:6.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • eradication_1:79.51%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:196414
  • name:Eradication
  • tooltip:Damage taken from the Warlock increased by $s1%.
  • description:{$@spelldesc196412=Chaos Bolt increases the damage you deal to the target by $196414s1% for {$196414d=6 seconds}.}
  • max_stacks:0
  • duration:6.00
  • cooldown:0.00
  • default_chance:0.00%
Eradication 12.9 41.8 22.9sec 5.3sec 80.14% 80.14% 41.8(41.8) 12.0

Buff details

  • buff initial source:Shoulders
  • cooldown name:buff_eradication
  • max_stacks:1
  • duration:6.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • eradication_1:80.14%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:196414
  • name:Eradication
  • tooltip:Damage taken from the Warlock increased by $s1%.
  • description:{$@spelldesc196412=Chaos Bolt increases the damage you deal to the target by $196414s1% for {$196414d=6 seconds}.}
  • max_stacks:0
  • duration:6.00
  • cooldown:0.00
  • default_chance:0.00%
Eradication 12.9 41.8 22.9sec 5.3sec 79.85% 79.85% 41.8(41.8) 12.0

Buff details

  • buff initial source:Cloak
  • cooldown name:buff_eradication
  • max_stacks:1
  • duration:6.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • eradication_1:79.85%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:196414
  • name:Eradication
  • tooltip:Damage taken from the Warlock increased by $s1%.
  • description:{$@spelldesc196412=Chaos Bolt increases the damage you deal to the target by $196414s1% for {$196414d=6 seconds}.}
  • max_stacks:0
  • duration:6.00
  • cooldown:0.00
  • default_chance:0.00%
Eradication 13.0 41.2 22.7sec 5.3sec 79.43% 79.43% 41.2(41.2) 12.2

Buff details

  • buff initial source:Magistrike
  • cooldown name:buff_eradication
  • max_stacks:1
  • duration:6.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • eradication_1:79.43%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:196414
  • name:Eradication
  • tooltip:Damage taken from the Warlock increased by $s1%.
  • description:{$@spelldesc196412=Chaos Bolt increases the damage you deal to the target by $196414s1% for {$196414d=6 seconds}.}
  • max_stacks:0
  • duration:6.00
  • cooldown:0.00
  • default_chance:0.00%
Eradication 12.8 42.0 23.0sec 5.3sec 79.99% 79.99% 42.0(42.0) 12.0

Buff details

  • buff initial source:Spite
  • cooldown name:buff_eradication
  • max_stacks:1
  • duration:6.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • eradication_1:79.99%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:196414
  • name:Eradication
  • tooltip:Damage taken from the Warlock increased by $s1%.
  • description:{$@spelldesc196412=Chaos Bolt increases the damage you deal to the target by $196414s1% for {$196414d=6 seconds}.}
  • max_stacks:0
  • duration:6.00
  • cooldown:0.00
  • default_chance:0.00%
Eradication 9.9 58.2 30.0sec 4.3sec 86.21% 86.21% 58.2(58.2) 9.0

Buff details

  • buff initial source:Feretory
  • cooldown name:buff_eradication
  • max_stacks:1
  • duration:6.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • eradication_1:86.21%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:196414
  • name:Eradication
  • tooltip:Damage taken from the Warlock increased by $s1%.
  • description:{$@spelldesc196412=Chaos Bolt increases the damage you deal to the target by $196414s1% for {$196414d=6 seconds}.}
  • max_stacks:0
  • duration:6.00
  • cooldown:0.00
  • default_chance:0.00%
Eradication 13.2 40.3 22.4sec 5.4sec 78.75% 78.75% 40.3(40.3) 12.4

Buff details

  • buff initial source:Portal_Pants
  • cooldown name:buff_eradication
  • max_stacks:1
  • duration:6.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • eradication_1:78.75%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:196414
  • name:Eradication
  • tooltip:Damage taken from the Warlock increased by $s1%.
  • description:{$@spelldesc196412=Chaos Bolt increases the damage you deal to the target by $196414s1% for {$196414d=6 seconds}.}
  • max_stacks:0
  • duration:6.00
  • cooldown:0.00
  • default_chance:0.00%
Eradication 12.5 43.7 23.7sec 5.2sec 80.90% 80.90% 43.7(43.7) 11.6

Buff details

  • buff initial source:Norgannon's
  • cooldown name:buff_eradication
  • max_stacks:1
  • duration:6.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • eradication_1:80.90%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:196414
  • name:Eradication
  • tooltip:Damage taken from the Warlock increased by $s1%.
  • description:{$@spelldesc196412=Chaos Bolt increases the damage you deal to the target by $196414s1% for {$196414d=6 seconds}.}
  • max_stacks:0
  • duration:6.00
  • cooldown:0.00
  • default_chance:0.00%
Eradication 12.7 42.8 23.3sec 5.2sec 80.48% 80.48% 42.8(42.8) 11.8

Buff details

  • buff initial source:Alythess'
  • cooldown name:buff_eradication
  • max_stacks:1
  • duration:6.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • eradication_1:80.48%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:196414
  • name:Eradication
  • tooltip:Damage taken from the Warlock increased by $s1%.
  • description:{$@spelldesc196412=Chaos Bolt increases the damage you deal to the target by $196414s1% for {$196414d=6 seconds}.}
  • max_stacks:0
  • duration:6.00
  • cooldown:0.00
  • default_chance:0.00%
Eradication 12.4 44.3 23.8sec 5.1sec 81.31% 81.31% 44.3(44.3) 11.5

Buff details

  • buff initial source:Sephuz
  • cooldown name:buff_eradication
  • max_stacks:1
  • duration:6.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • eradication_1:81.31%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:196414
  • name:Eradication
  • tooltip:Damage taken from the Warlock increased by $s1%.
  • description:{$@spelldesc196412=Chaos Bolt increases the damage you deal to the target by $196414s1% for {$196414d=6 seconds}.}
  • max_stacks:0
  • duration:6.00
  • cooldown:0.00
  • default_chance:0.00%
Eradication 13.3 40.4 22.2sec 5.4sec 79.21% 79.21% 40.4(40.4) 12.4

Buff details

  • buff initial source:KJ_Trinket
  • cooldown name:buff_eradication
  • max_stacks:1
  • duration:6.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • eradication_1:79.21%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:196414
  • name:Eradication
  • tooltip:Damage taken from the Warlock increased by $s1%.
  • description:{$@spelldesc196412=Chaos Bolt increases the damage you deal to the target by $196414s1% for {$196414d=6 seconds}.}
  • max_stacks:0
  • duration:6.00
  • cooldown:0.00
  • default_chance:0.00%
Eradication 13.8 17.4 20.9sec 8.9sec 43.97% 43.97% 17.4(17.4) 13.3

Buff details

  • buff initial source:Meme_Build
  • cooldown name:buff_eradication
  • max_stacks:1
  • duration:6.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • eradication_1:43.97%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:196414
  • name:Eradication
  • tooltip:Damage taken from the Warlock increased by $s1%.
  • description:{$@spelldesc196412=Chaos Bolt increases the damage you deal to the target by $196414s1% for {$196414d=6 seconds}.}
  • max_stacks:0
  • duration:6.00
  • cooldown:0.00
  • default_chance:0.00%
Havoc 14.9 0.0 20.9sec 20.9sec 95.86% 95.86% 0.0(0.0) 13.9

Buff details

  • buff initial source:Destro_7.2_NoLeggos
  • cooldown name:buff_havoc
  • max_stacks:1
  • duration:8.00
  • cooldown:20.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • havoc_1:95.86%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:80240
  • name:Havoc
  • tooltip:Spells cast by the Warlock also hit this target.
  • description:Marks a target with Havoc for {$d=8 seconds}, causing your single target spells to also strike the Havoc victim. Limit 1.
  • max_stacks:1
  • duration:8.00
  • cooldown:20.00
  • default_chance:100.00%
Havoc 14.9 0.0 20.9sec 20.9sec 95.79% 95.79% 0.0(0.0) 13.9

Buff details

  • buff initial source:Prydaz
  • cooldown name:buff_havoc
  • max_stacks:1
  • duration:8.00
  • cooldown:20.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • havoc_1:95.79%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:80240
  • name:Havoc
  • tooltip:Spells cast by the Warlock also hit this target.
  • description:Marks a target with Havoc for {$d=8 seconds}, causing your single target spells to also strike the Havoc victim. Limit 1.
  • max_stacks:1
  • duration:8.00
  • cooldown:20.00
  • default_chance:100.00%
Havoc 14.9 0.0 20.9sec 20.9sec 95.85% 95.85% 0.0(0.0) 13.9

Buff details

  • buff initial source:Shoulders
  • cooldown name:buff_havoc
  • max_stacks:1
  • duration:8.00
  • cooldown:20.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • havoc_1:95.85%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:80240
  • name:Havoc
  • tooltip:Spells cast by the Warlock also hit this target.
  • description:Marks a target with Havoc for {$d=8 seconds}, causing your single target spells to also strike the Havoc victim. Limit 1.
  • max_stacks:1
  • duration:8.00
  • cooldown:20.00
  • default_chance:100.00%
Havoc 14.9 0.0 20.9sec 20.9sec 95.81% 95.81% 0.0(0.0) 13.9

Buff details

  • buff initial source:Cloak
  • cooldown name:buff_havoc
  • max_stacks:1
  • duration:8.00
  • cooldown:20.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • havoc_1:95.81%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:80240
  • name:Havoc
  • tooltip:Spells cast by the Warlock also hit this target.
  • description:Marks a target with Havoc for {$d=8 seconds}, causing your single target spells to also strike the Havoc victim. Limit 1.
  • max_stacks:1
  • duration:8.00
  • cooldown:20.00
  • default_chance:100.00%
Havoc 14.9 0.0 20.9sec 20.9sec 95.79% 95.79% 0.0(0.0) 13.9

Buff details

  • buff initial source:Magistrike
  • cooldown name:buff_havoc
  • max_stacks:1
  • duration:8.00
  • cooldown:20.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • havoc_1:95.79%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:80240
  • name:Havoc
  • tooltip:Spells cast by the Warlock also hit this target.
  • description:Marks a target with Havoc for {$d=8 seconds}, causing your single target spells to also strike the Havoc victim. Limit 1.
  • max_stacks:1
  • duration:8.00
  • cooldown:20.00
  • default_chance:100.00%
Havoc 14.9 0.0 20.9sec 20.9sec 95.82% 95.82% 0.0(0.0) 13.9

Buff details

  • buff initial source:Spite
  • cooldown name:buff_havoc
  • max_stacks:1
  • duration:8.00
  • cooldown:20.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • havoc_1:95.82%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:80240
  • name:Havoc
  • tooltip:Spells cast by the Warlock also hit this target.
  • description:Marks a target with Havoc for {$d=8 seconds}, causing your single target spells to also strike the Havoc victim. Limit 1.
  • max_stacks:1
  • duration:8.00
  • cooldown:20.00
  • default_chance:100.00%
Havoc 14.9 0.0 20.8sec 20.9sec 96.06% 96.06% 0.0(0.0) 14.0

Buff details

  • buff initial source:Feretory
  • cooldown name:buff_havoc
  • max_stacks:1
  • duration:8.00
  • cooldown:20.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • havoc_1:96.06%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:80240
  • name:Havoc
  • tooltip:Spells cast by the Warlock also hit this target.
  • description:Marks a target with Havoc for {$d=8 seconds}, causing your single target spells to also strike the Havoc victim. Limit 1.
  • max_stacks:1
  • duration:8.00
  • cooldown:20.00
  • default_chance:100.00%
Havoc 14.9 0.0 20.9sec 20.9sec 95.78% 95.78% 0.0(0.0) 13.9

Buff details

  • buff initial source:Portal_Pants
  • cooldown name:buff_havoc
  • max_stacks:1
  • duration:8.00
  • cooldown:20.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • havoc_1:95.78%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:80240
  • name:Havoc
  • tooltip:Spells cast by the Warlock also hit this target.
  • description:Marks a target with Havoc for {$d=8 seconds}, causing your single target spells to also strike the Havoc victim. Limit 1.
  • max_stacks:1
  • duration:8.00
  • cooldown:20.00
  • default_chance:100.00%
Havoc 14.9 0.0 20.9sec 20.9sec 95.90% 95.90% 0.0(0.0) 13.9

Buff details

  • buff initial source:Norgannon's
  • cooldown name:buff_havoc
  • max_stacks:1
  • duration:8.00
  • cooldown:20.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • havoc_1:95.90%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:80240
  • name:Havoc
  • tooltip:Spells cast by the Warlock also hit this target.
  • description:Marks a target with Havoc for {$d=8 seconds}, causing your single target spells to also strike the Havoc victim. Limit 1.
  • max_stacks:1
  • duration:8.00
  • cooldown:20.00
  • default_chance:100.00%
Havoc 14.9 0.0 20.9sec 20.9sec 95.83% 95.83% 0.0(0.0) 13.9

Buff details

  • buff initial source:Alythess'
  • cooldown name:buff_havoc
  • max_stacks:1
  • duration:8.00
  • cooldown:20.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • havoc_1:95.83%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:80240
  • name:Havoc
  • tooltip:Spells cast by the Warlock also hit this target.
  • description:Marks a target with Havoc for {$d=8 seconds}, causing your single target spells to also strike the Havoc victim. Limit 1.
  • max_stacks:1
  • duration:8.00
  • cooldown:20.00
  • default_chance:100.00%
Havoc 14.9 0.0 20.9sec 20.9sec 95.89% 95.89% 0.0(0.0) 13.9

Buff details

  • buff initial source:Sephuz
  • cooldown name:buff_havoc
  • max_stacks:1
  • duration:8.00
  • cooldown:20.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • havoc_1:95.89%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:80240
  • name:Havoc
  • tooltip:Spells cast by the Warlock also hit this target.
  • description:Marks a target with Havoc for {$d=8 seconds}, causing your single target spells to also strike the Havoc victim. Limit 1.
  • max_stacks:1
  • duration:8.00
  • cooldown:20.00
  • default_chance:100.00%
Havoc 14.9 0.0 20.9sec 20.9sec 95.78% 95.78% 0.0(0.0) 13.9

Buff details

  • buff initial source:KJ_Trinket
  • cooldown name:buff_havoc
  • max_stacks:1
  • duration:8.00
  • cooldown:20.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • havoc_1:95.78%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:80240
  • name:Havoc
  • tooltip:Spells cast by the Warlock also hit this target.
  • description:Marks a target with Havoc for {$d=8 seconds}, causing your single target spells to also strike the Havoc victim. Limit 1.
  • max_stacks:1
  • duration:8.00
  • cooldown:20.00
  • default_chance:100.00%
Havoc 15.0 0.0 20.7sec 20.7sec 39.50% 39.50% 0.0(0.0) 14.7

Buff details

  • buff initial source:Meme_Build
  • cooldown name:buff_havoc
  • max_stacks:1
  • duration:8.00
  • cooldown:20.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • havoc_1:39.50%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:80240
  • name:Havoc
  • tooltip:Spells cast by the Warlock also hit this target.
  • description:Marks a target with Havoc for {$d=8 seconds}, causing your single target spells to also strike the Havoc victim. Limit 1.
  • max_stacks:1
  • duration:8.00
  • cooldown:20.00
  • default_chance:100.00%
Roaring Blaze 10.6 37.4 30.0sec 6.3sec 71.19% 70.89% 0.0(0.0) 0.0

Buff details

  • buff initial source:Destro_7.2_NoLeggos
  • cooldown name:buff_roaring_blaze
  • max_stacks:100
  • duration:30.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • roaring_blaze_1:9.12%
  • roaring_blaze_2:9.88%
  • roaring_blaze_3:10.54%
  • roaring_blaze_4:16.27%
  • roaring_blaze_5:21.96%
  • roaring_blaze_6:3.41%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:205690
  • name:Roaring Blaze
  • tooltip:Damage taken from the Warlock's Immolate increased by $s1%.
  • description:{$@spelldesc205184=Conflagrate increases your remaining Immolate damage on the target by $205690s1% until Immolate expires or is refreshed.}
  • max_stacks:0
  • duration:30.00
  • cooldown:0.00
  • default_chance:0.00%
Roaring Blaze 10.4 37.1 30.4sec 6.3sec 70.84% 70.61% 0.0(0.0) 0.0

Buff details

  • buff initial source:Prydaz
  • cooldown name:buff_roaring_blaze
  • max_stacks:100
  • duration:30.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • roaring_blaze_1:9.06%
  • roaring_blaze_2:9.84%
  • roaring_blaze_3:10.54%
  • roaring_blaze_4:16.50%
  • roaring_blaze_5:21.68%
  • roaring_blaze_6:3.23%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:205690
  • name:Roaring Blaze
  • tooltip:Damage taken from the Warlock's Immolate increased by $s1%.
  • description:{$@spelldesc205184=Conflagrate increases your remaining Immolate damage on the target by $205690s1% until Immolate expires or is refreshed.}
  • max_stacks:0
  • duration:30.00
  • cooldown:0.00
  • default_chance:0.00%
Roaring Blaze 10.5 37.3 30.3sec 6.3sec 71.04% 70.79% 0.0(0.0) 0.0

Buff details

  • buff initial source:Shoulders
  • cooldown name:buff_roaring_blaze
  • max_stacks:100
  • duration:30.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • roaring_blaze_1:9.11%
  • roaring_blaze_2:9.82%
  • roaring_blaze_3:10.40%
  • roaring_blaze_4:16.66%
  • roaring_blaze_5:21.78%
  • roaring_blaze_6:3.27%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:205690
  • name:Roaring Blaze
  • tooltip:Damage taken from the Warlock's Immolate increased by $s1%.
  • description:{$@spelldesc205184=Conflagrate increases your remaining Immolate damage on the target by $205690s1% until Immolate expires or is refreshed.}
  • max_stacks:0
  • duration:30.00
  • cooldown:0.00
  • default_chance:0.00%
Roaring Blaze 10.5 37.2 30.2sec 6.3sec 71.03% 70.78% 0.0(0.0) 0.0

Buff details

  • buff initial source:Cloak
  • cooldown name:buff_roaring_blaze
  • max_stacks:100
  • duration:30.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • roaring_blaze_1:9.06%
  • roaring_blaze_2:9.83%
  • roaring_blaze_3:10.60%
  • roaring_blaze_4:16.48%
  • roaring_blaze_5:21.78%
  • roaring_blaze_6:3.29%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:205690
  • name:Roaring Blaze
  • tooltip:Damage taken from the Warlock's Immolate increased by $s1%.
  • description:{$@spelldesc205184=Conflagrate increases your remaining Immolate damage on the target by $205690s1% until Immolate expires or is refreshed.}
  • max_stacks:0
  • duration:30.00
  • cooldown:0.00
  • default_chance:0.00%
Roaring Blaze 10.4 37.0 30.5sec 6.3sec 70.75% 70.54% 0.0(0.0) 0.0

Buff details

  • buff initial source:Magistrike
  • cooldown name:buff_roaring_blaze
  • max_stacks:100
  • duration:30.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • roaring_blaze_1:9.07%
  • roaring_blaze_2:9.84%
  • roaring_blaze_3:10.52%
  • roaring_blaze_4:16.56%
  • roaring_blaze_5:21.60%
  • roaring_blaze_6:3.16%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:205690
  • name:Roaring Blaze
  • tooltip:Damage taken from the Warlock's Immolate increased by $s1%.
  • description:{$@spelldesc205184=Conflagrate increases your remaining Immolate damage on the target by $205690s1% until Immolate expires or is refreshed.}
  • max_stacks:0
  • duration:30.00
  • cooldown:0.00
  • default_chance:0.00%
Roaring Blaze 10.5 37.3 30.2sec 6.3sec 71.05% 70.80% 0.0(0.0) 0.0

Buff details

  • buff initial source:Spite
  • cooldown name:buff_roaring_blaze
  • max_stacks:100
  • duration:30.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • roaring_blaze_1:9.12%
  • roaring_blaze_2:9.83%
  • roaring_blaze_3:10.62%
  • roaring_blaze_4:16.39%
  • roaring_blaze_5:21.78%
  • roaring_blaze_6:3.32%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:205690
  • name:Roaring Blaze
  • tooltip:Damage taken from the Warlock's Immolate increased by $s1%.
  • description:{$@spelldesc205184=Conflagrate increases your remaining Immolate damage on the target by $205690s1% until Immolate expires or is refreshed.}
  • max_stacks:0
  • duration:30.00
  • cooldown:0.00
  • default_chance:0.00%
Roaring Blaze 10.6 37.5 29.8sec 6.2sec 71.35% 71.03% 0.0(0.0) 0.0

Buff details

  • buff initial source:Feretory
  • cooldown name:buff_roaring_blaze
  • max_stacks:100
  • duration:30.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • roaring_blaze_1:10.65%
  • roaring_blaze_2:10.26%
  • roaring_blaze_3:10.25%
  • roaring_blaze_4:15.48%
  • roaring_blaze_5:21.19%
  • roaring_blaze_6:3.52%
  • roaring_blaze_7:0.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:205690
  • name:Roaring Blaze
  • tooltip:Damage taken from the Warlock's Immolate increased by $s1%.
  • description:{$@spelldesc205184=Conflagrate increases your remaining Immolate damage on the target by $205690s1% until Immolate expires or is refreshed.}
  • max_stacks:0
  • duration:30.00
  • cooldown:0.00
  • default_chance:0.00%
Roaring Blaze 10.3 36.8 31.0sec 6.4sec 70.41% 70.31% 0.0(0.0) 0.0

Buff details

  • buff initial source:Portal_Pants
  • cooldown name:buff_roaring_blaze
  • max_stacks:100
  • duration:30.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • roaring_blaze_1:9.04%
  • roaring_blaze_2:9.75%
  • roaring_blaze_3:10.56%
  • roaring_blaze_4:16.68%
  • roaring_blaze_5:21.38%
  • roaring_blaze_6:2.99%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:205690
  • name:Roaring Blaze
  • tooltip:Damage taken from the Warlock's Immolate increased by $s1%.
  • description:{$@spelldesc205184=Conflagrate increases your remaining Immolate damage on the target by $205690s1% until Immolate expires or is refreshed.}
  • max_stacks:0
  • duration:30.00
  • cooldown:0.00
  • default_chance:0.00%
Roaring Blaze 10.7 37.9 29.7sec 6.2sec 71.49% 71.21% 0.0(0.0) 0.0

Buff details

  • buff initial source:Norgannon's
  • cooldown name:buff_roaring_blaze
  • max_stacks:100
  • duration:30.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • roaring_blaze_1:9.32%
  • roaring_blaze_2:9.65%
  • roaring_blaze_3:10.44%
  • roaring_blaze_4:16.14%
  • roaring_blaze_5:22.02%
  • roaring_blaze_6:3.92%
  • roaring_blaze_7:0.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:205690
  • name:Roaring Blaze
  • tooltip:Damage taken from the Warlock's Immolate increased by $s1%.
  • description:{$@spelldesc205184=Conflagrate increases your remaining Immolate damage on the target by $205690s1% until Immolate expires or is refreshed.}
  • max_stacks:0
  • duration:30.00
  • cooldown:0.00
  • default_chance:0.00%
Roaring Blaze 10.5 37.3 30.1sec 6.3sec 71.07% 70.77% 0.0(0.0) 0.0

Buff details

  • buff initial source:Alythess'
  • cooldown name:buff_roaring_blaze
  • max_stacks:100
  • duration:30.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • roaring_blaze_1:9.21%
  • roaring_blaze_2:9.90%
  • roaring_blaze_3:10.52%
  • roaring_blaze_4:16.34%
  • roaring_blaze_5:21.77%
  • roaring_blaze_6:3.33%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:205690
  • name:Roaring Blaze
  • tooltip:Damage taken from the Warlock's Immolate increased by $s1%.
  • description:{$@spelldesc205184=Conflagrate increases your remaining Immolate damage on the target by $205690s1% until Immolate expires or is refreshed.}
  • max_stacks:0
  • duration:30.00
  • cooldown:0.00
  • default_chance:0.00%
Roaring Blaze 10.6 37.5 29.9sec 6.2sec 71.34% 71.04% 0.0(0.0) 0.0

Buff details

  • buff initial source:Sephuz
  • cooldown name:buff_roaring_blaze
  • max_stacks:100
  • duration:30.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • roaring_blaze_1:9.33%
  • roaring_blaze_2:9.85%
  • roaring_blaze_3:10.49%
  • roaring_blaze_4:16.20%
  • roaring_blaze_5:21.93%
  • roaring_blaze_6:3.53%
  • roaring_blaze_7:0.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:205690
  • name:Roaring Blaze
  • tooltip:Damage taken from the Warlock's Immolate increased by $s1%.
  • description:{$@spelldesc205184=Conflagrate increases your remaining Immolate damage on the target by $205690s1% until Immolate expires or is refreshed.}
  • max_stacks:0
  • duration:30.00
  • cooldown:0.00
  • default_chance:0.00%
Roaring Blaze 10.4 37.0 30.7sec 6.3sec 70.66% 70.58% 0.0(0.0) 0.0

Buff details

  • buff initial source:KJ_Trinket
  • cooldown name:buff_roaring_blaze
  • max_stacks:100
  • duration:30.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • roaring_blaze_1:9.01%
  • roaring_blaze_2:9.79%
  • roaring_blaze_3:10.54%
  • roaring_blaze_4:16.71%
  • roaring_blaze_5:21.47%
  • roaring_blaze_6:3.13%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:205690
  • name:Roaring Blaze
  • tooltip:Damage taken from the Warlock's Immolate increased by $s1%.
  • description:{$@spelldesc205184=Conflagrate increases your remaining Immolate damage on the target by $205690s1% until Immolate expires or is refreshed.}
  • max_stacks:0
  • duration:30.00
  • cooldown:0.00
  • default_chance:0.00%
Constant Buffs
bleeding

Buff details

  • buff initial source:enemy2
  • cooldown name:buff_bleeding
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • bleeding_1:100.00%
Mortal Wounds

Buff details

  • buff initial source:enemy2
  • cooldown name:buff_mortal_wounds
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:0.25

Stack Uptimes

  • mortal_wounds_1:100.00%

Spelldata details

  • id:115804
  • name:Mortal Wounds
  • tooltip:Healing effects received reduced by $w1%.
  • description:Grievously wounds the target, reducing the effectiveness of any healing received for {$115804d=10 seconds}.
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:101.00%

Procs

Count Interval

Resources

Resource Usage Type Count Total Average RPE APR
enemy2
Resource RPS-Gain RPS-Loss
Health 0.00 6821013.41
Combat End Resource Mean Min Max
Health 74200150.27 0.00 215831367.55

Benefits & Uptimes

Benefits %
Uptimes %

Deaths

death count 118
death count pct 1.18
avg death time 306.93
min death time 262.10
max death time 375.83
dmg taken 2053081513.66

Statistics & Data Analysis

Fight Length
Sample Data enemy2 Fight Length
Count 9999
Mean 300.99
Minimum 217.68
Maximum 385.07
Spread ( max - min ) 167.39
Range [ ( max - min ) / 2 * 100% ] 27.81%
DPS
Sample Data enemy2 Damage Per Second
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
Priority Target DPS
Sample Data enemy2 Priority Target Damage Per Second
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
DPS(e)
Sample Data enemy2 Damage Per Second (Effective)
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Damage
Sample Data enemy2 Damage
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
DTPS
Sample Data enemy2 Damage Taken Per Second
Count 9999
Mean 6836459.19
Minimum 6476805.99
Maximum 7338657.96
Spread ( max - min ) 861851.97
Range [ ( max - min ) / 2 * 100% ] 6.30%
Standard Deviation 136316.1002
5th Percentile 6628344.59
95th Percentile 7061086.05
( 95th Percentile - 5th Percentile ) 432741.47
Mean Distribution
Standard Deviation 1363.2292
95.00% Confidence Intervall ( 6833787.31 - 6839131.07 )
Normalized 95.00% Confidence Intervall ( 99.96% - 100.04% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 16
0.1% Error 1528
0.1 Scale Factor Error with Delta=300 158627316
0.05 Scale Factor Error with Delta=300 634509263
0.01 Scale Factor Error with Delta=300 15862731561
HPS
Sample Data enemy2 Healing Per Second
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
HPS(e)
Sample Data enemy2 Healing Per Second (Effective)
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
Sample Data enemy2 Heal
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
Sample Data enemy2 Healing Taken Per Second
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
TMI
Sample Data enemy2 Theck-Meloree Index
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
ETMI
Sample Data enemy2Theck-Meloree Index (Effective)
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
MSD
Sample Data enemy2 Max Spike Value
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 snapshot_stats

Stats

Raid-Buffed Unbuffed Gear Amount
Strength 0 0 0
Agility 0 0 0
Stamina 0 0 0
Intellect 0 0 0
Spirit 0 0 0
Health 0 2577361201 0
Melee Crit 5.00% 5.00% 0
Spell Crit 0.00% 0.00% 0
Haste 0.00% 0.00% 0
Damage / Heal Versatility 0.00% 0.00% 0
Mitigation Versatility 0.00% 0.00% 0
Mastery 0.00% 0.00% 0
Armor 3474 3474 3474
Run Speed 7 0 0
Tank-Miss 3.00% 3.00% 0
Tank-Dodge 3.00% 3.00% 0
Tank-Parry 3.00% 3.00% 0
Tank-Block 3.00% 3.00% 0
Tank-Crit 0.00% 0.00% 0

Gear

Source Slot Average Item Level: 0.00

Talents

Level
15 none none none
30 none none none
45 none none none
60 none none none
75 none none none
90 none none none
100 none none none

Profile

enemy="enemy2"
level=113
race=humanoid
role=tank
position=front
talents=0000000
spec=unknown

# This default action priority list is automatically created based on your character.
# It is a attempt to provide you with a action list that is both simple and practicable,
# while resulting in a meaningful and good simulation. It may not result in the absolutely highest possible dps.
# Feel free to edit, adapt and improve it to your own needs.
# SimulationCraft is always looking for updates and improvements to the default action lists.

# Executed before combat begins. Accepts non-harmful actions only.
actions.precombat=snapshot_stats

# Executed every time the actor is available.


# Gear Summary
# gear_ilvl=0.00

APM

Average number of actions executed per minute.

APS

Average absorption per active player duration.

Constant Buffs

Buffs received prior to combat and present the entire fight.

Count

Average number of times an action is executed per iteration.

Crit

Average crit damage.

Crit%

Percentage of executes that resulted in critical strikes.

DPE

Average damage per execution of an individual action.

DPET

Average damage per execute time of an individual action; the amount of damage generated, divided by the time taken to execute the action, including time spent in the GCD.

DPR

Average damage per resource point spent.

DPS

Average damage per active player duration.

DPSE

Average damage per fight duration.

DTPS

Average damage taken per second per active player duration.

HPS

Average healing (and absorption) per active player duration.

HPSE

Average healing (and absorption) per fight duration.

HPE

Average healing (or absorb) per execution of an individual action.

HPET

Average healing (or absorb) per execute time of an individual action; the amount of healing generated, divided by the time taken to execute the action, including time spent in the GCD.

HPR

Average healing (or absorb) per resource point spent.

Impacts

Average number of impacts against a target (for attacks that hit multiple times per execute) per iteration.

Dodge%

Percentage of executes that resulted in dodges.

DPS%

Percentage of total DPS contributed by a particular action.

HPS%

Percentage of total HPS (including absorb) contributed by a particular action.

Theck-Meloree Index

Measure of damage smoothness, calculated over entire fight length. Related to max spike damage, 1k TMI is roughly equivalent to 1% of your health. TMI ignores external healing and absorbs. Lower is better.

TMI bin size

Time bin size used to calculate TMI and MSD, in seconds.

Type

Direct or Periodic damage.

Max Spike Damage Frequency

This is roughly how many spikes as large as MSD Mean you take per iteration. Calculated from TMI and MSD values.

Dynamic Buffs

Temporary buffs received during combat, perhaps multiple times.

Glance%

Percentage of executes that resulted in glancing blows.

Block%

Percentage of executes that resulted in blocking blows.

Id

Associated spell-id for this ability.

Ability

Name of the ability.

Total

Total damage for this ability during the fight.

Hit

Average non-crit damage.

Interval

Average time between executions of a particular action.

Avg

Average direct damage per execution.

Miss%

Percentage of executes that resulted in misses, dodges or parries.

Origin

The player profile from which the simulation script was generated. The profile must be copied into the same directory as this HTML file in order for the link to work.

Parry%

Percentage of executes that resulted in parries.

RPS In

Average primary resource points generated per second.

RPS Out

Average primary resource points consumed per second.

Scale Factors

Gain per unit stat increase except for Hit/Expertise which represent Loss per unit stat decrease.

Gear Amount

Amount from raw gear, before class, attunement, or buff modifiers. Amount from hybrid primary stats (i.e. Agility/Intellect) shown in parentheses.

Stats Raid Buffed

Amount after all static buffs have been accounted for. Dynamic buffs (i.e. trinkets, potions) not included.

Stats Unbuffed

Amount after class modifiers and effects, but before buff modifiers.

Ticks

Average number of periodic ticks per iteration. Spells that do not have a damage-over-time component will have zero ticks.

Ticks Crit

Average crit tick damage.

Ticks Crit%

Percentage of ticks that resulted in critical strikes.

Ticks Hit

Average non-crit tick damage.

Ticks Miss%

Percentage of ticks that resulted in misses, dodges or parries.

Ticks Uptime%

Percentage of total time that DoT is ticking on target.

Ticks Avg

Average damage per tick.

Timeline Distribution

The simulated encounter's duration can vary based on the health of the target and variation in the raid DPS. This chart shows how often the duration of the encounter varied by how much time.

Waiting

This is the percentage of time in which no action can be taken other than autoattacks. This can be caused by resource starvation, lockouts, and timers.

Scale Factor Ranking

This row ranks the scale factors from highest to lowest, checking whether one scale factor is higher/lower than another with statistical significance.

TMI Range

This is the range of TMI values containing 95.00% of the data, roughly centered on the mean.

TMI/MSD Window

Window length used to calculate TMI and MSD, in seconds.

Max Spike Damage

Maximum amount of net damage taken in any N-second period (default 6sec), expressed as a percentage of max health. Calculated independently for each iteration. 'MSD Min/Mean/Max' are the lowest/average/highest MSDs out of all iterations.

Error

Estimator for the 95.00% confidence interval.

Range

This is the range of values containing 95.00% of the data, roughly centered on the mean.

Fight Length

Fight Length: 300.00
Vary Combat Length: 0.20

Fight Length is the specified average fight duration. If vary_combat_length is set, the fight length will vary by +/- that portion of the value. See Combat Length in the wiki for further details.